Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6386
Gene name
LocationContig_654:7528..9643
Strand+
Gene length (bp)2115
Transcript length (bp)2115
Coding sequence length (bp)2115
Protein length (aa) 705

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10263 SprT-like SprT-like family 3.9E-36 443 574
PF17283 Zn_ribbon_SprT SprT-like zinc ribbon domain 5.3E-10 580 617

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O42953|YGM4_SCHPO HMG box-containing protein C19G7.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC19G7.04 PE=4 SV=2 411 670 1.0E-39
sp|Q96QF7|ACRC_HUMAN Acidic repeat-containing protein OS=Homo sapiens GN=ACRC PE=2 SV=1 505 627 1.0E-10

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6386
MARLAQCPSRSDNEPLQPNTRAQNHELDNLASSAKSTTGDYKDNTKGFVLKSQSTTTLVRKMRRIKDSHAPPPTL
AYGMHEDGFKAQSLLPSTSLSPAKVRETCCIAHNSINHQTGLESSLSMIKRTTCLDDIKSDRESDRVMTPEYYSS
CESPFNPIIRQPYSRGHFITRDKNDIRRNNSQESIRRDSYLDNSTKSATEDQGGGDVNDGEETSSVYQTAAEDLT
TNEIDSDCTRDEPAQGLVDTHVSVFETDSGSNRSDSIHSHLESNDPSVEVRPQLKKPVGSYLPQNIFSDPNLEHH
QGQGVMPTFQQKATPPQTESLGETESSTLSTGPQIRPLRLGKVAHELLERPYKMDEWAVSTSSLDSSEDAEANKD
QIEIPFTTPRIKKANTLGLTLPCDLPGNLTKSYEPSALEPRDKVAPVKSSPSKKKTKSIFDNRKDTVAKDFLSEL
DAKITKGEIARLTQLTGGVKVIWTKSLNTTAGRANWRRETTQSRPADGTAKLEQRHHASIELAEKVINDESKLLN
VVAHEFCHLANFMISGVNNRPHGVEFQAWAAKCSRAFGESHGIHVTTRHTYDIDFKYVWRCTTCGYEYKRHSRSI
KPGRHGCGNCKGTLEQIKPVPRVAKGGATGSATGNPNQYQTFMKKHMKIVRSENPGSPQKDLMKMVAERWALDKK
KAMTESMAKTGDETIGGVVDQMEQMTLNQ*
Coding >OphauG2|6386
ATGGCTCGATTGGCTCAGTGCCCTTCAAGAAGCGATAATGAGCCTTTACAGCCAAATACCCGTGCCCAAAACCAT
GAGCTAGACAACTTGGCCTCAAGCGCAAAATCCACTACGGGCGACTATAAAGACAACACTAAAGGCTTCGTCCTC
AAGTCCCAGTCTACAACAACTTTGGTGCGCAAAATGCGTCGAATCAAGGACTCACATGCACCTCCTCCAACGCTT
GCCTATGGCATGCACGAAGATGGGTTCAAGGCTCAATCATTGCTCCCTTCGACATCATTAAGCCCAGCGAAGGTC
AGGGAAACATGTTGTATCGCGCACAATAGTATAAATCATCAGACTGGTCTAGAATCTTCTTTATCCATGATCAAA
CGTACCACATGTCTAGACGATATCAAATCAGACCGGGAATCGGACCGGGTAATGACGCCCGAATATTATAGCTCC
TGCGAAAGCCCCTTCAACCCAATTATTCGTCAGCCTTATTCGCGCGGCCACTTTATCACTAGAGACAAGAATGAC
ATCCGTCGAAATAATAGTCAGGAGTCTATCAGGCGTGACTCATATCTCGACAACAGTACCAAATCTGCTACAGAG
GATCAAGGCGGGGGAGATGTGAACGATGGAGAAGAGACTTCCAGCGTATATCAAACTGCGGCTGAGGACTTGACA
ACCAACGAAATTGACAGCGACTGTACCCGCGATGAGCCTGCCCAAGGCTTGGTGGACACGCATGTATCAGTTTTC
GAGACAGACTCCGGTTCGAATCGGAGCGACAGTATCCATTCCCACTTGGAGTCGAATGACCCCAGTGTTGAAGTC
AGACCCCAATTGAAGAAGCCAGTTGGCAGTTATTTGCCGCAGAATATATTTTCAGACCCCAATTTGGAGCACCAC
CAAGGCCAAGGCGTGATGCCAACGTTTCAACAAAAAGCCACTCCGCCTCAGACAGAGAGTTTAGGAGAAACGGAG
TCAAGCACACTGTCTACTGGGCCCCAAATCCGACCCTTGAGATTAGGAAAAGTGGCGCATGAATTGTTGGAAAGA
CCTTACAAGATGGACGAATGGGCAGTTTCAACGAGTAGCCTTGATTCGAGTGAGGATGCAGAAGCCAACAAGGAT
CAAATCGAAATACCGTTCACGACGCCACGCATAAAGAAAGCGAATACTCTAGGCCTCACTCTACCATGCGATTTG
CCCGGGAACTTGACGAAATCTTATGAACCAAGTGCTCTTGAGCCACGGGACAAGGTGGCGCCAGTCAAGTCGAGC
CCGAGCAAGAAGAAAACAAAGAGCATATTTGACAACAGAAAGGACACTGTTGCCAAGGATTTTCTTAGCGAGCTC
GATGCCAAGATTACCAAAGGAGAAATTGCTAGGCTGACTCAGTTGACGGGCGGTGTCAAGGTAATATGGACCAAG
TCACTCAATACGACAGCCGGCAGAGCCAACTGGCGTCGGGAGACGACACAGAGCAGACCAGCAGACGGTACAGCC
AAATTGGAGCAAAGGCATCACGCATCAATTGAATTGGCCGAGAAGGTAATCAACGACGAGAGCAAACTATTGAAT
GTAGTAGCTCACGAGTTTTGCCACTTGGCCAACTTTATGATAAGTGGCGTCAACAACAGACCGCACGGAGTCGAA
TTTCAAGCATGGGCAGCCAAGTGCTCACGAGCTTTTGGAGAGTCCCATGGTATCCATGTGACAACTAGGCACACA
TACGATATTGACTTTAAATATGTGTGGAGGTGTACTACTTGCGGCTATGAGTATAAGCGGCACTCGAGAAGTATC
AAACCGGGACGACATGGGTGCGGCAACTGCAAAGGCACCCTCGAGCAGATCAAACCAGTACCTCGTGTCGCCAAG
GGCGGCGCAACTGGCAGCGCAACTGGCAACCCAAACCAGTATCAAACTTTTATGAAGAAGCACATGAAAATAGTG
AGGAGCGAGAACCCAGGCAGCCCTCAGAAAGACTTGATGAAAATGGTGGCTGAACGCTGGGCTCTTGACAAAAAG
AAGGCTATGACTGAGAGCATGGCCAAGACTGGTGACGAGACTATTGGCGGCGTTGTTGACCAGATGGAACAAATG
ACTCTCAATCAATGA
Transcript >OphauG2|6386
ATGGCTCGATTGGCTCAGTGCCCTTCAAGAAGCGATAATGAGCCTTTACAGCCAAATACCCGTGCCCAAAACCAT
GAGCTAGACAACTTGGCCTCAAGCGCAAAATCCACTACGGGCGACTATAAAGACAACACTAAAGGCTTCGTCCTC
AAGTCCCAGTCTACAACAACTTTGGTGCGCAAAATGCGTCGAATCAAGGACTCACATGCACCTCCTCCAACGCTT
GCCTATGGCATGCACGAAGATGGGTTCAAGGCTCAATCATTGCTCCCTTCGACATCATTAAGCCCAGCGAAGGTC
AGGGAAACATGTTGTATCGCGCACAATAGTATAAATCATCAGACTGGTCTAGAATCTTCTTTATCCATGATCAAA
CGTACCACATGTCTAGACGATATCAAATCAGACCGGGAATCGGACCGGGTAATGACGCCCGAATATTATAGCTCC
TGCGAAAGCCCCTTCAACCCAATTATTCGTCAGCCTTATTCGCGCGGCCACTTTATCACTAGAGACAAGAATGAC
ATCCGTCGAAATAATAGTCAGGAGTCTATCAGGCGTGACTCATATCTCGACAACAGTACCAAATCTGCTACAGAG
GATCAAGGCGGGGGAGATGTGAACGATGGAGAAGAGACTTCCAGCGTATATCAAACTGCGGCTGAGGACTTGACA
ACCAACGAAATTGACAGCGACTGTACCCGCGATGAGCCTGCCCAAGGCTTGGTGGACACGCATGTATCAGTTTTC
GAGACAGACTCCGGTTCGAATCGGAGCGACAGTATCCATTCCCACTTGGAGTCGAATGACCCCAGTGTTGAAGTC
AGACCCCAATTGAAGAAGCCAGTTGGCAGTTATTTGCCGCAGAATATATTTTCAGACCCCAATTTGGAGCACCAC
CAAGGCCAAGGCGTGATGCCAACGTTTCAACAAAAAGCCACTCCGCCTCAGACAGAGAGTTTAGGAGAAACGGAG
TCAAGCACACTGTCTACTGGGCCCCAAATCCGACCCTTGAGATTAGGAAAAGTGGCGCATGAATTGTTGGAAAGA
CCTTACAAGATGGACGAATGGGCAGTTTCAACGAGTAGCCTTGATTCGAGTGAGGATGCAGAAGCCAACAAGGAT
CAAATCGAAATACCGTTCACGACGCCACGCATAAAGAAAGCGAATACTCTAGGCCTCACTCTACCATGCGATTTG
CCCGGGAACTTGACGAAATCTTATGAACCAAGTGCTCTTGAGCCACGGGACAAGGTGGCGCCAGTCAAGTCGAGC
CCGAGCAAGAAGAAAACAAAGAGCATATTTGACAACAGAAAGGACACTGTTGCCAAGGATTTTCTTAGCGAGCTC
GATGCCAAGATTACCAAAGGAGAAATTGCTAGGCTGACTCAGTTGACGGGCGGTGTCAAGGTAATATGGACCAAG
TCACTCAATACGACAGCCGGCAGAGCCAACTGGCGTCGGGAGACGACACAGAGCAGACCAGCAGACGGTACAGCC
AAATTGGAGCAAAGGCATCACGCATCAATTGAATTGGCCGAGAAGGTAATCAACGACGAGAGCAAACTATTGAAT
GTAGTAGCTCACGAGTTTTGCCACTTGGCCAACTTTATGATAAGTGGCGTCAACAACAGACCGCACGGAGTCGAA
TTTCAAGCATGGGCAGCCAAGTGCTCACGAGCTTTTGGAGAGTCCCATGGTATCCATGTGACAACTAGGCACACA
TACGATATTGACTTTAAATATGTGTGGAGGTGTACTACTTGCGGCTATGAGTATAAGCGGCACTCGAGAAGTATC
AAACCGGGACGACATGGGTGCGGCAACTGCAAAGGCACCCTCGAGCAGATCAAACCAGTACCTCGTGTCGCCAAG
GGCGGCGCAACTGGCAGCGCAACTGGCAACCCAAACCAGTATCAAACTTTTATGAAGAAGCACATGAAAATAGTG
AGGAGCGAGAACCCAGGCAGCCCTCAGAAAGACTTGATGAAAATGGTGGCTGAACGCTGGGCTCTTGACAAAAAG
AAGGCTATGACTGAGAGCATGGCCAAGACTGGTGACGAGACTATTGGCGGCGTTGTTGACCAGATGGAACAAATG
ACTCTCAATCAATGA
Gene >OphauG2|6386
ATGGCTCGATTGGCTCAGTGCCCTTCAAGAAGCGATAATGAGCCTTTACAGCCAAATACCCGTGCCCAAAACCAT
GAGCTAGACAACTTGGCCTCAAGCGCAAAATCCACTACGGGCGACTATAAAGACAACACTAAAGGCTTCGTCCTC
AAGTCCCAGTCTACAACAACTTTGGTGCGCAAAATGCGTCGAATCAAGGACTCACATGCACCTCCTCCAACGCTT
GCCTATGGCATGCACGAAGATGGGTTCAAGGCTCAATCATTGCTCCCTTCGACATCATTAAGCCCAGCGAAGGTC
AGGGAAACATGTTGTATCGCGCACAATAGTATAAATCATCAGACTGGTCTAGAATCTTCTTTATCCATGATCAAA
CGTACCACATGTCTAGACGATATCAAATCAGACCGGGAATCGGACCGGGTAATGACGCCCGAATATTATAGCTCC
TGCGAAAGCCCCTTCAACCCAATTATTCGTCAGCCTTATTCGCGCGGCCACTTTATCACTAGAGACAAGAATGAC
ATCCGTCGAAATAATAGTCAGGAGTCTATCAGGCGTGACTCATATCTCGACAACAGTACCAAATCTGCTACAGAG
GATCAAGGCGGGGGAGATGTGAACGATGGAGAAGAGACTTCCAGCGTATATCAAACTGCGGCTGAGGACTTGACA
ACCAACGAAATTGACAGCGACTGTACCCGCGATGAGCCTGCCCAAGGCTTGGTGGACACGCATGTATCAGTTTTC
GAGACAGACTCCGGTTCGAATCGGAGCGACAGTATCCATTCCCACTTGGAGTCGAATGACCCCAGTGTTGAAGTC
AGACCCCAATTGAAGAAGCCAGTTGGCAGTTATTTGCCGCAGAATATATTTTCAGACCCCAATTTGGAGCACCAC
CAAGGCCAAGGCGTGATGCCAACGTTTCAACAAAAAGCCACTCCGCCTCAGACAGAGAGTTTAGGAGAAACGGAG
TCAAGCACACTGTCTACTGGGCCCCAAATCCGACCCTTGAGATTAGGAAAAGTGGCGCATGAATTGTTGGAAAGA
CCTTACAAGATGGACGAATGGGCAGTTTCAACGAGTAGCCTTGATTCGAGTGAGGATGCAGAAGCCAACAAGGAT
CAAATCGAAATACCGTTCACGACGCCACGCATAAAGAAAGCGAATACTCTAGGCCTCACTCTACCATGCGATTTG
CCCGGGAACTTGACGAAATCTTATGAACCAAGTGCTCTTGAGCCACGGGACAAGGTGGCGCCAGTCAAGTCGAGC
CCGAGCAAGAAGAAAACAAAGAGCATATTTGACAACAGAAAGGACACTGTTGCCAAGGATTTTCTTAGCGAGCTC
GATGCCAAGATTACCAAAGGAGAAATTGCTAGGCTGACTCAGTTGACGGGCGGTGTCAAGGTAATATGGACCAAG
TCACTCAATACGACAGCCGGCAGAGCCAACTGGCGTCGGGAGACGACACAGAGCAGACCAGCAGACGGTACAGCC
AAATTGGAGCAAAGGCATCACGCATCAATTGAATTGGCCGAGAAGGTAATCAACGACGAGAGCAAACTATTGAAT
GTAGTAGCTCACGAGTTTTGCCACTTGGCCAACTTTATGATAAGTGGCGTCAACAACAGACCGCACGGAGTCGAA
TTTCAAGCATGGGCAGCCAAGTGCTCACGAGCTTTTGGAGAGTCCCATGGTATCCATGTGACAACTAGGCACACA
TACGATATTGACTTTAAATATGTGTGGAGGTGTACTACTTGCGGCTATGAGTATAAGCGGCACTCGAGAAGTATC
AAACCGGGACGACATGGGTGCGGCAACTGCAAAGGCACCCTCGAGCAGATCAAACCAGTACCTCGTGTCGCCAAG
GGCGGCGCAACTGGCAGCGCAACTGGCAACCCAAACCAGTATCAAACTTTTATGAAGAAGCACATGAAAATAGTG
AGGAGCGAGAACCCAGGCAGCCCTCAGAAAGACTTGATGAAAATGGTGGCTGAACGCTGGGCTCTTGACAAAAAG
AAGGCTATGACTGAGAGCATGGCCAAGACTGGTGACGAGACTATTGGCGGCGTTGTTGACCAGATGGAACAAATG
ACTCTCAATCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail