Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6365
Gene name
LocationContig_65:32031..33762
Strand-
Gene length (bp)1731
Transcript length (bp)1731
Coding sequence length (bp)1731
Protein length (aa) 577

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01344 Kelch_1 Kelch motif 2.6E-06 321 357
PF01344 Kelch_1 Kelch motif 8.2E-06 369 402
PF01344 Kelch_1 Kelch motif 5.0E-09 429 468
PF01344 Kelch_1 Kelch motif 1.0E-04 477 515
PF13418 Kelch_4 Galactose oxidase, central domain 3.7E-05 322 357
PF13418 Kelch_4 Galactose oxidase, central domain 1.6E-04 369 403
PF13418 Kelch_4 Galactose oxidase, central domain 6.3E-05 429 463
PF13418 Kelch_4 Galactose oxidase, central domain 2.7E-05 478 518
PF13964 Kelch_6 Kelch motif 1.3E-06 369 414
PF07646 Kelch_2 Kelch motif 9.2E-08 429 467
PF13415 Kelch_3 Galactose oxidase, central domain 6.3E-05 327 377
PF13854 Kelch_5 Kelch motif 1.3E-04 314 350
PF13854 Kelch_5 Kelch motif 6.7E-05 427 462

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 250 498 8.0E-24
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 271 516 2.0E-22
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 271 516 3.0E-22
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 271 516 3.0E-22
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 239 548 5.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 250 498 8.0E-24
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 271 516 2.0E-22
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 271 516 3.0E-22
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 271 516 3.0E-22
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 239 548 5.0E-22
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 239 548 6.0E-22
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 239 548 2.0E-21
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 327 560 2.0E-20
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 277 548 1.0E-19
sp|P50090|KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL2 PE=1 SV=1 251 545 1.0E-19
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 279 486 8.0E-19
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 247 495 5.0E-18
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 255 548 5.0E-18
sp|Q80YG3|KLDC1_MOUSE Kelch domain-containing protein 1 OS=Mus musculus GN=Klhdc1 PE=2 SV=1 255 509 7.0E-18
sp|P38853|KEL1_YEAST Kelch repeat-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL1 PE=1 SV=1 255 551 7.0E-18
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 253 545 3.0E-17
sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 280 486 3.0E-17
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 237 420 2.0E-16
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 270 495 2.0E-16
sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 241 548 3.0E-16
sp|Q5ZJ37|RABEK_CHICK Rab9 effector protein with kelch motifs OS=Gallus gallus GN=RABEPK PE=2 SV=1 249 413 3.0E-16
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 253 545 4.0E-16
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 305 565 4.0E-16
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 253 545 4.0E-16
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 270 447 5.0E-16
sp|Q8N7A1|KLDC1_HUMAN Kelch domain-containing protein 1 OS=Homo sapiens GN=KLHDC1 PE=2 SV=2 255 508 6.0E-16
sp|P80197|AFK_PHYPO Actin-fragmin kinase OS=Physarum polycephalum PE=1 SV=2 269 560 9.0E-16
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 244 495 1.0E-15
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 244 495 1.0E-15
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 253 545 1.0E-15
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 315 574 2.0E-15
sp|Q5ZJ37|RABEK_CHICK Rab9 effector protein with kelch motifs OS=Gallus gallus GN=RABEPK PE=2 SV=1 280 486 2.0E-15
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 253 467 2.0E-15
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 244 495 6.0E-15
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 258 565 8.0E-15
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 244 495 8.0E-15
sp|Q6P3S6|FBX42_HUMAN F-box only protein 42 OS=Homo sapiens GN=FBXO42 PE=1 SV=1 262 467 8.0E-15
sp|Q5RDA9|FBX42_PONAB F-box only protein 42 OS=Pongo abelii GN=FBXO42 PE=2 SV=1 262 467 8.0E-15
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 254 450 1.0E-14
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 280 535 2.0E-14
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 270 457 3.0E-14
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 348 560 4.0E-14
sp|Q6PDJ6|FBX42_MOUSE F-box only protein 42 OS=Mus musculus GN=Fbxo42 PE=1 SV=1 262 467 4.0E-14
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 348 560 5.0E-14
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 348 560 5.0E-14
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 302 516 6.0E-14
sp|Q9Y5Z7|HCFC2_HUMAN Host cell factor 2 OS=Homo sapiens GN=HCFC2 PE=1 SV=1 253 548 7.0E-14
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 322 553 9.0E-14
sp|Q4V8F4|RABEK_RAT Rab9 effector protein with kelch motifs OS=Rattus norvegicus GN=Rabepk PE=2 SV=1 279 486 1.0E-13
sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 247 425 2.0E-13
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 351 568 2.0E-13
sp|Q54C94|GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum GN=gefF PE=2 SV=1 266 501 2.0E-13
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 363 560 3.0E-13
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 306 495 3.0E-13
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 280 519 4.0E-13
sp|Q5U3Y0|KLD10_RAT Kelch domain-containing protein 10 OS=Rattus norvegicus GN=Klhdc10 PE=2 SV=1 261 517 4.0E-13
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 305 546 5.0E-13
sp|Q6PAR0|KLD10_MOUSE Kelch domain-containing protein 10 OS=Mus musculus GN=Klhdc10 PE=1 SV=1 264 517 5.0E-13
sp|Q5RKG2|HCFC2_RAT Host cell factor 2 OS=Rattus norvegicus GN=Hcfc2 PE=2 SV=1 253 548 6.0E-13
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 253 396 7.0E-13
sp|Q8VCH5|RABEK_MOUSE Rab9 effector protein with kelch motifs OS=Mus musculus GN=Rabepk PE=1 SV=2 279 486 8.0E-13
sp|Q5U580|KLD10_XENLA Kelch domain-containing protein 10 OS=Xenopus laevis GN=klhdc10 PE=2 SV=1 266 517 1.0E-12
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 355 555 2.0E-12
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 262 560 2.0E-12
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 277 451 2.0E-12
sp|O14248|TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea3 PE=1 SV=1 280 515 2.0E-12
sp|P50090|KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL2 PE=1 SV=1 254 422 3.0E-12
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 271 399 3.0E-12
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 322 550 3.0E-12
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 322 545 4.0E-12
sp|Q93XW5|NSP5_ARATH Nitrile-specifier protein 5 OS=Arabidopsis thaliana GN=NSP5 PE=2 SV=1 255 497 4.0E-12
sp|Q28DE7|KLD10_XENTR Kelch domain-containing protein 10 OS=Xenopus tropicalis GN=klhdc10 PE=2 SV=2 266 517 5.0E-12
sp|Q9C8K7|FBK21_ARATH F-box/kelch-repeat protein At1g51550 OS=Arabidopsis thaliana GN=At1g51550 PE=2 SV=1 253 495 6.0E-12
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 322 545 7.0E-12
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 365 545 7.0E-12
sp|Q3KRE6|KLDC2_RAT Kelch domain-containing protein 2 OS=Rattus norvegicus GN=Klhdc2 PE=2 SV=1 255 484 7.0E-12
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 322 545 9.0E-12
sp|Q9Y2U9|KLDC2_HUMAN Kelch domain-containing protein 2 OS=Homo sapiens GN=KLHDC2 PE=1 SV=1 255 484 1.0E-11
sp|Q6P3S6|FBX42_HUMAN F-box only protein 42 OS=Homo sapiens GN=FBXO42 PE=1 SV=1 368 560 2.0E-11
sp|Q5RDA9|FBX42_PONAB F-box only protein 42 OS=Pongo abelii GN=FBXO42 PE=2 SV=1 340 560 2.0E-11
sp|Q9Y5Z7|HCFC2_HUMAN Host cell factor 2 OS=Homo sapiens GN=HCFC2 PE=1 SV=1 242 509 2.0E-11
sp|Q9Y6Y0|NS1BP_HUMAN Influenza virus NS1A-binding protein OS=Homo sapiens GN=IVNS1ABP PE=1 SV=3 266 515 2.0E-11
sp|Q4G5Y1|KLDC2_MOUSE Kelch domain-containing protein 2 OS=Mus musculus GN=Klhdc2 PE=2 SV=3 255 484 2.0E-11
sp|Q6PID8|KLD10_HUMAN Kelch domain-containing protein 10 OS=Homo sapiens GN=KLHDC10 PE=1 SV=1 264 517 2.0E-11
sp|Q5E9A7|KLDC2_BOVIN Kelch domain-containing protein 2 OS=Bos taurus GN=KLHDC2 PE=2 SV=1 255 484 2.0E-11
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 262 405 3.0E-11
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 255 410 3.0E-11
sp|Q0IIC2|KLD10_BOVIN Kelch domain-containing protein 10 OS=Bos taurus GN=KLHDC10 PE=2 SV=1 264 517 3.0E-11
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 255 448 4.0E-11
sp|Q8VCH5|RABEK_MOUSE Rab9 effector protein with kelch motifs OS=Mus musculus GN=Rabepk PE=1 SV=2 279 467 4.0E-11
sp|Q8RY71|ESP_ARATH Epithiospecifier protein OS=Arabidopsis thaliana GN=ESP PE=1 SV=2 247 540 4.0E-11
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 255 448 5.0E-11
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 255 448 6.0E-11
sp|Q67UX0|ADO2_ORYSJ Putative adagio-like protein 2 OS=Oryza sativa subsp. japonica GN=Os02g0150800 PE=3 SV=1 266 501 6.0E-11
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 245 388 7.0E-11
sp|Q4V8F4|RABEK_RAT Rab9 effector protein with kelch motifs OS=Rattus norvegicus GN=Rabepk PE=2 SV=1 255 425 7.0E-11
sp|O04316|JAL29_ARATH Nitrile-specifier protein 4 OS=Arabidopsis thaliana GN=NSP4 PE=2 SV=1 255 522 7.0E-11
sp|O49326|JAL21_ARATH Nitrile-specifier protein 2 OS=Arabidopsis thaliana GN=NSP2 PE=2 SV=1 255 545 7.0E-11
sp|Q5RKG2|HCFC2_RAT Host cell factor 2 OS=Rattus norvegicus GN=Hcfc2 PE=2 SV=1 242 509 8.0E-11
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 255 474 1.0E-10
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 255 454 1.0E-10
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 304 549 1.0E-10
sp|Q8W420|ADO2_ARATH Adagio protein 2 OS=Arabidopsis thaliana GN=ADO2 PE=1 SV=1 255 501 1.0E-10
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 255 470 2.0E-10
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 244 386 2.0E-10
sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 279 402 2.0E-10
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 294 525 2.0E-10
sp|Q60EX6|BSL1_ORYSJ Serine/threonine-protein phosphatase BSL1 homolog OS=Oryza sativa subsp. japonica GN=BSL1 PE=2 SV=1 255 507 2.0E-10
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 270 497 3.0E-10
sp|Q8L7U5|BSL1_ARATH Serine/threonine-protein phosphatase BSL1 OS=Arabidopsis thaliana GN=BSL1 PE=1 SV=2 243 559 3.0E-10
sp|Q8R2P1|KLH25_MOUSE Kelch-like protein 25 OS=Mus musculus GN=Klhl25 PE=2 SV=1 266 516 4.0E-10
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 255 474 5.0E-10
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 366 548 5.0E-10
sp|Q5RG82|NS1BA_DANRE Influenza virus NS1A-binding protein homolog A OS=Danio rerio GN=ivns1abpa PE=2 SV=1 266 515 5.0E-10
sp|Q4KLM4|KLH25_RAT Kelch-like protein 25 OS=Rattus norvegicus GN=Klhl25 PE=2 SV=1 266 516 5.0E-10
sp|Q9C9W9|ADO3_ARATH Adagio protein 3 OS=Arabidopsis thaliana GN=ADO3 PE=1 SV=1 255 512 6.0E-10
sp|Q94BT6|ADO1_ARATH Adagio protein 1 OS=Arabidopsis thaliana GN=ADO1 PE=1 SV=2 263 501 7.0E-10
sp|Q9SDM9|JAL28_ARATH Nitrile-specifier protein 1 OS=Arabidopsis thaliana GN=NSP1 PE=2 SV=2 255 522 8.0E-10
sp|Q2R2W1|ADO3_ORYSJ Adagio-like protein 3 OS=Oryza sativa subsp. japonica GN=Os11g0547000 PE=2 SV=2 255 512 9.0E-10
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 221 376 1.0E-09
sp|Q920Q8|NS1BP_MOUSE Influenza virus NS1A-binding protein homolog OS=Mus musculus GN=Ivns1abp PE=1 SV=2 266 515 1.0E-09
sp|Q9LR78|BSU1_ARATH Serine/threonine-protein phosphatase BSU1 OS=Arabidopsis thaliana GN=BSU1 PE=1 SV=2 208 507 1.0E-09
sp|Q70JS2|KELC_ANOST Ring canal kelch homolog OS=Anopheles stephensi GN=kel PE=2 SV=2 326 557 3.0E-09
sp|Q9H0H3|KLH25_HUMAN Kelch-like protein 25 OS=Homo sapiens GN=KLHL25 PE=1 SV=1 266 516 3.0E-09
sp|Q8N7A1|KLDC1_HUMAN Kelch domain-containing protein 1 OS=Homo sapiens GN=KLHDC1 PE=2 SV=2 270 545 4.0E-09
sp|Q7ZVQ8|NS1BB_DANRE Influenza virus NS1A-binding protein homolog B OS=Danio rerio GN=ivns1abpb PE=2 SV=1 266 515 4.0E-09
sp|Q60EX6|BSL1_ORYSJ Serine/threonine-protein phosphatase BSL1 homolog OS=Oryza sativa subsp. japonica GN=BSL1 PE=2 SV=1 293 495 5.0E-09
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 305 574 7.0E-09
sp|B4MXW3|KLHDB_DROWI Kelch-like protein diablo OS=Drosophila willistoni GN=dbo PE=3 SV=1 330 557 7.0E-09
sp|O35709|ENC1_MOUSE Ectoderm-neural cortex protein 1 OS=Mus musculus GN=Enc1 PE=2 SV=2 277 505 8.0E-09
sp|O14682|ENC1_HUMAN Ectoderm-neural cortex protein 1 OS=Homo sapiens GN=ENC1 PE=1 SV=2 277 505 8.0E-09
sp|Q6JEL3|KLH10_RAT Kelch-like protein 10 OS=Rattus norvegicus GN=Klhl10 PE=1 SV=1 330 548 8.0E-09
sp|Q9D5V2|KLH10_MOUSE Kelch-like protein 10 OS=Mus musculus GN=Klhl10 PE=1 SV=1 330 548 9.0E-09
sp|O04318|JAL27_ARATH Nitrile-specifier protein 3 OS=Arabidopsis thaliana GN=NSP3 PE=2 SV=1 255 545 9.0E-09
sp|Q6JEL2|KLH10_HUMAN Kelch-like protein 10 OS=Homo sapiens GN=KLHL10 PE=1 SV=1 330 548 1.0E-08
sp|Q0D2A9|KLH25_XENTR Kelch-like protein 25 OS=Xenopus tropicalis GN=klhl25 PE=2 SV=1 266 516 1.0E-08
sp|Q80YG3|KLDC1_MOUSE Kelch domain-containing protein 1 OS=Mus musculus GN=Klhdc1 PE=2 SV=1 270 554 2.0E-08
sp|P38853|KEL1_YEAST Kelch repeat-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL1 PE=1 SV=1 355 566 2.0E-08
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 244 396 2.0E-08
sp|Q2R2W1|ADO3_ORYSJ Adagio-like protein 3 OS=Oryza sativa subsp. japonica GN=Os11g0547000 PE=2 SV=2 306 495 2.0E-08
sp|B3M9V8|KLHDB_DROAN Kelch-like protein diablo OS=Drosophila ananassae GN=dbo PE=3 SV=2 330 559 2.0E-08
sp|B4QLQ2|KLHDB_DROSI Kelch-like protein diablo OS=Drosophila simulans GN=dbo PE=3 SV=1 330 559 2.0E-08
sp|Q9Y2U9|KLDC2_HUMAN Kelch domain-containing protein 2 OS=Homo sapiens GN=KLHDC2 PE=1 SV=1 293 447 3.0E-08
sp|Q9C9W9|ADO3_ARATH Adagio protein 3 OS=Arabidopsis thaliana GN=ADO3 PE=1 SV=1 306 495 3.0E-08
sp|B4GRJ2|KLHDB_DROPE Kelch-like protein diablo OS=Drosophila persimilis GN=dbo PE=3 SV=1 330 559 3.0E-08
sp|B3NDN0|KLHDB_DROER Kelch-like protein diablo OS=Drosophila erecta GN=dbo PE=3 SV=1 330 559 3.0E-08
sp|Q6DFF7|KLH25_XENLA Kelch-like protein 25 OS=Xenopus laevis GN=klhl25 PE=2 SV=1 266 516 3.0E-08
sp|B4PD06|KLHDB_DROYA Kelch-like protein diablo OS=Drosophila yakuba GN=dbo PE=3 SV=1 330 559 3.0E-08
sp|B4HIK1|KLHDB_DROSE Kelch-like protein diablo OS=Drosophila sechellia GN=dbo PE=3 SV=1 330 559 3.0E-08
sp|Q9VUU5|KLHDB_DROME Kelch-like protein diablo OS=Drosophila melanogaster GN=dbo PE=1 SV=1 330 559 3.0E-08
sp|Q921I2|KLDC4_MOUSE Kelch domain-containing protein 4 OS=Mus musculus GN=Klhdc4 PE=2 SV=2 441 575 3.0E-08
sp|Q2M0J9|KLHDB_DROPS Kelch-like protein diablo OS=Drosophila pseudoobscura pseudoobscura GN=dbo PE=3 SV=2 330 557 3.0E-08
sp|Q4V8F4|RABEK_RAT Rab9 effector protein with kelch motifs OS=Rattus norvegicus GN=Rabepk PE=2 SV=1 305 517 4.0E-08
sp|Q4G5Y1|KLDC2_MOUSE Kelch domain-containing protein 2 OS=Mus musculus GN=Klhdc2 PE=2 SV=3 293 447 4.0E-08
sp|Q9SJF0|BSL2_ARATH Serine/threonine-protein phosphatase BSL2 OS=Arabidopsis thaliana GN=BSL2 PE=1 SV=2 295 559 4.0E-08
sp|Q5Z8K3|ADO1_ORYSJ Adagio-like protein 1 OS=Oryza sativa subsp. japonica GN=Os06g0694000 PE=2 SV=1 255 501 4.0E-08
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 322 451 5.0E-08
sp|B4J045|KLHDB_DROGR Kelch-like protein diablo OS=Drosophila grimshawi GN=dbo PE=3 SV=1 330 559 5.0E-08
sp|Q3KRE6|KLDC2_RAT Kelch domain-containing protein 2 OS=Rattus norvegicus GN=Klhdc2 PE=2 SV=1 293 447 6.0E-08
sp|Q94BT6|ADO1_ARATH Adagio protein 1 OS=Arabidopsis thaliana GN=ADO1 PE=1 SV=2 255 550 7.0E-08
sp|Q5R8W1|KLDC4_PONAB Kelch domain-containing protein 4 OS=Pongo abelii GN=KLHDC4 PE=2 SV=1 441 575 7.0E-08
sp|B4L0G9|KLHDB_DROMO Kelch-like protein diablo OS=Drosophila mojavensis GN=dbo PE=3 SV=1 330 557 7.0E-08
sp|Q6PDJ6|FBX42_MOUSE F-box only protein 42 OS=Mus musculus GN=Fbxo42 PE=1 SV=1 228 392 8.0E-08
sp|Q5ZKD9|KLH20_CHICK Kelch-like protein 20 OS=Gallus gallus GN=KLHL20 PE=2 SV=1 297 547 8.0E-08
sp|Q8K430|KLH17_RAT Kelch-like protein 17 OS=Rattus norvegicus GN=Klhl17 PE=1 SV=1 294 555 8.0E-08
sp|Q6TDP3|KLH17_MOUSE Kelch-like protein 17 OS=Mus musculus GN=Klhl17 PE=1 SV=1 294 555 8.0E-08
sp|B4LIG6|KLHDB_DROVI Kelch-like protein diablo OS=Drosophila virilis GN=dbo PE=3 SV=1 330 557 8.0E-08
sp|P38853|KEL1_YEAST Kelch repeat-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL1 PE=1 SV=1 278 431 9.0E-08
sp|Q8VCH5|RABEK_MOUSE Rab9 effector protein with kelch motifs OS=Mus musculus GN=Rabepk PE=1 SV=2 305 517 9.0E-08
sp|Q9SHS7|BSL3_ARATH Serine/threonine-protein phosphatase BSL3 OS=Arabidopsis thaliana GN=BSL3 PE=1 SV=2 244 507 9.0E-08
sp|Q9C8K7|FBK21_ARATH F-box/kelch-repeat protein At1g51550 OS=Arabidopsis thaliana GN=At1g51550 PE=2 SV=1 315 547 1.0E-07
sp|Q5E9A7|KLDC2_BOVIN Kelch domain-containing protein 2 OS=Bos taurus GN=KLHDC2 PE=2 SV=1 293 447 1.0E-07
sp|D3Z8N4|KLH20_RAT Kelch-like protein 20 OS=Rattus norvegicus GN=Klhl20 PE=3 SV=1 297 547 1.0E-07
sp|Q9Y2M5|KLH20_HUMAN Kelch-like protein 20 OS=Homo sapiens GN=KLHL20 PE=1 SV=4 297 547 1.0E-07
sp|Q08DK3|KLH20_BOVIN Kelch-like protein 20 OS=Bos taurus GN=KLHL20 PE=2 SV=3 297 547 1.0E-07
sp|Q5R7B8|KLH20_PONAB Kelch-like protein 20 OS=Pongo abelii GN=KLHL20 PE=2 SV=3 297 547 1.0E-07
sp|Q6DFF6|KLH20_XENLA Kelch-like protein 20 OS=Xenopus laevis GN=klhl20 PE=2 SV=1 297 547 1.0E-07
sp|Q8VCK5|KLH20_MOUSE Kelch-like protein 20 OS=Mus musculus GN=Klhl20 PE=2 SV=2 297 547 1.0E-07
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 244 338 2.0E-07
sp|Q9SJF0|BSL2_ARATH Serine/threonine-protein phosphatase BSL2 OS=Arabidopsis thaliana GN=BSL2 PE=1 SV=2 244 507 2.0E-07
sp|Q6TDP4|KLH17_HUMAN Kelch-like protein 17 OS=Homo sapiens GN=KLHL17 PE=2 SV=1 294 555 2.0E-07
sp|G5ED84|KLHL8_CAEEL Kelch-like protein 8 OS=Caenorhabditis elegans GN=kel-8 PE=1 SV=1 331 547 2.0E-07
sp|O14248|TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea3 PE=1 SV=1 255 381 3.0E-07
sp|Q5ZJ37|RABEK_CHICK Rab9 effector protein with kelch motifs OS=Gallus gallus GN=RABEPK PE=2 SV=1 329 546 4.0E-07
sp|Q9Y6Y0|NS1BP_HUMAN Influenza virus NS1A-binding protein OS=Homo sapiens GN=IVNS1ABP PE=1 SV=3 374 572 4.0E-07
sp|Q8TBB5|KLDC4_HUMAN Kelch domain-containing protein 4 OS=Homo sapiens GN=KLHDC4 PE=1 SV=1 441 575 4.0E-07
sp|Q5RG82|NS1BA_DANRE Influenza virus NS1A-binding protein homolog A OS=Danio rerio GN=ivns1abpa PE=2 SV=1 215 555 5.0E-07
sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 305 574 6.0E-07
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 245 376 7.0E-07
sp|Q6DFU2|NS1BP_XENLA Influenza virus NS1A-binding protein homolog OS=Xenopus laevis GN=ivns1abp PE=2 SV=1 275 515 1.0E-06
sp|Q6P3S6|FBX42_HUMAN F-box only protein 42 OS=Homo sapiens GN=FBXO42 PE=1 SV=1 228 392 2.0E-06
sp|Q5RDA9|FBX42_PONAB F-box only protein 42 OS=Pongo abelii GN=FBXO42 PE=2 SV=1 228 392 2.0E-06
sp|Q4V8F4|RABEK_RAT Rab9 effector protein with kelch motifs OS=Rattus norvegicus GN=Rabepk PE=2 SV=1 355 561 2.0E-06
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 244 388 2.0E-06
sp|Q920Q8|NS1BP_MOUSE Influenza virus NS1A-binding protein homolog OS=Mus musculus GN=Ivns1abp PE=1 SV=2 374 572 2.0E-06
sp|Q7QGL0|KLHDB_ANOGA Kelch-like protein diablo OS=Anopheles gambiae GN=dbo PE=3 SV=4 330 557 2.0E-06
sp|Q5U3Y0|KLD10_RAT Kelch domain-containing protein 10 OS=Rattus norvegicus GN=Klhdc10 PE=2 SV=1 241 452 3.0E-06
sp|Q6PAR0|KLD10_MOUSE Kelch domain-containing protein 10 OS=Mus musculus GN=Klhdc10 PE=1 SV=1 241 452 3.0E-06
sp|Q7QGL0|KLHDB_ANOGA Kelch-like protein diablo OS=Anopheles gambiae GN=dbo PE=3 SV=4 368 547 3.0E-06
sp|B0WWP2|KLHDB_CULQU Kelch-like protein diablo OS=Culex quinquefasciatus GN=dbo PE=3 SV=2 330 557 3.0E-06
sp|B0WWP2|KLHDB_CULQU Kelch-like protein diablo OS=Culex quinquefasciatus GN=dbo PE=3 SV=2 368 547 3.0E-06
sp|Q16RL8|KLHDB_AEDAE Kelch-like protein diablo OS=Aedes aegypti GN=dbo PE=3 SV=1 330 557 3.0E-06
sp|Q16RL8|KLHDB_AEDAE Kelch-like protein diablo OS=Aedes aegypti GN=dbo PE=3 SV=1 368 547 3.0E-06
sp|Q10579|SPE26_CAEEL Spermatocyte protein spe-26 OS=Caenorhabditis elegans GN=spe-26 PE=1 SV=1 330 550 3.0E-06
sp|Q6PID8|KLD10_HUMAN Kelch domain-containing protein 10 OS=Homo sapiens GN=KLHDC10 PE=1 SV=1 241 452 4.0E-06
sp|Q8W420|ADO2_ARATH Adagio protein 2 OS=Arabidopsis thaliana GN=ADO2 PE=1 SV=1 255 550 4.0E-06
sp|Q7ZVQ8|NS1BB_DANRE Influenza virus NS1A-binding protein homolog B OS=Danio rerio GN=ivns1abpb PE=2 SV=1 374 560 4.0E-06
sp|Q5ZKD9|KLH20_CHICK Kelch-like protein 20 OS=Gallus gallus GN=KLHL20 PE=2 SV=1 330 559 4.0E-06
sp|D3Z8N4|KLH20_RAT Kelch-like protein 20 OS=Rattus norvegicus GN=Klhl20 PE=3 SV=1 330 559 4.0E-06
sp|Q9Y2M5|KLH20_HUMAN Kelch-like protein 20 OS=Homo sapiens GN=KLHL20 PE=1 SV=4 330 559 4.0E-06
sp|Q08DK3|KLH20_BOVIN Kelch-like protein 20 OS=Bos taurus GN=KLHL20 PE=2 SV=3 330 559 4.0E-06
sp|Q9QYP0|MEGF8_RAT Multiple epidermal growth factor-like domains protein 8 OS=Rattus norvegicus GN=Megf8 PE=1 SV=2 260 498 4.0E-06
sp|Q9NR64|KLHL1_HUMAN Kelch-like protein 1 OS=Homo sapiens GN=KLHL1 PE=2 SV=1 280 548 4.0E-06
sp|Q0IIC2|KLD10_BOVIN Kelch domain-containing protein 10 OS=Bos taurus GN=KLHDC10 PE=2 SV=1 241 452 5.0E-06
sp|Q8K430|KLH17_RAT Kelch-like protein 17 OS=Rattus norvegicus GN=Klhl17 PE=1 SV=1 325 555 5.0E-06
sp|Q6TDP3|KLH17_MOUSE Kelch-like protein 17 OS=Mus musculus GN=Klhl17 PE=1 SV=1 325 555 5.0E-06
sp|Q6DFF6|KLH20_XENLA Kelch-like protein 20 OS=Xenopus laevis GN=klhl20 PE=2 SV=1 330 559 5.0E-06
sp|Q8VCK5|KLH20_MOUSE Kelch-like protein 20 OS=Mus musculus GN=Klhl20 PE=2 SV=2 330 559 5.0E-06
sp|Q6TDP4|KLH17_HUMAN Kelch-like protein 17 OS=Homo sapiens GN=KLHL17 PE=2 SV=1 325 555 6.0E-06
sp|Q2QM47|BSL2_ORYSJ Serine/threonine-protein phosphatase BSL2 homolog OS=Oryza sativa subsp. japonica GN=BSL2 PE=2 SV=2 115 507 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6506
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6365 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1898
Ophiocordyceps kimflemingae Ophio5|7882
Ophiocordyceps subramaniannii Hirsu2|10902

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6365
MASRQSNSNSPISPPSTKSQNTGHTPSRSVTERRHKELQLRQRSQSVSNATPSALDMQSAPSSIASSPRRPLTEA
APDFPASPSTRVSSPLPSIRSVTPRSRLPPDHSTGALSRQTTLSSPSSPAEPSSPAVGRGHASQRAVASLAGIAH
NASAAPSSRPSSAMDSPGTRQSSDISAHSAAKSRKAEDKESKKAATISQSTASSSRGTFSNSARARQTTDASPNA
ARTRHLSFPLLQDPKDAPDVHVAPATGMYWSKAFESGAPHPNLRAHTTTIIGSNIYIFGGCDTRTCFNKLYMIDA
DSFYWWAPQTAGEVPVPLRAMTCTAVGKKLIIFGGGDGPAYYNDVWVFDTLNLRWSRPRLVGDRAPCKRRAHTAC
LYKNGLYVFGGGDGDRALNDIWRLDVSDSNKMAWKLISSTEKAAPGIADYRPKPRGYHTANVSGGKLIVFGGSDS
VECFDDVWIYDIERHVWIAIDMASSFRRLSHTATLVGSYLFVIGGHDGNDYCNDLLLLNLVSMTWDKRKTYGKPL
SVRGYHGTVLHDSRLLVVGGFDGAQVFGDVTILEMAIHAYYSQISHFTIDV*
Coding >OphauG2|6365
ATGGCTAGCCGACAATCCAATTCCAACTCTCCCATCTCTCCTCCGTCCACAAAAAGCCAAAACACGGGCCACACA
CCCAGCAGGAGCGTCACAGAGCGCCGTCACAAGGAGCTCCAACTTCGCCAGCGCTCACAGTCAGTCTCCAATGCC
ACCCCGAGCGCTTTGGACATGCAGTCTGCTCCAAGCAGCATAGCCTCCTCTCCAAGGAGGCCCTTGACTGAAGCT
GCTCCTGACTTTCCGGCTTCCCCTTCGACCAGAGTTAGCTCTCCGCTGCCATCAATCAGGAGCGTCACACCAAGA
TCAAGGCTGCCTCCTGACCATTCAACTGGCGCTCTAAGCAGACAGACAACGCTTTCAAGTCCCTCTTCGCCTGCC
GAGCCGTCTTCTCCTGCTGTTGGTCGGGGCCATGCATCACAGCGAGCGGTAGCGTCTTTGGCTGGCATTGCCCAT
AACGCTTCGGCAGCGCCCTCGTCCCGGCCATCATCGGCCATGGACTCTCCAGGGACGAGACAGTCATCCGACATT
TCGGCTCATAGTGCAGCCAAGTCGAGAAAAGCAGAGGACAAGGAGTCCAAAAAGGCAGCAACAATTTCGCAGTCT
ACAGCTTCGTCTAGTCGCGGCACCTTTTCCAACTCGGCTAGAGCTCGCCAGACGACAGACGCATCTCCAAATGCT
GCAAGGACTCGTCATCTTTCGTTTCCCCTTCTTCAAGATCCTAAAGATGCTCCAGACGTCCATGTTGCTCCAGCA
ACGGGCATGTACTGGTCCAAAGCGTTCGAATCTGGCGCCCCCCATCCCAATCTTCGAGCTCACACCACCACCATT
ATCGGCTCCAATATTTACATCTTTGGCGGCTGCGATACACGCACTTGCTTCAACAAGCTCTACATGATCGACGCT
GACTCATTTTACTGGTGGGCTCCCCAGACTGCGGGCGAGGTGCCCGTGCCACTGCGAGCCATGACATGCACTGCC
GTGGGCAAGAAACTCATCATCTTTGGAGGGGGTGACGGCCCTGCGTACTACAACGATGTCTGGGTCTTTGATACT
CTCAACTTGCGCTGGTCAAGGCCTCGCCTTGTGGGAGACAGGGCGCCGTGTAAACGCAGGGCTCACACGGCCTGT
CTCTATAAGAATGGGCTTTATGTCTTTGGCGGAGGTGACGGAGACCGTGCGCTCAACGACATATGGCGCCTGGAC
GTCAGCGACTCAAACAAGATGGCATGGAAGTTGATTTCGAGCACAGAAAAGGCAGCTCCCGGAATAGCCGACTAC
CGACCCAAGCCTCGAGGCTACCACACAGCCAACGTGAGCGGCGGCAAGCTCATCGTGTTTGGAGGCTCGGATAGC
GTTGAGTGCTTTGACGATGTGTGGATTTACGACATTGAGAGACATGTCTGGATCGCCATCGACATGGCCAGCTCG
TTCCGACGTCTGTCACACACGGCCACTCTTGTTGGCTCCTATCTCTTTGTCATTGGCGGCCACGACGGCAATGAT
TATTGCAACGACTTGCTGCTGCTCAATCTTGTGAGCATGACGTGGGATAAGCGTAAGACGTACGGCAAGCCATTG
AGCGTGCGAGGTTACCACGGCACTGTGCTGCACGACAGCAGGTTGCTTGTTGTTGGGGGCTTCGACGGTGCCCAA
GTATTTGGCGACGTGACTATTCTCGAAATGGCAATCCACGCATACTACTCGCAGATAAGCCACTTTACTATTGAC
GTTTGA
Transcript >OphauG2|6365
ATGGCTAGCCGACAATCCAATTCCAACTCTCCCATCTCTCCTCCGTCCACAAAAAGCCAAAACACGGGCCACACA
CCCAGCAGGAGCGTCACAGAGCGCCGTCACAAGGAGCTCCAACTTCGCCAGCGCTCACAGTCAGTCTCCAATGCC
ACCCCGAGCGCTTTGGACATGCAGTCTGCTCCAAGCAGCATAGCCTCCTCTCCAAGGAGGCCCTTGACTGAAGCT
GCTCCTGACTTTCCGGCTTCCCCTTCGACCAGAGTTAGCTCTCCGCTGCCATCAATCAGGAGCGTCACACCAAGA
TCAAGGCTGCCTCCTGACCATTCAACTGGCGCTCTAAGCAGACAGACAACGCTTTCAAGTCCCTCTTCGCCTGCC
GAGCCGTCTTCTCCTGCTGTTGGTCGGGGCCATGCATCACAGCGAGCGGTAGCGTCTTTGGCTGGCATTGCCCAT
AACGCTTCGGCAGCGCCCTCGTCCCGGCCATCATCGGCCATGGACTCTCCAGGGACGAGACAGTCATCCGACATT
TCGGCTCATAGTGCAGCCAAGTCGAGAAAAGCAGAGGACAAGGAGTCCAAAAAGGCAGCAACAATTTCGCAGTCT
ACAGCTTCGTCTAGTCGCGGCACCTTTTCCAACTCGGCTAGAGCTCGCCAGACGACAGACGCATCTCCAAATGCT
GCAAGGACTCGTCATCTTTCGTTTCCCCTTCTTCAAGATCCTAAAGATGCTCCAGACGTCCATGTTGCTCCAGCA
ACGGGCATGTACTGGTCCAAAGCGTTCGAATCTGGCGCCCCCCATCCCAATCTTCGAGCTCACACCACCACCATT
ATCGGCTCCAATATTTACATCTTTGGCGGCTGCGATACACGCACTTGCTTCAACAAGCTCTACATGATCGACGCT
GACTCATTTTACTGGTGGGCTCCCCAGACTGCGGGCGAGGTGCCCGTGCCACTGCGAGCCATGACATGCACTGCC
GTGGGCAAGAAACTCATCATCTTTGGAGGGGGTGACGGCCCTGCGTACTACAACGATGTCTGGGTCTTTGATACT
CTCAACTTGCGCTGGTCAAGGCCTCGCCTTGTGGGAGACAGGGCGCCGTGTAAACGCAGGGCTCACACGGCCTGT
CTCTATAAGAATGGGCTTTATGTCTTTGGCGGAGGTGACGGAGACCGTGCGCTCAACGACATATGGCGCCTGGAC
GTCAGCGACTCAAACAAGATGGCATGGAAGTTGATTTCGAGCACAGAAAAGGCAGCTCCCGGAATAGCCGACTAC
CGACCCAAGCCTCGAGGCTACCACACAGCCAACGTGAGCGGCGGCAAGCTCATCGTGTTTGGAGGCTCGGATAGC
GTTGAGTGCTTTGACGATGTGTGGATTTACGACATTGAGAGACATGTCTGGATCGCCATCGACATGGCCAGCTCG
TTCCGACGTCTGTCACACACGGCCACTCTTGTTGGCTCCTATCTCTTTGTCATTGGCGGCCACGACGGCAATGAT
TATTGCAACGACTTGCTGCTGCTCAATCTTGTGAGCATGACGTGGGATAAGCGTAAGACGTACGGCAAGCCATTG
AGCGTGCGAGGTTACCACGGCACTGTGCTGCACGACAGCAGGTTGCTTGTTGTTGGGGGCTTCGACGGTGCCCAA
GTATTTGGCGACGTGACTATTCTCGAAATGGCAATCCACGCATACTACTCGCAGATAAGCCACTTTACTATTGAC
GTTTGA
Gene >OphauG2|6365
ATGGCTAGCCGACAATCCAATTCCAACTCTCCCATCTCTCCTCCGTCCACAAAAAGCCAAAACACGGGCCACACA
CCCAGCAGGAGCGTCACAGAGCGCCGTCACAAGGAGCTCCAACTTCGCCAGCGCTCACAGTCAGTCTCCAATGCC
ACCCCGAGCGCTTTGGACATGCAGTCTGCTCCAAGCAGCATAGCCTCCTCTCCAAGGAGGCCCTTGACTGAAGCT
GCTCCTGACTTTCCGGCTTCCCCTTCGACCAGAGTTAGCTCTCCGCTGCCATCAATCAGGAGCGTCACACCAAGA
TCAAGGCTGCCTCCTGACCATTCAACTGGCGCTCTAAGCAGACAGACAACGCTTTCAAGTCCCTCTTCGCCTGCC
GAGCCGTCTTCTCCTGCTGTTGGTCGGGGCCATGCATCACAGCGAGCGGTAGCGTCTTTGGCTGGCATTGCCCAT
AACGCTTCGGCAGCGCCCTCGTCCCGGCCATCATCGGCCATGGACTCTCCAGGGACGAGACAGTCATCCGACATT
TCGGCTCATAGTGCAGCCAAGTCGAGAAAAGCAGAGGACAAGGAGTCCAAAAAGGCAGCAACAATTTCGCAGTCT
ACAGCTTCGTCTAGTCGCGGCACCTTTTCCAACTCGGCTAGAGCTCGCCAGACGACAGACGCATCTCCAAATGCT
GCAAGGACTCGTCATCTTTCGTTTCCCCTTCTTCAAGATCCTAAAGATGCTCCAGACGTCCATGTTGCTCCAGCA
ACGGGCATGTACTGGTCCAAAGCGTTCGAATCTGGCGCCCCCCATCCCAATCTTCGAGCTCACACCACCACCATT
ATCGGCTCCAATATTTACATCTTTGGCGGCTGCGATACACGCACTTGCTTCAACAAGCTCTACATGATCGACGCT
GACTCATTTTACTGGTGGGCTCCCCAGACTGCGGGCGAGGTGCCCGTGCCACTGCGAGCCATGACATGCACTGCC
GTGGGCAAGAAACTCATCATCTTTGGAGGGGGTGACGGCCCTGCGTACTACAACGATGTCTGGGTCTTTGATACT
CTCAACTTGCGCTGGTCAAGGCCTCGCCTTGTGGGAGACAGGGCGCCGTGTAAACGCAGGGCTCACACGGCCTGT
CTCTATAAGAATGGGCTTTATGTCTTTGGCGGAGGTGACGGAGACCGTGCGCTCAACGACATATGGCGCCTGGAC
GTCAGCGACTCAAACAAGATGGCATGGAAGTTGATTTCGAGCACAGAAAAGGCAGCTCCCGGAATAGCCGACTAC
CGACCCAAGCCTCGAGGCTACCACACAGCCAACGTGAGCGGCGGCAAGCTCATCGTGTTTGGAGGCTCGGATAGC
GTTGAGTGCTTTGACGATGTGTGGATTTACGACATTGAGAGACATGTCTGGATCGCCATCGACATGGCCAGCTCG
TTCCGACGTCTGTCACACACGGCCACTCTTGTTGGCTCCTATCTCTTTGTCATTGGCGGCCACGACGGCAATGAT
TATTGCAACGACTTGCTGCTGCTCAATCTTGTGAGCATGACGTGGGATAAGCGTAAGACGTACGGCAAGCCATTG
AGCGTGCGAGGTTACCACGGCACTGTGCTGCACGACAGCAGGTTGCTTGTTGTTGGGGGCTTCGACGGTGCCCAA
GTATTTGGCGACGTGACTATTCTCGAAATGGCAATCCACGCATACTACTCGCAGATAAGCCACTTTACTATTGAC
GTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail