Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6368
Gene name
LocationContig_650:2602..3755
Strand+
Gene length (bp)1153
Transcript length (bp)1029
Coding sequence length (bp)1029
Protein length (aa) 343

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 2.0E-08 6 68
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 3.1E-06 308 338

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SG09|MRD1_NEUCR Multiple RNA-binding domain-containing protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mrd-1 PE=3 SV=1 2 340 3.0E-58
sp|Q4WJT7|MRD1_ASPFU Multiple RNA-binding domain-containing protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mrd1 PE=3 SV=1 1 334 1.0E-39
sp|Q5BGA9|MRD1_EMENI Multiple RNA-binding domain-containing protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mrd1 PE=3 SV=1 1 334 4.0E-38
sp|Q5AJS6|MRD1_CANAL Multiple RNA-binding domain-containing protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MRD1 PE=3 SV=1 4 334 3.0E-23
sp|Q06106|MRD1_YEAST Multiple RNA-binding domain-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRD1 PE=1 SV=1 4 334 6.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SG09|MRD1_NEUCR Multiple RNA-binding domain-containing protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mrd-1 PE=3 SV=1 2 340 3.0E-58
sp|Q4WJT7|MRD1_ASPFU Multiple RNA-binding domain-containing protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mrd1 PE=3 SV=1 1 334 1.0E-39
sp|Q5BGA9|MRD1_EMENI Multiple RNA-binding domain-containing protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mrd1 PE=3 SV=1 1 334 4.0E-38
sp|Q5AJS6|MRD1_CANAL Multiple RNA-binding domain-containing protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MRD1 PE=3 SV=1 4 334 3.0E-23
sp|Q06106|MRD1_YEAST Multiple RNA-binding domain-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRD1 PE=1 SV=1 4 334 6.0E-22
sp|Q6FXP4|MRD1_CANGA Multiple RNA-binding domain-containing protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MRD1 PE=3 SV=1 4 334 2.0E-19
sp|Q6CEW9|MRD1_YARLI Multiple RNA-binding domain-containing protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MRD1 PE=3 SV=1 4 337 2.0E-18
sp|Q75A83|MRD1_ASHGO Multiple RNA-binding domain-containing protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRD1 PE=3 SV=2 4 334 2.0E-17
sp|Q6CQR6|MRD1_KLULA Multiple RNA-binding domain-containing protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MRD1 PE=3 SV=1 4 334 1.0E-14
sp|Q4PC17|MRD1_USTMA Multiple RNA-binding domain-containing protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MRD1 PE=3 SV=1 4 80 7.0E-13
sp|O13620|MRD1_SCHPO Multiple RNA-binding domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrd1 PE=3 SV=1 4 337 2.0E-11
sp|Q9Y4C8|RBM19_HUMAN Probable RNA-binding protein 19 OS=Homo sapiens GN=RBM19 PE=1 SV=3 4 147 1.0E-08
sp|Q8R3C6|RBM19_MOUSE Probable RNA-binding protein 19 OS=Mus musculus GN=Rbm19 PE=1 SV=1 4 175 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6368
MATSRIFVKGLPPNITETEFRNHFSANNRHITDVKLIPQRRIGYIGYKSSEDASSAVKYFNRSYIRMSKILVEPA
RPISDLGLRSSSRPANCPVNNNKAQAIGDKGDVPKKRKRDETDKADSKLHEFLRVMKPGRQGAIADDIGLCALGE
AETRENVVSVDDSDDDYHDMPTRPDKSRKIEQTGNGQRVEDAKLQVREAKAPDAASVVAKDRSEDTEPVASQATK
PCVAATDDDWLRSRTSRLLDLVDADELVDKTVAQPTGESVIASKEEATHSSTEITSHVADDATGCQEFSEDGAVE
AITKTCRLFVRNLPYDVSEDNLQEAFEKYGELQEGQLIPLSI*
Coding >OphauG2|6368
ATGGCGACGTCAAGAATTTTCGTCAAGGGGCTTCCTCCGAATATAACAGAAACCGAGTTTCGAAATCACTTCTCT
GCTAATAACCGACATATCACGGACGTCAAATTAATACCACAGCGACGCATTGGCTACATTGGCTACAAAAGCTCA
GAAGACGCCTCCAGTGCTGTCAAGTACTTCAATAGATCATACATTCGAATGTCAAAAATATTGGTAGAGCCAGCG
AGACCTATCTCAGACCTTGGCCTACGGAGTAGCTCTCGACCTGCGAACTGCCCAGTAAATAACAATAAGGCACAA
GCTATTGGAGATAAGGGAGATGTGCCGAAAAAGCGCAAGCGAGATGAGACGGACAAGGCCGATTCAAAATTGCAC
GAATTTCTCCGAGTCATGAAACCGGGAAGACAAGGCGCCATCGCAGACGACATAGGTCTTTGCGCCCTCGGAGAG
GCCGAGACTCGCGAAAATGTGGTGTCTGTAGATGACAGCGATGATGACTACCACGACATGCCGACGAGGCCTGAC
AAGTCACGCAAAATAGAACAGACAGGAAACGGTCAACGGGTCGAGGATGCGAAACTCCAAGTAAGGGAGGCTAAG
GCGCCAGACGCCGCTTCAGTTGTGGCTAAAGACAGGTCAGAAGATACTGAACCAGTGGCAAGCCAAGCCACCAAG
CCATGTGTTGCGGCCACTGATGATGACTGGCTGCGATCGAGAACGAGCCGGCTGCTGGATCTTGTTGATGCTGAT
GAGCTTGTTGACAAAACAGTGGCACAACCTACGGGTGAATCAGTCATTGCATCTAAAGAAGAAGCGACACATTCC
TCGACCGAAATAACATCGCATGTGGCGGATGACGCTACGGGGTGCCAGGAATTTTCAGAAGATGGCGCGGTCGAG
GCCATCACGAAGACATGTCGACTGTTTGTGCGCAATTTACCATACGACGTTAGCGAGGACAACTTGCAGGAAGCG
TTTGAAAAGTACGGCGAGTTGCAAGAGGGACAGCTTATACCATTGAGTATATGA
Transcript >OphauG2|6368
ATGGCGACGTCAAGAATTTTCGTCAAGGGGCTTCCTCCGAATATAACAGAAACCGAGTTTCGAAATCACTTCTCT
GCTAATAACCGACATATCACGGACGTCAAATTAATACCACAGCGACGCATTGGCTACATTGGCTACAAAAGCTCA
GAAGACGCCTCCAGTGCTGTCAAGTACTTCAATAGATCATACATTCGAATGTCAAAAATATTGGTAGAGCCAGCG
AGACCTATCTCAGACCTTGGCCTACGGAGTAGCTCTCGACCTGCGAACTGCCCAGTAAATAACAATAAGGCACAA
GCTATTGGAGATAAGGGAGATGTGCCGAAAAAGCGCAAGCGAGATGAGACGGACAAGGCCGATTCAAAATTGCAC
GAATTTCTCCGAGTCATGAAACCGGGAAGACAAGGCGCCATCGCAGACGACATAGGTCTTTGCGCCCTCGGAGAG
GCCGAGACTCGCGAAAATGTGGTGTCTGTAGATGACAGCGATGATGACTACCACGACATGCCGACGAGGCCTGAC
AAGTCACGCAAAATAGAACAGACAGGAAACGGTCAACGGGTCGAGGATGCGAAACTCCAAGTAAGGGAGGCTAAG
GCGCCAGACGCCGCTTCAGTTGTGGCTAAAGACAGGTCAGAAGATACTGAACCAGTGGCAAGCCAAGCCACCAAG
CCATGTGTTGCGGCCACTGATGATGACTGGCTGCGATCGAGAACGAGCCGGCTGCTGGATCTTGTTGATGCTGAT
GAGCTTGTTGACAAAACAGTGGCACAACCTACGGGTGAATCAGTCATTGCATCTAAAGAAGAAGCGACACATTCC
TCGACCGAAATAACATCGCATGTGGCGGATGACGCTACGGGGTGCCAGGAATTTTCAGAAGATGGCGCGGTCGAG
GCCATCACGAAGACATGTCGACTGTTTGTGCGCAATTTACCATACGACGTTAGCGAGGACAACTTGCAGGAAGCG
TTTGAAAAGTACGGCGAGTTGCAAGAGGGACAGCTTATACCATTGAGTATATGA
Gene >OphauG2|6368
ATGGCGACGTCAAGAATTTTCGTCAAGGGGCTTCCTCCGAATATAACAGAAACCGAGTTTCGAAATCACTTCTCT
GCTAATAACCGACATATCACGGACGTCAAATTAATACCACAGCGACGCATTGGCTACATTGGCTACAAAAGCTCA
GAAGACGCCTCCAGTGCTGTCAAGTACTTCAATAGATCATACATTCGAATGTCAAAAATATTGGTAGAGCCAGCG
AGACCTGTATGAACAAACATCACTCGCTCTAGCTTCATTCTGGTACTGATGGAATGCTAGATCTCAGACCTTGGC
CTACGGAGTAGCTCTCGACCTGCGAACTGCCCAGTAAATAACAATAAGGCACAAGCTATTGGAGATAAGGGAGAT
GTGCCGAAAAAGCGCAAGCGAGATGAGACGGACAAGGCCGATTCAAAATTGCACGAATTTCTCCGAGTCATGAAA
CCGGGAAGACAAGGCGCCATCGCAGACGACATAGGTCTTTGCGCCCTCGGAGAGGCCGAGACTCGCGAAAATGTG
GTGTCTGTAGATGACAGCGATGATGACTACCACGACATGCCGACGAGGCCTGACAAGTCACGCAAAATAGAACAG
ACAGGAAACGGTCAACGGGTCGAGGATGCGAAACTCCAAGTAAGGGAGGCTAAGGCGCCAGACGCCGCTTCAGTT
GTGGCTAAAGACAGGTCAGAAGATACTGAACCAGTGGCAAGCCAAGCCACCAAGCCATGTGTTGCGGCCACTGAT
GATGACTGGCTGCGATCGAGAACGAGCCGGCTGCTGGATCTTGTTGATGCTGATGAGCTTGTTGACAAAACAGTG
GCACAACCTACGGGTGAATCAGTCATTGCATCTAAAGAAGAAGCGACACATTCCTCGACCGAAATAACATCGCAT
GTGGCGGATGACGCTACGGGGTGCCAGGAATTTTCAGAAGATGGCGCGGTCGAGGCCATCACGAAGACATGTCGA
CTGTTTGTGCGCAATTTACCATACGACGTTAGCGAGGACAACTTGCAGGAAGCGTTTGAAAAGTACGGCGAGTTG
CAAGAGGTACGTGAAAATATGCGTGACAGAAGTGGCAGAAGCCACCAAATGGTTAAAATGATGAAGCCCATGATA
GGGACAGCTTATACCATTGAGTATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail