Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6374
Gene name
LocationContig_652:3088..6030
Strand-
Gene length (bp)2942
Transcript length (bp)2877
Coding sequence length (bp)2877
Protein length (aa) 959

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01055 Glyco_hydro_31 Glycosyl hydrolases family 31 1.1E-115 251 819
PF16863 NtCtMGAM_N N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase 6.5E-36 46 157
PF13802 Gal_mutarotas_2 Galactose mutarotase-like 2.3E-13 161 223

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WRH9|AGDC_ASPFU Probable alpha/beta-glucosidase agdC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=agdC PE=3 SV=1 32 903 0.0E+00
sp|B0XNL6|AGDC_ASPFC Probable alpha/beta-glucosidase agdC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=agdC PE=3 SV=1 32 903 0.0E+00
sp|B8MZ41|AGDC_ASPFN Probable alpha/beta-glucosidase agdC OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=agdC PE=3 SV=1 25 944 0.0E+00
sp|Q2UQV7|AGDC_ASPOR Probable alpha/beta-glucosidase agdC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=agdC PE=3 SV=1 25 944 0.0E+00
sp|A1CNK4|AGDC_ASPCL Probable alpha/beta-glucosidase agdC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=agdC PE=3 SV=1 17 944 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WRH9|AGDC_ASPFU Probable alpha/beta-glucosidase agdC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=agdC PE=3 SV=1 32 903 0.0E+00
sp|B0XNL6|AGDC_ASPFC Probable alpha/beta-glucosidase agdC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=agdC PE=3 SV=1 32 903 0.0E+00
sp|B8MZ41|AGDC_ASPFN Probable alpha/beta-glucosidase agdC OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=agdC PE=3 SV=1 25 944 0.0E+00
sp|Q2UQV7|AGDC_ASPOR Probable alpha/beta-glucosidase agdC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=agdC PE=3 SV=1 25 944 0.0E+00
sp|A1CNK4|AGDC_ASPCL Probable alpha/beta-glucosidase agdC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=agdC PE=3 SV=1 17 944 0.0E+00
sp|A1D1E6|AGDC_NEOFI Probable alpha/beta-glucosidase agdC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=agdC PE=3 SV=1 26 903 0.0E+00
sp|Q0CMA7|AGDC_ASPTN Probable alpha/beta-glucosidase agdC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=agdC PE=3 SV=1 27 909 0.0E+00
sp|Q5AWI5|AGDC_EMENI Alpha/beta-glucosidase agdC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=agdC PE=2 SV=2 32 911 0.0E+00
sp|D4B0X3|AGD1_ARTBC Probable alpha/beta-glucosidase ARB_02101 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02101 PE=1 SV=1 5 442 9.0E-140
sp|Q9C0Y4|AGLU_SCHPO Alpha-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=agl1 PE=1 SV=2 32 903 2.0E-138
sp|Q09901|YAJ1_SCHPO Uncharacterized family 31 glucosidase C30D11.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC30D11.01c PE=3 SV=2 32 903 3.0E-133
sp|Q9URX4|YFZB_SCHPO Uncharacterized family 31 glucosidase C1039.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.11c PE=3 SV=1 30 907 1.0E-132
sp|O74254|AMYG_CANAL Glucoamylase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GAM1 PE=1 SV=2 31 912 6.0E-115
sp|Q92442|AGLU_MUCJA Alpha-glucosidase OS=Mucor javanicus PE=1 SV=1 1 861 2.0E-108
sp|P29064|AGLU_CANTS Alpha-glucosidase OS=Candida tsukubaensis PE=1 SV=1 3 861 9.0E-89
sp|Q653V7|AGLU_ORYSJ Probable alpha-glucosidase Os06g0675700 OS=Oryza sativa subsp. japonica GN=Os06g0675700 PE=1 SV=1 64 460 6.0E-81
sp|P56526|AGLU_ASPNG Alpha-glucosidase OS=Aspergillus niger GN=aglA PE=1 SV=1 20 434 4.0E-75
sp|O04931|AGLU_BETVU Alpha-glucosidase OS=Beta vulgaris PE=1 SV=1 3 434 4.0E-74
sp|Q9S7Y7|XYL1_ARATH Alpha-xylosidase 1 OS=Arabidopsis thaliana GN=XYL1 PE=1 SV=1 25 480 7.0E-74
sp|Q43763|AGLU_HORVU Alpha-glucosidase OS=Hordeum vulgare PE=2 SV=1 47 434 2.0E-73
sp|O04893|AGLU_SPIOL Alpha-glucosidase OS=Spinacia oleracea PE=1 SV=1 60 434 1.0E-72
sp|P70699|LYAG_MOUSE Lysosomal alpha-glucosidase OS=Mus musculus GN=Gaa PE=1 SV=2 33 434 9.0E-67
sp|F4J6T7|XYL2_ARATH Putative alpha-xylosidase 2 OS=Arabidopsis thaliana GN=XYL2 PE=5 SV=1 56 432 3.0E-66
sp|Q12558|AGLU_ASPOR Alpha-glucosidase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=agdA PE=2 SV=1 20 410 4.0E-66
sp|Q6P7A9|LYAG_RAT Lysosomal alpha-glucosidase OS=Rattus norvegicus GN=Gaa PE=2 SV=1 33 434 1.0E-63
sp|Q5R7A9|LYAG_PONAB Lysosomal alpha-glucosidase OS=Pongo abelii GN=GAA PE=2 SV=1 33 434 9.0E-63
sp|D4B0X3|AGD1_ARTBC Probable alpha/beta-glucosidase ARB_02101 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02101 PE=1 SV=1 533 918 3.0E-62
sp|P10253|LYAG_HUMAN Lysosomal alpha-glucosidase OS=Homo sapiens GN=GAA PE=1 SV=4 33 434 3.0E-62
sp|Q9MYM4|LYAG_BOVIN Lysosomal alpha-glucosidase OS=Bos taurus GN=GAA PE=2 SV=1 61 434 7.0E-62
sp|P22861|AMYG_SCHOC Glucoamylase 1 OS=Schwanniomyces occidentalis GN=GAM1 PE=1 SV=1 34 389 1.0E-61
sp|O43451|MGA_HUMAN Maltase-glucoamylase, intestinal OS=Homo sapiens GN=MGAM PE=1 SV=5 60 434 3.0E-57
sp|Q2M2H8|MGAL_HUMAN Probable maltase-glucoamylase 2 OS=Homo sapiens GN=MGAM2 PE=2 SV=3 34 434 1.0E-53
sp|Q43763|AGLU_HORVU Alpha-glucosidase OS=Hordeum vulgare PE=2 SV=1 522 884 4.0E-51
sp|P07768|SUIS_RABIT Sucrase-isomaltase, intestinal OS=Oryctolagus cuniculus GN=SI PE=1 SV=3 34 434 5.0E-50
sp|O00906|AGLU_TETPY Lysosomal acid alpha-glucosidase OS=Tetrahymena pyriformis PE=1 SV=1 65 899 7.0E-50
sp|O43451|MGA_HUMAN Maltase-glucoamylase, intestinal OS=Homo sapiens GN=MGAM PE=1 SV=5 19 434 2.0E-49
sp|O62653|SUIS_SUNMU Sucrase-isomaltase, intestinal OS=Suncus murinus GN=SI PE=2 SV=3 61 434 5.0E-48
sp|Q2M2H8|MGAL_HUMAN Probable maltase-glucoamylase 2 OS=Homo sapiens GN=MGAM2 PE=2 SV=3 30 434 2.0E-47
sp|Q653V7|AGLU_ORYSJ Probable alpha-glucosidase Os06g0675700 OS=Oryza sativa subsp. japonica GN=Os06g0675700 PE=1 SV=1 522 881 4.0E-47
sp|P14410|SUIS_HUMAN Sucrase-isomaltase, intestinal OS=Homo sapiens GN=SI PE=1 SV=6 35 434 3.0E-46
sp|P07768|SUIS_RABIT Sucrase-isomaltase, intestinal OS=Oryctolagus cuniculus GN=SI PE=1 SV=3 46 434 8.0E-46
sp|Q12558|AGLU_ASPOR Alpha-glucosidase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=agdA PE=2 SV=1 561 861 4.0E-45
sp|P23739|SUIS_RAT Sucrase-isomaltase, intestinal OS=Rattus norvegicus GN=Si PE=1 SV=5 46 434 7.0E-45
sp|P56526|AGLU_ASPNG Alpha-glucosidase OS=Aspergillus niger GN=aglA PE=1 SV=1 561 861 2.0E-44
sp|P23739|SUIS_RAT Sucrase-isomaltase, intestinal OS=Rattus norvegicus GN=Si PE=1 SV=5 34 434 2.0E-43
sp|P14410|SUIS_HUMAN Sucrase-isomaltase, intestinal OS=Homo sapiens GN=SI PE=1 SV=6 34 434 5.0E-43
sp|O04893|AGLU_SPIOL Alpha-glucosidase OS=Spinacia oleracea PE=1 SV=1 538 903 4.0E-41
sp|O62653|SUIS_SUNMU Sucrase-isomaltase, intestinal OS=Suncus murinus GN=SI PE=2 SV=3 35 434 1.0E-40
sp|P14410|SUIS_HUMAN Sucrase-isomaltase, intestinal OS=Homo sapiens GN=SI PE=1 SV=6 561 884 1.0E-39
sp|P23739|SUIS_RAT Sucrase-isomaltase, intestinal OS=Rattus norvegicus GN=Si PE=1 SV=5 561 884 1.0E-39
sp|O04931|AGLU_BETVU Alpha-glucosidase OS=Beta vulgaris PE=1 SV=1 525 885 4.0E-39
sp|P07768|SUIS_RABIT Sucrase-isomaltase, intestinal OS=Oryctolagus cuniculus GN=SI PE=1 SV=3 533 903 5.0E-38
sp|Q9S7Y7|XYL1_ARATH Alpha-xylosidase 1 OS=Arabidopsis thaliana GN=XYL1 PE=1 SV=1 560 858 3.0E-36
sp|Q9MYM4|LYAG_BOVIN Lysosomal alpha-glucosidase OS=Bos taurus GN=GAA PE=2 SV=1 533 912 5.0E-36
sp|Q5R7A9|LYAG_PONAB Lysosomal alpha-glucosidase OS=Pongo abelii GN=GAA PE=2 SV=1 522 912 8.0E-36
sp|Q9F234|AGL2_BACTQ Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens PE=3 SV=1 162 434 9.0E-36
sp|Q2M2H8|MGAL_HUMAN Probable maltase-glucoamylase 2 OS=Homo sapiens GN=MGAM2 PE=2 SV=3 561 914 1.0E-35
sp|P70699|LYAG_MOUSE Lysosomal alpha-glucosidase OS=Mus musculus GN=Gaa PE=1 SV=2 561 912 4.0E-35
sp|Q6P7A9|LYAG_RAT Lysosomal alpha-glucosidase OS=Rattus norvegicus GN=Gaa PE=2 SV=1 542 912 4.0E-35
sp|P10253|LYAG_HUMAN Lysosomal alpha-glucosidase OS=Homo sapiens GN=GAA PE=1 SV=4 522 912 1.0E-34
sp|F4J6T7|XYL2_ARATH Putative alpha-xylosidase 2 OS=Arabidopsis thaliana GN=XYL2 PE=5 SV=1 561 934 2.0E-34
sp|Q9US55|GLU2A_SCHPO Glucosidase 2 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gls2 PE=3 SV=1 548 877 8.0E-34
sp|O62653|SUIS_SUNMU Sucrase-isomaltase, intestinal OS=Suncus murinus GN=SI PE=2 SV=3 561 954 1.0E-33
sp|O43451|MGA_HUMAN Maltase-glucoamylase, intestinal OS=Homo sapiens GN=MGAM PE=1 SV=5 561 904 9.0E-33
sp|Q94502|GANAB_DICDI Neutral alpha-glucosidase AB OS=Dictyostelium discoideum GN=modA PE=3 SV=1 569 904 2.0E-32
sp|Q8BHN3|GANAB_MOUSE Neutral alpha-glucosidase AB OS=Mus musculus GN=Ganab PE=1 SV=1 565 905 3.0E-32
sp|O43451|MGA_HUMAN Maltase-glucoamylase, intestinal OS=Homo sapiens GN=MGAM PE=1 SV=5 533 905 6.0E-32
sp|P14410|SUIS_HUMAN Sucrase-isomaltase, intestinal OS=Homo sapiens GN=SI PE=1 SV=6 557 915 2.0E-31
sp|Q14697|GANAB_HUMAN Neutral alpha-glucosidase AB OS=Homo sapiens GN=GANAB PE=1 SV=3 565 905 2.0E-31
sp|O62653|SUIS_SUNMU Sucrase-isomaltase, intestinal OS=Suncus murinus GN=SI PE=2 SV=3 579 942 3.0E-31
sp|P79403|GANAB_PIG Neutral alpha-glucosidase AB OS=Sus scrofa GN=GANAB PE=1 SV=1 565 905 3.0E-31
sp|Q2M2H8|MGAL_HUMAN Probable maltase-glucoamylase 2 OS=Homo sapiens GN=MGAM2 PE=2 SV=3 579 894 6.0E-31
sp|P07768|SUIS_RABIT Sucrase-isomaltase, intestinal OS=Oryctolagus cuniculus GN=SI PE=1 SV=3 556 867 6.0E-31
sp|B9F676|GLU2A_ORYSJ Probable glucan 1,3-alpha-glucosidase OS=Oryza sativa subsp. japonica GN=Os03g0216600 PE=3 SV=1 565 912 7.0E-31
sp|Q9FN05|PSL5_ARATH Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana GN=PSL5 PE=1 SV=1 565 887 1.0E-30
sp|Q8BVW0|GANC_MOUSE Neutral alpha-glucosidase C OS=Mus musculus GN=Ganc PE=1 SV=2 580 892 2.0E-30
sp|Q8BHN3|GANAB_MOUSE Neutral alpha-glucosidase AB OS=Mus musculus GN=Ganab PE=1 SV=1 74 434 4.0E-30
sp|Q4R4N7|GANAB_MACFA Neutral alpha-glucosidase AB OS=Macaca fascicularis GN=GANAB PE=2 SV=1 565 905 4.0E-30
sp|Q14697|GANAB_HUMAN Neutral alpha-glucosidase AB OS=Homo sapiens GN=GANAB PE=1 SV=3 69 434 7.0E-30
sp|Q4R4N7|GANAB_MACFA Neutral alpha-glucosidase AB OS=Macaca fascicularis GN=GANAB PE=2 SV=1 69 434 7.0E-30
sp|Q8TET4|GANC_HUMAN Neutral alpha-glucosidase C OS=Homo sapiens GN=GANC PE=2 SV=3 548 903 7.0E-30
sp|Q9BE70|GANC_MACFA Neutral alpha-glucosidase C (Fragment) OS=Macaca fascicularis GN=GANC PE=2 SV=2 548 903 8.0E-30
sp|P79403|GANAB_PIG Neutral alpha-glucosidase AB OS=Sus scrofa GN=GANAB PE=1 SV=1 150 411 2.0E-29
sp|Q8TET4|GANC_HUMAN Neutral alpha-glucosidase C OS=Homo sapiens GN=GANC PE=2 SV=3 162 445 5.0E-28
sp|Q9BE70|GANC_MACFA Neutral alpha-glucosidase C (Fragment) OS=Macaca fascicularis GN=GANC PE=2 SV=2 161 445 2.0E-27
sp|Q8BVW0|GANC_MOUSE Neutral alpha-glucosidase C OS=Mus musculus GN=Ganc PE=1 SV=2 161 434 5.0E-26
sp|D0KQM8|AGLU_SULS9 Alpha-glucosidase OS=Sulfolobus solfataricus (strain 98/2) GN=malA PE=1 SV=1 121 434 3.0E-24
sp|P0CD66|AGLU_SULSO Alpha-glucosidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=malA PE=1 SV=1 121 434 3.0E-24
sp|P38138|GLU2A_YEAST Glucosidase 2 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROT2 PE=1 SV=1 569 859 7.0E-24
sp|P23739|SUIS_RAT Sucrase-isomaltase, intestinal OS=Rattus norvegicus GN=Si PE=1 SV=5 579 917 9.0E-24
sp|Q9F234|AGL2_BACTQ Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens PE=3 SV=1 562 859 1.0E-22
sp|Q9FN05|PSL5_ARATH Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana GN=PSL5 PE=1 SV=1 162 413 2.0E-22
sp|Q9US55|GLU2A_SCHPO Glucosidase 2 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gls2 PE=3 SV=1 161 434 4.0E-21
sp|Q94502|GANAB_DICDI Neutral alpha-glucosidase AB OS=Dictyostelium discoideum GN=modA PE=3 SV=1 162 434 1.0E-20
sp|B3PEE6|OL4AG_CELJU Oligosaccharide 4-alpha-D-glucosyltransferase OS=Cellvibrio japonicus (strain Ueda107) GN=agd31B PE=1 SV=1 569 870 7.0E-20
sp|P38138|GLU2A_YEAST Glucosidase 2 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROT2 PE=1 SV=1 161 434 3.0E-18
sp|B9F676|GLU2A_ORYSJ Probable glucan 1,3-alpha-glucosidase OS=Oryza sativa subsp. japonica GN=Os03g0216600 PE=3 SV=1 196 434 4.0E-18
sp|D0KQM8|AGLU_SULS9 Alpha-glucosidase OS=Sulfolobus solfataricus (strain 98/2) GN=malA PE=1 SV=1 601 820 7.0E-18
sp|P0CD66|AGLU_SULSO Alpha-glucosidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=malA PE=1 SV=1 601 820 7.0E-18
sp|P31434|XYLS_ECOLI Alpha-xylosidase OS=Escherichia coli (strain K12) GN=yicI PE=1 SV=2 162 434 6.0E-13
sp|Q9P999|XYLS_SULSO Alpha-xylosidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=xylS PE=1 SV=1 567 884 8.0E-09
sp|Q5AW25|AGDD_EMENI Alpha-xylosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=agdD PE=1 SV=1 162 394 3.0E-08
sp|A7LXT0|GH31A_BACO1 Alpha-xylosidase BoGH31A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) GN=BACOVA_02646 PE=1 SV=1 247 438 1.0E-07
sp|Q5AW25|AGDD_EMENI Alpha-xylosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=agdD PE=1 SV=1 582 820 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0044238 primary metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6374
MRLVKTLALYTGLYTGLLAVADAETKNGTDLCPGYRAVNASENAFGVRADLILNGEACDAFATDVQHLVLEVVHE
TDDRLHVKIQDAANQVYQVPEAAFPRPGGRSRATESTLQFDYSMSPFFFTVTRRATGEVLFDTSAAPLIFESQFV
RLRTRLPWKPNLYGLGEHADSFRLPTRNFTRTLWNRGSDGMRAERNLYGSHPFYMDHRGHATHGVFLLNSNGMDV
KIDTTHAGAKQHLEYNTLGGVLDLWFLGGPGPADVARQYSHLVGRPAMPPFWALGFHQSRHGFRDVYQLAEVVAR
YEAERIPLEAIWSDTDYMDRHRVFSLDPVRYPLSKMQAFVRHLHARNQRYVAVVHPAVAFANYPPLHHGIHDDVF
LRRPNGSLFVADTWAGPAVFPDWFSTNIQAYYNKMFGHVFAPDSGIAMDGISLDANEPSFHSCKYPCIQKWRSLY
RKPSRSRKPPRKGLEGWPCELQRHGHCKAKDGSLLTTTTTLNSSSSSLHAHLPPAQHPNSSSSSSLHLHQPLSPF
HDPLPWHGLNDRCLTTPDYKIKNQPSQRRNSKTDPLSAKTIDTDVRHQNGLAMYDTHNLYGTMMASVVRHAILSV
RPGHRPFLISRSTFAGAGAKAGCALGDNLSSSDHYRLSVRHLLSFASIFQFSMVGSNVCGYTGLSEWGLCARWVS
LAAFYPLFRSHSAMHDIHRELYYLPTTKAAARKYVRIRYRLLDYLYTALWRASFDGTPPVSPLWWNQPLDENLWA
EELAFNFGPSILVVPMPSKRFRTCRTYLPTDRFYVWDDHKPIDGDQRVHSFSGPVFPSQPVLIRGASIIPTRETW
ALTTTELRTKGFELLVALDSTASFAHGQLYLDDGISSNTSNRHSLIHFAYHSQNSSLSITGIFNAPVTDYITKIT
VLGAGCSNKNIMRLSRVRHRVRTTKHSRTFHVHVPLNAPNTVKIPAHQLKCFGDTLLP*
Coding >OphauG2|6374
ATGAGGCTCGTCAAGACGTTGGCACTATACACTGGGCTATACACTGGGCTCTTGGCAGTGGCAGACGCAGAAACA
AAAAATGGCACAGATCTGTGCCCAGGCTATCGGGCAGTCAATGCCAGCGAGAATGCATTCGGGGTCAGGGCCGAC
TTGATTCTCAACGGCGAGGCATGTGACGCTTTTGCAACAGATGTTCAGCATCTCGTTCTCGAGGTGGTTCATGAA
ACAGACGACCGGCTTCACGTCAAGATTCAGGACGCGGCCAACCAGGTCTACCAGGTTCCTGAAGCAGCCTTTCCC
CGTCCAGGGGGCCGCAGCCGGGCAACGGAAAGCACTCTGCAGTTTGACTACTCCATGTCGCCCTTTTTCTTCACG
GTGACGCGGCGGGCCACGGGCGAGGTGCTCTTTGACACGTCGGCCGCTCCGCTCATCTTCGAGTCGCAGTTTGTG
CGGCTCCGCACTCGGCTGCCGTGGAAGCCCAACCTGTACGGGCTGGGCGAGCACGCCGACAGCTTCCGGCTGCCG
ACGCGCAACTTCACGCGCACGCTGTGGAACCGCGGCAGCGACGGGATGCGGGCGGAGCGCAACCTGTATGGCTCG
CACCCCTTTTACATGGACCACCGCGGCCACGCCACGCACGGCGTCTTCCTCCTCAACTCCAACGGCATGGACGTC
AAGATTGACACGACGCACGCCGGCGCCAAGCAGCATCTCGAGTACAACACCCTGGGCGGCGTGCTGGATCTGTGG
TTCCTGGGCGGCCCCGGCCCGGCCGACGTGGCCCGCCAGTACAGCCACCTGGTCGGCCGCCCGGCCATGCCGCCC
TTTTGGGCCCTGGGCTTCCACCAGAGCCGCCACGGCTTCCGCGACGTCTACCAGCTGGCCGAGGTGGTGGCGCGC
TACGAGGCCGAGCGCATCCCGCTCGAGGCCATCTGGAGCGACACCGACTACATGGACCGCCACCGCGTCTTCTCC
CTCGACCCCGTGCGCTACCCGCTGTCCAAGATGCAGGCCTTTGTGCGCCACCTGCACGCCCGCAACCAGCGCTAC
GTGGCCGTCGTCCATCCCGCTGTGGCCTTTGCCAACTACCCGCCCTTGCACCACGGCATCCACGACGACGTCTTC
CTCCGCCGCCCCAACGGCAGCCTGTTTGTCGCCGACACCTGGGCTGGCCCGGCCGTCTTCCCCGACTGGTTCTCC
ACAAACATCCAGGCCTACTACAACAAGATGTTTGGCCACGTCTTTGCCCCCGACTCGGGCATCGCCATGGACGGC
ATCTCGCTCGATGCCAACGAGCCCAGCTTCCACTCCTGCAAATATCCCTGCATCCAGAAATGGCGCTCCCTGTAC
CGCAAGCCCTCTCGCTCCCGCAAGCCGCCGCGCAAGGGCCTCGAGGGCTGGCCATGCGAGCTGCAGCGTCACGGC
CACTGCAAGGCCAAGGACGGCTCCCTGCTCACCACCACCACCACCCTCAACTCCTCCTCCTCCTCCCTCCACGCC
CATCTCCCGCCCGCCCAGCACCCCAACTCCTCCTCCTCCTCCTCCCTCCACCTCCACCAGCCTCTGTCCCCATTC
CACGACCCCCTCCCCTGGCACGGCCTCAACGACCGCTGCCTCACCACCCCCGACTACAAAATCAAAAACCAGCCC
TCCCAGCGCCGCAACTCAAAAACAGACCCCCTCTCCGCCAAAACCATCGACACCGACGTCCGCCATCAAAACGGC
CTCGCCATGTACGACACCCACAACCTCTACGGCACCATGATGGCCTCCGTCGTCCGCCACGCCATCCTCTCCGTC
CGCCCCGGCCACCGCCCCTTTCTCATCTCCCGCAGCACCTTTGCCGGCGCCGGCGCAAAGGCCGGCTGCGCCCTC
GGCGACAACCTGAGCTCCTCCGACCACTACCGCCTGTCCGTCCGCCACCTCCTCTCCTTTGCCTCCATCTTCCAG
TTCTCCATGGTCGGCTCCAATGTCTGTGGCTACACCGGCCTCTCCGAGTGGGGCCTGTGTGCCCGATGGGTCTCC
CTCGCCGCCTTTTACCCCTTGTTCCGCAGCCACAGCGCCATGCACGACATCCACCGTGAGCTCTACTATCTCCCC
ACCACAAAGGCCGCCGCCAGGAAATACGTCCGCATCCGCTACCGCCTCCTCGACTATCTCTACACCGCCCTCTGG
CGCGCCAGCTTCGACGGCACCCCCCCCGTCTCTCCCCTGTGGTGGAACCAGCCCCTCGACGAGAACCTGTGGGCC
GAGGAGCTCGCCTTCAACTTCGGCCCCTCCATCCTCGTCGTCCCCATGCCCTCCAAACGCTTCCGCACCTGCCGC
ACCTACCTCCCCACCGACCGCTTCTACGTTTGGGACGACCATAAGCCCATCGACGGCGACCAACGCGTCCACTCC
TTCTCCGGCCCAGTCTTCCCCTCCCAGCCTGTCTTGATCCGCGGCGCCTCCATCATCCCCACCCGCGAAACTTGG
GCTCTTACCACTACCGAGCTGCGCACCAAAGGCTTTGAGCTCCTCGTTGCTCTCGACAGCACTGCCTCCTTTGCC
CATGGCCAGCTCTATCTCGACGACGGCATCTCCTCAAACACCTCCAACCGCCACTCCCTCATCCACTTCGCCTAC
CACTCCCAAAACTCCTCCCTCTCAATCACCGGCATCTTCAACGCCCCCGTCACAGACTACATTACCAAAATCACC
GTCTTGGGCGCCGGCTGCTCCAACAAAAACATCATGCGCTTGTCAAGAGTCAGACACAGGGTCCGCACAACCAAG
CATAGCCGCACCTTTCACGTCCACGTCCCTCTTAATGCCCCCAACACTGTCAAAATACCTGCCCATCAATTGAAG
TGTTTTGGCGATACACTTCTTCCTTAA
Transcript >OphauG2|6374
ATGAGGCTCGTCAAGACGTTGGCACTATACACTGGGCTATACACTGGGCTCTTGGCAGTGGCAGACGCAGAAACA
AAAAATGGCACAGATCTGTGCCCAGGCTATCGGGCAGTCAATGCCAGCGAGAATGCATTCGGGGTCAGGGCCGAC
TTGATTCTCAACGGCGAGGCATGTGACGCTTTTGCAACAGATGTTCAGCATCTCGTTCTCGAGGTGGTTCATGAA
ACAGACGACCGGCTTCACGTCAAGATTCAGGACGCGGCCAACCAGGTCTACCAGGTTCCTGAAGCAGCCTTTCCC
CGTCCAGGGGGCCGCAGCCGGGCAACGGAAAGCACTCTGCAGTTTGACTACTCCATGTCGCCCTTTTTCTTCACG
GTGACGCGGCGGGCCACGGGCGAGGTGCTCTTTGACACGTCGGCCGCTCCGCTCATCTTCGAGTCGCAGTTTGTG
CGGCTCCGCACTCGGCTGCCGTGGAAGCCCAACCTGTACGGGCTGGGCGAGCACGCCGACAGCTTCCGGCTGCCG
ACGCGCAACTTCACGCGCACGCTGTGGAACCGCGGCAGCGACGGGATGCGGGCGGAGCGCAACCTGTATGGCTCG
CACCCCTTTTACATGGACCACCGCGGCCACGCCACGCACGGCGTCTTCCTCCTCAACTCCAACGGCATGGACGTC
AAGATTGACACGACGCACGCCGGCGCCAAGCAGCATCTCGAGTACAACACCCTGGGCGGCGTGCTGGATCTGTGG
TTCCTGGGCGGCCCCGGCCCGGCCGACGTGGCCCGCCAGTACAGCCACCTGGTCGGCCGCCCGGCCATGCCGCCC
TTTTGGGCCCTGGGCTTCCACCAGAGCCGCCACGGCTTCCGCGACGTCTACCAGCTGGCCGAGGTGGTGGCGCGC
TACGAGGCCGAGCGCATCCCGCTCGAGGCCATCTGGAGCGACACCGACTACATGGACCGCCACCGCGTCTTCTCC
CTCGACCCCGTGCGCTACCCGCTGTCCAAGATGCAGGCCTTTGTGCGCCACCTGCACGCCCGCAACCAGCGCTAC
GTGGCCGTCGTCCATCCCGCTGTGGCCTTTGCCAACTACCCGCCCTTGCACCACGGCATCCACGACGACGTCTTC
CTCCGCCGCCCCAACGGCAGCCTGTTTGTCGCCGACACCTGGGCTGGCCCGGCCGTCTTCCCCGACTGGTTCTCC
ACAAACATCCAGGCCTACTACAACAAGATGTTTGGCCACGTCTTTGCCCCCGACTCGGGCATCGCCATGGACGGC
ATCTCGCTCGATGCCAACGAGCCCAGCTTCCACTCCTGCAAATATCCCTGCATCCAGAAATGGCGCTCCCTGTAC
CGCAAGCCCTCTCGCTCCCGCAAGCCGCCGCGCAAGGGCCTCGAGGGCTGGCCATGCGAGCTGCAGCGTCACGGC
CACTGCAAGGCCAAGGACGGCTCCCTGCTCACCACCACCACCACCCTCAACTCCTCCTCCTCCTCCCTCCACGCC
CATCTCCCGCCCGCCCAGCACCCCAACTCCTCCTCCTCCTCCTCCCTCCACCTCCACCAGCCTCTGTCCCCATTC
CACGACCCCCTCCCCTGGCACGGCCTCAACGACCGCTGCCTCACCACCCCCGACTACAAAATCAAAAACCAGCCC
TCCCAGCGCCGCAACTCAAAAACAGACCCCCTCTCCGCCAAAACCATCGACACCGACGTCCGCCATCAAAACGGC
CTCGCCATGTACGACACCCACAACCTCTACGGCACCATGATGGCCTCCGTCGTCCGCCACGCCATCCTCTCCGTC
CGCCCCGGCCACCGCCCCTTTCTCATCTCCCGCAGCACCTTTGCCGGCGCCGGCGCAAAGGCCGGCTGCGCCCTC
GGCGACAACCTGAGCTCCTCCGACCACTACCGCCTGTCCGTCCGCCACCTCCTCTCCTTTGCCTCCATCTTCCAG
TTCTCCATGGTCGGCTCCAATGTCTGTGGCTACACCGGCCTCTCCGAGTGGGGCCTGTGTGCCCGATGGGTCTCC
CTCGCCGCCTTTTACCCCTTGTTCCGCAGCCACAGCGCCATGCACGACATCCACCGTGAGCTCTACTATCTCCCC
ACCACAAAGGCCGCCGCCAGGAAATACGTCCGCATCCGCTACCGCCTCCTCGACTATCTCTACACCGCCCTCTGG
CGCGCCAGCTTCGACGGCACCCCCCCCGTCTCTCCCCTGTGGTGGAACCAGCCCCTCGACGAGAACCTGTGGGCC
GAGGAGCTCGCCTTCAACTTCGGCCCCTCCATCCTCGTCGTCCCCATGCCCTCCAAACGCTTCCGCACCTGCCGC
ACCTACCTCCCCACCGACCGCTTCTACGTTTGGGACGACCATAAGCCCATCGACGGCGACCAACGCGTCCACTCC
TTCTCCGGCCCAGTCTTCCCCTCCCAGCCTGTCTTGATCCGCGGCGCCTCCATCATCCCCACCCGCGAAACTTGG
GCTCTTACCACTACCGAGCTGCGCACCAAAGGCTTTGAGCTCCTCGTTGCTCTCGACAGCACTGCCTCCTTTGCC
CATGGCCAGCTCTATCTCGACGACGGCATCTCCTCAAACACCTCCAACCGCCACTCCCTCATCCACTTCGCCTAC
CACTCCCAAAACTCCTCCCTCTCAATCACCGGCATCTTCAACGCCCCCGTCACAGACTACATTACCAAAATCACC
GTCTTGGGCGCCGGCTGCTCCAACAAAAACATCATGCGCTTGTCAAGAGTCAGACACAGGGTCCGCACAACCAAG
CATAGCCGCACCTTTCACGTCCACGTCCCTCTTAATGCCCCCAACACTGTCAAAATACCTGCCCATCAATTGAAG
TGTTTTGGCGATACACTTCTTCCTTAA
Gene >OphauG2|6374
ATGAGGCTCGTCAAGACGTTGGCACTATACACTGGGCTATACACTGGGCTCTTGGCAGTGGCAGACGCAGAAACA
AAAAATGGCACAGATCTGTGCCCAGGCTATCGGGCAGTCAATGCCAGCGAGAATGCATTCGGGGTCAGGGCCGAC
TTGATTCTCAACGGCGAGGCATGTGACGCTTTTGCAACAGATGTTCAGCATCTCGTTCTCGAGGTGGTTCATGAA
ACAGGTACTGGATCCCTGGGCTCTGCTGGCTGCCATGAAGACGCGCTGACCAAGGGGGGGACGGGACAGACGACC
GGCTTCACGTCAAGATTCAGGACGCGGCCAACCAGGTCTACCAGGTTCCTGAAGCAGCCTTTCCCCGTCCAGGGG
GCCGCAGCCGGGCAACGGAAAGCACTCTGCAGTTTGACTACTCCATGTCGCCCTTTTTCTTCACGGTGACGCGGC
GGGCCACGGGCGAGGTGCTCTTTGACACGTCGGCCGCTCCGCTCATCTTCGAGTCGCAGTTTGTGCGGCTCCGCA
CTCGGCTGCCGTGGAAGCCCAACCTGTACGGGCTGGGCGAGCACGCCGACAGCTTCCGGCTGCCGACGCGCAACT
TCACGCGCACGCTGTGGAACCGCGGCAGCGACGGGATGCGGGCGGAGCGCAACCTGTATGGCTCGCACCCCTTTT
ACATGGACCACCGCGGCCACGCCACGCACGGCGTCTTCCTCCTCAACTCCAACGGCATGGACGTCAAGATTGACA
CGACGCACGCCGGCGCCAAGCAGCATCTCGAGTACAACACCCTGGGCGGCGTGCTGGATCTGTGGTTCCTGGGCG
GCCCCGGCCCGGCCGACGTGGCCCGCCAGTACAGCCACCTGGTCGGCCGCCCGGCCATGCCGCCCTTTTGGGCCC
TGGGCTTCCACCAGAGCCGCCACGGCTTCCGCGACGTCTACCAGCTGGCCGAGGTGGTGGCGCGCTACGAGGCCG
AGCGCATCCCGCTCGAGGCCATCTGGAGCGACACCGACTACATGGACCGCCACCGCGTCTTCTCCCTCGACCCCG
TGCGCTACCCGCTGTCCAAGATGCAGGCCTTTGTGCGCCACCTGCACGCCCGCAACCAGCGCTACGTGGCCGTCG
TCCATCCCGCTGTGGCCTTTGCCAACTACCCGCCCTTGCACCACGGCATCCACGACGACGTCTTCCTCCGCCGCC
CCAACGGCAGCCTGTTTGTCGCCGACACCTGGGCTGGCCCGGCCGTCTTCCCCGACTGGTTCTCCACAAACATCC
AGGCCTACTACAACAAGATGTTTGGCCACGTCTTTGCCCCCGACTCGGGCATCGCCATGGACGGCATCTCGCTCG
ATGCCAACGAGCCCAGCTTCCACTCCTGCAAATATCCCTGCATCCAGAAATGGCGCTCCCTGTACCGCAAGCCCT
CTCGCTCCCGCAAGCCGCCGCGCAAGGGCCTCGAGGGCTGGCCATGCGAGCTGCAGCGTCACGGCCACTGCAAGG
CCAAGGACGGCTCCCTGCTCACCACCACCACCACCCTCAACTCCTCCTCCTCCTCCCTCCACGCCCATCTCCCGC
CCGCCCAGCACCCCAACTCCTCCTCCTCCTCCTCCCTCCACCTCCACCAGCCTCTGTCCCCATTCCACGACCCCC
TCCCCTGGCACGGCCTCAACGACCGCTGCCTCACCACCCCCGACTACAAAATCAAAAACCAGCCCTCCCAGCGCC
GCAACTCAAAAACAGACCCCCTCTCCGCCAAAACCATCGACACCGACGTCCGCCATCAAAACGGCCTCGCCATGT
ACGACACCCACAACCTCTACGGCACCATGATGGCCTCCGTCGTCCGCCACGCCATCCTCTCCGTCCGCCCCGGCC
ACCGCCCCTTTCTCATCTCCCGCAGCACCTTTGCCGGCGCCGGCGCAAAGGCCGGCTGCGCCCTCGGCGACAACC
TGAGCTCCTCCGACCACTACCGCCTGTCCGTCCGCCACCTCCTCTCCTTTGCCTCCATCTTCCAGTTCTCCATGG
TCGGCTCCAATGTCTGTGGCTACACCGGCCTCTCCGAGTGGGGCCTGTGTGCCCGATGGGTCTCCCTCGCCGCCT
TTTACCCCTTGTTCCGCAGCCACAGCGCCATGCACGACATCCACCGTGAGCTCTACTATCTCCCCACCACAAAGG
CCGCCGCCAGGAAATACGTCCGCATCCGCTACCGCCTCCTCGACTATCTCTACACCGCCCTCTGGCGCGCCAGCT
TCGACGGCACCCCCCCCGTCTCTCCCCTGTGGTGGAACCAGCCCCTCGACGAGAACCTGTGGGCCGAGGAGCTCG
CCTTCAACTTCGGCCCCTCCATCCTCGTCGTCCCCATGCCCTCCAAACGCTTCCGCACCTGCCGCACCTACCTCC
CCACCGACCGCTTCTACGTTTGGGACGACCATAAGCCCATCGACGGCGACCAACGCGTCCACTCCTTCTCCGGCC
CAGTCTTCCCCTCCCAGCCTGTCTTGATCCGCGGCGCCTCCATCATCCCCACCCGCGAAACTTGGGCTCTTACCA
CTACCGAGCTGCGCACCAAAGGCTTTGAGCTCCTCGTTGCTCTCGACAGCACTGCCTCCTTTGCCCATGGCCAGC
TCTATCTCGACGACGGCATCTCCTCAAACACCTCCAACCGCCACTCCCTCATCCACTTCGCCTACCACTCCCAAA
ACTCCTCCCTCTCAATCACCGGCATCTTCAACGCCCCCGTCACAGACTACATTACCAAAATCACCGTCTTGGGCG
CCGGCTGCTCCAACAAAAACATCATGCGCTTGTCAAGAGTCAGACACAGGGTCCGCACAACCAAGCATAGCCGCA
CCTTTCACGTCCACGTCCCTCTTAATGCCCCCAACACTGTCAAAATACCTGCCCATCAATTGAAGTGTTTTGGCG
ATACACTTCTTCCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail