Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6371
Gene name
LocationContig_651:3750..4291
Strand+
Gene length (bp)541
Transcript length (bp)474
Coding sequence length (bp)474
Protein length (aa) 158

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10224 DUF2205 Short coiled-coil protein 4.0E-36 80 153

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4903
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6371 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5879
Ophiocordyceps camponoti-floridani Ophcf2|05424
Ophiocordyceps kimflemingae Ophio5|1172
Ophiocordyceps subramaniannii Hirsu2|1367

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6371
MSDDNDNQSVGSNANASSMERSDSCASTSPSDSEPIIHHPIPTRPRLPSRKSSGPLVVPRDSSAVGPVEPQFGPD
DVRAMSPRRTGEDLDKMGKQAREELHRHAKALQESLINIFNRIEAVREEHDKLDNNNKFLQKYIGDLMSTTKITS
SGSRTKK*
Coding >OphauG2|6371
ATGTCAGACGACAACGATAACCAGTCTGTCGGCTCCAACGCCAATGCCAGCTCCATGGAACGCTCCGATTCCTGC
GCTTCCACAAGCCCCTCGGATAGCGAGCCCATAATACACCACCCCATTCCAACCCGCCCGCGCCTGCCTAGCCGT
AAGAGCAGCGGCCCTCTAGTCGTGCCTCGAGACAGCTCTGCCGTCGGCCCCGTCGAGCCGCAGTTTGGTCCAGAC
GACGTGCGGGCCATGAGCCCCCGGCGGACAGGCGAGGACCTGGACAAGATGGGCAAGCAGGCAAGGGAAGAGCTT
CACAGACACGCCAAGGCACTGCAAGAATCCCTCATCAACATCTTCAACCGCATCGAGGCCGTCCGCGAAGAACAC
GACAAGCTCGACAACAACAACAAGTTTCTGCAAAAGTACATTGGCGACCTTATGAGCACCACTAAAATCACTTCA
TCCGGCAGCAGAACCAAGAAATGA
Transcript >OphauG2|6371
ATGTCAGACGACAACGATAACCAGTCTGTCGGCTCCAACGCCAATGCCAGCTCCATGGAACGCTCCGATTCCTGC
GCTTCCACAAGCCCCTCGGATAGCGAGCCCATAATACACCACCCCATTCCAACCCGCCCGCGCCTGCCTAGCCGT
AAGAGCAGCGGCCCTCTAGTCGTGCCTCGAGACAGCTCTGCCGTCGGCCCCGTCGAGCCGCAGTTTGGTCCAGAC
GACGTGCGGGCCATGAGCCCCCGGCGGACAGGCGAGGACCTGGACAAGATGGGCAAGCAGGCAAGGGAAGAGCTT
CACAGACACGCCAAGGCACTGCAAGAATCCCTCATCAACATCTTCAACCGCATCGAGGCCGTCCGCGAAGAACAC
GACAAGCTCGACAACAACAACAAGTTTCTGCAAAAGTACATTGGCGACCTTATGAGCACCACTAAAATCACTTCA
TCCGGCAGCAGAACCAAGAAATGA
Gene >OphauG2|6371
ATGTCAGACGACAACGATAACCAGTCTGTCGGCTCCAACGCCAATGCCAGCTCCATGGAACGCTCCGATTCCTGC
GCTTCCACAAGCCCCTCGGATAGCGAGCCCATAATACACCACCCCATTCCAACCCGCCCGCGCCTGCCTAGCCGT
AAGAGCAGCGGCCCTCTAGTCGTGCCTCGAGACAGCTCTGCCGTCGGCCCCGTCGAGCCGCAGTTTGGTCCAGAC
GACGTGCGGGCCATGAGCCCCCGGCGGACAGGCGAGGACCTGGACAAGATGGGCAAGCAGGCAAGGGAAGAGCTT
CACAGGTAAGCAGCCCATCCGCTCATGTCGACATGCGAGCCCTCTCCCTCTCTGACCTCCCCTTGACCCCAGACA
CGCCAAGGCACTGCAAGAATCCCTCATCAACATCTTCAACCGCATCGAGGCCGTCCGCGAAGAACACGACAAGCT
CGACAACAACAACAAGTTTCTGCAAAAGTACATTGGCGACCTTATGAGCACCACTAAAATCACTTCATCCGGCAG
CAGAACCAAGAAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail