Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6362
Gene name
LocationContig_65:15698..18142
Strand+
Gene length (bp)2444
Transcript length (bp)2340
Coding sequence length (bp)2340
Protein length (aa) 780

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13418 Kelch_4 Galactose oxidase, central domain 2.2E-04 108 153
PF13418 Kelch_4 Galactose oxidase, central domain 4.9E-09 159 200
PF13418 Kelch_4 Galactose oxidase, central domain 5.0E-05 210 252
PF13418 Kelch_4 Galactose oxidase, central domain 1.1E-04 258 293
PF13854 Kelch_5 Kelch motif 2.2E-07 207 248
PF01344 Kelch_1 Kelch motif 1.5E-04 164 200
PF01344 Kelch_1 Kelch motif 1.2E-05 211 252
PF13415 Kelch_3 Galactose oxidase, central domain 2.2E-06 116 167
PF13415 Kelch_3 Galactose oxidase, central domain 2.0E-06 169 218
PF00651 BTB BTB/POZ domain 5.6E-09 557 666

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 159 298 9.0E-18
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 114 313 3.0E-17
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 109 276 9.0E-17
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 64 296 2.0E-15
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 116 276 1.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 159 298 9.0E-18
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 114 313 3.0E-17
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 109 276 9.0E-17
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 64 296 2.0E-15
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 116 276 1.0E-14
sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 111 278 4.0E-14
sp|O14248|TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea3 PE=1 SV=1 114 288 5.0E-14
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 119 307 7.0E-14
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 119 307 8.0E-14
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 144 293 1.0E-13
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 144 293 1.0E-13
sp|Q54C94|GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum GN=gefF PE=2 SV=1 112 287 1.0E-13
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 119 307 1.0E-13
sp|P80197|AFK_PHYPO Actin-fragmin kinase OS=Physarum polycephalum PE=1 SV=2 108 242 3.0E-13
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 119 307 4.0E-13
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 144 293 4.0E-13
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 118 278 2.0E-12
sp|Q80YG3|KLDC1_MOUSE Kelch domain-containing protein 1 OS=Mus musculus GN=Klhdc1 PE=2 SV=1 107 288 2.0E-12
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 97 292 2.0E-12
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 113 276 2.0E-12
sp|Q8N7A1|KLDC1_HUMAN Kelch domain-containing protein 1 OS=Homo sapiens GN=KLHDC1 PE=2 SV=2 100 288 2.0E-12
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 113 276 2.0E-12
sp|Q4V8F4|RABEK_RAT Rab9 effector protein with kelch motifs OS=Rattus norvegicus GN=Rabepk PE=2 SV=1 114 252 2.0E-12
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 113 276 4.0E-12
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 107 279 5.0E-12
sp|Q8VCH5|RABEK_MOUSE Rab9 effector protein with kelch motifs OS=Mus musculus GN=Rabepk PE=1 SV=2 114 252 5.0E-12
sp|Q5ZJ37|RABEK_CHICK Rab9 effector protein with kelch motifs OS=Gallus gallus GN=RABEPK PE=2 SV=1 100 280 7.0E-12
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 117 296 2.0E-11
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 117 296 2.0E-11
sp|P50090|KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL2 PE=1 SV=1 89 280 2.0E-11
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 118 276 2.0E-11
sp|Q9Y5Z7|HCFC2_HUMAN Host cell factor 2 OS=Homo sapiens GN=HCFC2 PE=1 SV=1 117 296 3.0E-11
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 117 279 4.0E-11
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 117 279 4.0E-11
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 116 380 4.0E-11
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 117 279 4.0E-11
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 117 296 4.0E-11
sp|Q54C94|GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum GN=gefF PE=2 SV=1 118 280 5.0E-11
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 116 381 6.0E-11
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 116 381 8.0E-11
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 115 288 8.0E-11
sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 135 294 2.0E-10
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 100 279 2.0E-10
sp|Q5RKG2|HCFC2_RAT Host cell factor 2 OS=Rattus norvegicus GN=Hcfc2 PE=2 SV=1 117 296 2.0E-10
sp|O22286|BPM3_ARATH BTB/POZ and MATH domain-containing protein 3 OS=Arabidopsis thaliana GN=BPM3 PE=1 SV=1 547 723 3.0E-10
sp|Q6NXM2|RCBT1_MOUSE RCC1 and BTB domain-containing protein 1 OS=Mus musculus GN=Rcbtb1 PE=2 SV=1 574 721 4.0E-10
sp|Q8NDN9|RCBT1_HUMAN RCC1 and BTB domain-containing protein 1 OS=Homo sapiens GN=RCBTB1 PE=2 SV=1 574 721 4.0E-10
sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 100 292 2.0E-09
sp|Q9C9W9|ADO3_ARATH Adagio protein 3 OS=Arabidopsis thaliana GN=ADO3 PE=1 SV=1 117 278 2.0E-09
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 99 293 3.0E-09
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 141 293 3.0E-09
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 141 293 3.0E-09
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 141 293 3.0E-09
sp|P50090|KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL2 PE=1 SV=1 109 276 4.0E-09
sp|Q8W420|ADO2_ARATH Adagio protein 2 OS=Arabidopsis thaliana GN=ADO2 PE=1 SV=1 117 280 4.0E-09
sp|Q28DE7|KLD10_XENTR Kelch domain-containing protein 10 OS=Xenopus tropicalis GN=klhdc10 PE=2 SV=2 98 293 4.0E-09
sp|Q6P3S6|FBX42_HUMAN F-box only protein 42 OS=Homo sapiens GN=FBXO42 PE=1 SV=1 108 296 5.0E-09
sp|Q5RDA9|FBX42_PONAB F-box only protein 42 OS=Pongo abelii GN=FBXO42 PE=2 SV=1 108 296 5.0E-09
sp|Q9Y5Z7|HCFC2_HUMAN Host cell factor 2 OS=Homo sapiens GN=HCFC2 PE=1 SV=1 145 293 6.0E-09
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 119 280 8.0E-09
sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 100 293 1.0E-08
sp|Q0IIC2|KLD10_BOVIN Kelch domain-containing protein 10 OS=Bos taurus GN=KLHDC10 PE=2 SV=1 98 293 1.0E-08
sp|Q6PID8|KLD10_HUMAN Kelch domain-containing protein 10 OS=Homo sapiens GN=KLHDC10 PE=1 SV=1 98 293 1.0E-08
sp|Q6PAR0|KLD10_MOUSE Kelch domain-containing protein 10 OS=Mus musculus GN=Klhdc10 PE=1 SV=1 98 293 1.0E-08
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 156 293 2.0E-08
sp|Q5U3Y0|KLD10_RAT Kelch domain-containing protein 10 OS=Rattus norvegicus GN=Klhdc10 PE=2 SV=1 98 293 2.0E-08
sp|P38853|KEL1_YEAST Kelch repeat-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL1 PE=1 SV=1 116 228 2.0E-08
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 116 250 2.0E-08
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 110 276 2.0E-08
sp|Q5RKG2|HCFC2_RAT Host cell factor 2 OS=Rattus norvegicus GN=Hcfc2 PE=2 SV=1 145 293 4.0E-08
sp|Q5R8W1|KLDC4_PONAB Kelch domain-containing protein 4 OS=Pongo abelii GN=KLHDC4 PE=2 SV=1 103 252 4.0E-08
sp|Q94BT6|ADO1_ARATH Adagio protein 1 OS=Arabidopsis thaliana GN=ADO1 PE=1 SV=2 116 292 5.0E-08
sp|Q2R2W1|ADO3_ORYSJ Adagio-like protein 3 OS=Oryza sativa subsp. japonica GN=Os11g0547000 PE=2 SV=2 117 279 5.0E-08
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 116 228 5.0E-08
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 100 252 6.0E-08
sp|Q5U580|KLD10_XENLA Kelch domain-containing protein 10 OS=Xenopus laevis GN=klhdc10 PE=2 SV=1 98 293 6.0E-08
sp|Q99LJ7|RCBT2_MOUSE RCC1 and BTB domain-containing protein 2 OS=Mus musculus GN=Rcbtb2 PE=2 SV=1 574 718 6.0E-08
sp|Q9Y2U9|KLDC2_HUMAN Kelch domain-containing protein 2 OS=Homo sapiens GN=KLHDC2 PE=1 SV=1 92 288 6.0E-08
sp|Q0IIC2|KLD10_BOVIN Kelch domain-containing protein 10 OS=Bos taurus GN=KLHDC10 PE=2 SV=1 100 252 7.0E-08
sp|Q5RCZ7|RCBT2_PONAB RCC1 and BTB domain-containing protein 2 OS=Pongo abelii GN=RCBTB2 PE=2 SV=1 574 718 7.0E-08
sp|O95199|RCBT2_HUMAN RCC1 and BTB domain-containing protein 2 OS=Homo sapiens GN=RCBTB2 PE=1 SV=1 574 718 7.0E-08
sp|Q6PID8|KLD10_HUMAN Kelch domain-containing protein 10 OS=Homo sapiens GN=KLHDC10 PE=1 SV=1 100 252 8.0E-08
sp|Q4G5Y1|KLDC2_MOUSE Kelch domain-containing protein 2 OS=Mus musculus GN=Klhdc2 PE=2 SV=3 92 288 8.0E-08
sp|Q3KRE6|KLDC2_RAT Kelch domain-containing protein 2 OS=Rattus norvegicus GN=Klhdc2 PE=2 SV=1 92 288 8.0E-08
sp|Q9SDM9|JAL28_ARATH Nitrile-specifier protein 1 OS=Arabidopsis thaliana GN=NSP1 PE=2 SV=2 100 248 8.0E-08
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 169 276 9.0E-08
sp|Q6PAR0|KLD10_MOUSE Kelch domain-containing protein 10 OS=Mus musculus GN=Klhdc10 PE=1 SV=1 100 252 1.0E-07
sp|Q5U3Y0|KLD10_RAT Kelch domain-containing protein 10 OS=Rattus norvegicus GN=Klhdc10 PE=2 SV=1 100 252 1.0E-07
sp|Q6PDJ6|FBX42_MOUSE F-box only protein 42 OS=Mus musculus GN=Fbxo42 PE=1 SV=1 108 252 1.0E-07
sp|Q6PDJ6|FBX42_MOUSE F-box only protein 42 OS=Mus musculus GN=Fbxo42 PE=1 SV=1 159 293 1.0E-07
sp|Q6PDJ6|FBX42_MOUSE F-box only protein 42 OS=Mus musculus GN=Fbxo42 PE=1 SV=1 120 264 1.0E-07
sp|Q5Z8K3|ADO1_ORYSJ Adagio-like protein 1 OS=Oryza sativa subsp. japonica GN=Os06g0694000 PE=2 SV=1 117 292 1.0E-07
sp|O04316|JAL29_ARATH Nitrile-specifier protein 4 OS=Arabidopsis thaliana GN=NSP4 PE=2 SV=1 100 230 1.0E-07
sp|Q8TBB5|KLDC4_HUMAN Kelch domain-containing protein 4 OS=Homo sapiens GN=KLHDC4 PE=1 SV=1 103 252 1.0E-07
sp|Q6P798|RCBT2_RAT RCC1 and BTB domain-containing protein 2 OS=Rattus norvegicus GN=Rcbtb2 PE=2 SV=1 574 718 1.0E-07
sp|P80197|AFK_PHYPO Actin-fragmin kinase OS=Physarum polycephalum PE=1 SV=2 156 276 2.0E-07
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 159 301 2.0E-07
sp|Q6P3S6|FBX42_HUMAN F-box only protein 42 OS=Homo sapiens GN=FBXO42 PE=1 SV=1 120 255 2.0E-07
sp|Q6P3S6|FBX42_HUMAN F-box only protein 42 OS=Homo sapiens GN=FBXO42 PE=1 SV=1 159 293 2.0E-07
sp|Q5RDA9|FBX42_PONAB F-box only protein 42 OS=Pongo abelii GN=FBXO42 PE=2 SV=1 120 255 2.0E-07
sp|Q5RDA9|FBX42_PONAB F-box only protein 42 OS=Pongo abelii GN=FBXO42 PE=2 SV=1 159 293 2.0E-07
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 114 271 2.0E-07
sp|P38853|KEL1_YEAST Kelch repeat-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL1 PE=1 SV=1 5 276 2.0E-07
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 144 292 3.0E-07
sp|Q5E9A7|KLDC2_BOVIN Kelch domain-containing protein 2 OS=Bos taurus GN=KLHDC2 PE=2 SV=1 92 288 3.0E-07
sp|Q28DE7|KLD10_XENTR Kelch domain-containing protein 10 OS=Xenopus tropicalis GN=klhdc10 PE=2 SV=2 119 252 5.0E-07
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 156 276 8.0E-07
sp|O04318|JAL27_ARATH Nitrile-specifier protein 3 OS=Arabidopsis thaliana GN=NSP3 PE=2 SV=1 100 229 8.0E-07
sp|Q9LR78|BSU1_ARATH Serine/threonine-protein phosphatase BSU1 OS=Arabidopsis thaliana GN=BSU1 PE=1 SV=2 103 252 8.0E-07
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 119 252 1.0E-06
sp|P38853|KEL1_YEAST Kelch repeat-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL1 PE=1 SV=1 89 276 1.0E-06
sp|P38853|KEL1_YEAST Kelch repeat-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL1 PE=1 SV=1 103 294 1.0E-06
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 110 252 1.0E-06
sp|Q5U580|KLD10_XENLA Kelch domain-containing protein 10 OS=Xenopus laevis GN=klhdc10 PE=2 SV=1 119 252 1.0E-06
sp|P34568|BAT43_CAEEL BTB and MATH domain-containing protein 43 OS=Caenorhabditis elegans GN=bath-43 PE=3 SV=2 500 715 1.0E-06
sp|O49326|JAL21_ARATH Nitrile-specifier protein 2 OS=Arabidopsis thaliana GN=NSP2 PE=2 SV=1 100 230 1.0E-06
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 98 280 2.0E-06
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 98 280 2.0E-06
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 98 280 2.0E-06
sp|Q5R8W1|KLDC4_PONAB Kelch domain-containing protein 4 OS=Pongo abelii GN=KLHDC4 PE=2 SV=1 156 279 2.0E-06
sp|Q2LE78|BTBD6_XENLA BTB/POZ domain-containing protein 6 OS=Xenopus laevis GN=btbd6 PE=1 SV=1 549 745 2.0E-06
sp|Q93XW5|NSP5_ARATH Nitrile-specifier protein 5 OS=Arabidopsis thaliana GN=NSP5 PE=2 SV=1 100 292 2.0E-06
sp|Q921I2|KLDC4_MOUSE Kelch domain-containing protein 4 OS=Mus musculus GN=Klhdc4 PE=2 SV=2 168 279 3.0E-06
sp|Q6DBN1|Y4845_ARATH BTB/POZ domain-containing protein At4g08455 OS=Arabidopsis thaliana GN=At4g08455 PE=1 SV=1 565 713 3.0E-06
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 158 292 4.0E-06
sp|P60882|MEGF8_MOUSE Multiple epidermal growth factor-like domains protein 8 OS=Mus musculus GN=Megf8 PE=1 SV=2 115 287 4.0E-06
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 144 292 6.0E-06
sp|Q8TBB5|KLDC4_HUMAN Kelch domain-containing protein 4 OS=Homo sapiens GN=KLHDC4 PE=1 SV=1 156 279 6.0E-06
sp|Q67UX0|ADO2_ORYSJ Putative adagio-like protein 2 OS=Oryza sativa subsp. japonica GN=Os02g0150800 PE=3 SV=1 117 279 6.0E-06
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 100 276 8.0E-06
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 157 252 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6362
MAQPSTPPHQKTTPSSIFGRLASDSHSPPPTPTYSAPAIVGPSTSDSAAQSFLPSATLNSAMTTPSSPASSSKTY
IMPNSPAKTRPFADGYRPKITRTLGQRPACLVNASVTYCGNNQIYAFGGFDQYTDEVYNHVLRLDLASHQWSLVD
NYGDIPGVRMGHTATLYQGDKLLVFGGENEHRTYLSDLIVFDLKTAHWTQPQVSGPIPKGRARHAAVLHEDKLFV
IGGITGQNNYVLDDICYLDLRTFTWSKAWRFVGRFDHSAYIWGDRVWVFGGLSEDMDKISDLWWLDLKGSPEFDS
RPQFGILDRHSMANRANGSPRPPYTVTSAPVVGTSGYAANSRTAQVNTPSFQLKTYALMAPGSISALKFVSGSTI
PSQGSGIHYHAYSSGTLLDFVTPAATITPRECSLSALDLSSLRWQKLAEGREIFKPGYRWHYCTMNEDGTKAWLL
GCPTDPASADLGPNGYEEYLSDIMEIDLRRYGFLGNHMTPESRIESRPLNASRLVDFPSKGLGSDLAKLFNHAPE
TGSGTDFVVTALADDYEQDDGLGSGLVRGDEVSCDETWLAQDAPTSQPIHVHKLILQARWPHFARLYSAQMAEFH
TKRMHIPEPYPVVRAFLLYLYTDSIRGTAEPDGDATTDLSDVAGLLVMSNIYNIPHLRLLCVNRLAKELDVEHAC
VTWYCAGLANEEWLRKRAATFCMTHWGRIVRTQGFVRLPRSALVELSQEVDMEGRIVAGEELEWSSMTARYGELG
HGARKESISSSQAQMVESEADDDDGMELG*
Coding >OphauG2|6362
ATGGCACAACCGTCCACGCCTCCTCATCAGAAGACAACTCCATCGTCCATCTTTGGCCGCTTGGCCTCGGACTCT
CATTCTCCCCCCCCCACTCCCACTTACTCAGCCCCGGCCATCGTGGGCCCTTCGACGTCGGATTCGGCTGCACAG
TCTTTTCTGCCTTCTGCCACTCTCAACTCGGCCATGACGACGCCTTCCTCGCCCGCTTCATCCTCAAAAACGTAC
ATCATGCCCAACTCGCCCGCCAAGACTCGTCCTTTCGCCGACGGCTATCGGCCAAAAATCACGCGAACCTTGGGC
CAGCGGCCGGCCTGCTTGGTCAACGCATCTGTCACTTATTGCGGCAATAACCAGATATATGCCTTTGGAGGCTTC
GACCAGTATACAGATGAAGTGTACAACCATGTCTTGCGTCTTGATCTCGCCAGCCATCAGTGGAGCCTGGTTGAT
AACTATGGCGACATACCTGGTGTTCGCATGGGACACACGGCTACCCTCTACCAGGGAGACAAGCTTCTTGTATTT
GGCGGAGAAAACGAGCACCGGACATACCTCTCGGACCTCATTGTCTTTGACCTCAAGACTGCCCACTGGACTCAG
CCCCAGGTTTCTGGTCCGATACCCAAGGGACGAGCTCGGCATGCAGCTGTACTTCACGAAGACAAGCTGTTTGTC
ATTGGCGGCATCACTGGGCAGAACAACTATGTGTTGGATGACATTTGCTACCTCGACTTGCGCACCTTTACCTGG
TCCAAGGCATGGCGCTTTGTCGGTCGATTCGACCACTCTGCCTACATATGGGGCGATCGTGTATGGGTTTTTGGA
GGCTTGAGTGAAGACATGGACAAGATTAGCGATCTCTGGTGGCTTGACCTCAAAGGCAGTCCTGAATTCGACTCT
CGTCCTCAATTTGGAATCTTGGACCGCCACTCCATGGCAAATCGAGCCAATGGCTCTCCTAGACCGCCCTACACC
GTCACCTCGGCGCCTGTTGTAGGAACCTCTGGCTATGCTGCCAACTCACGTACCGCACAGGTCAACACACCCTCG
TTCCAGCTCAAGACGTATGCTCTCATGGCACCAGGCTCTATATCAGCTCTCAAGTTTGTTTCCGGGTCTACGATT
CCCTCTCAGGGGTCTGGTATCCACTACCATGCATATTCTTCGGGCACTCTGCTCGACTTTGTGACGCCAGCGGCC
ACAATTACTCCGCGAGAGTGTTCACTTTCGGCTTTGGATCTGTCATCTTTGCGGTGGCAGAAATTGGCCGAGGGC
CGTGAGATCTTCAAACCGGGGTATAGATGGCATTACTGTACCATGAATGAGGACGGCACTAAAGCATGGCTCCTT
GGATGTCCAACAGATCCTGCATCGGCCGACCTCGGGCCCAACGGCTATGAAGAATACCTCAGTGACATTATGGAG
ATTGATCTTCGACGATATGGCTTCCTCGGCAACCACATGACGCCCGAGTCGCGAATCGAGTCGCGGCCATTGAAT
GCTTCGCGCCTTGTCGATTTTCCTTCCAAGGGACTGGGTTCGGATCTGGCCAAGCTCTTCAACCATGCACCCGAG
ACGGGCAGCGGCACAGACTTTGTCGTGACGGCCTTGGCCGATGACTATGAGCAAGACGACGGCCTTGGCTCGGGG
CTTGTGAGAGGCGATGAAGTGTCTTGCGATGAAACGTGGTTGGCACAGGATGCTCCCACGTCTCAGCCAATCCAC
GTTCACAAGCTGATATTGCAGGCGCGCTGGCCTCATTTCGCACGCCTCTACAGCGCGCAAATGGCCGAGTTTCAC
ACCAAGCGGATGCACATTCCCGAGCCGTACCCGGTTGTCCGGGCCTTTCTCTTGTATCTCTACACGGACAGCATT
CGCGGCACGGCCGAGCCAGATGGCGACGCAACGACCGACTTGTCCGACGTGGCTGGCCTGCTCGTCATGTCCAAC
ATCTACAATATTCCGCATCTGCGCCTCTTGTGCGTCAACCGCCTTGCCAAGGAACTCGACGTTGAACATGCCTGC
GTGACGTGGTACTGCGCTGGCCTGGCCAATGAAGAGTGGCTGCGCAAGCGCGCCGCTACGTTTTGCATGACGCAC
TGGGGCCGCATTGTGCGCACGCAGGGCTTTGTCCGCCTGCCTCGCAGCGCTCTGGTGGAGCTGTCGCAAGAAGTC
GACATGGAAGGCCGCATCGTGGCTGGCGAAGAGCTGGAATGGAGCAGCATGACGGCACGGTATGGCGAGCTGGGC
CACGGCGCGCGAAAGGAGAGCATCAGCAGCAGCCAGGCCCAGATGGTTGAGTCCGAGGCCGACGACGATGACGGC
ATGGAGCTGGGCTAG
Transcript >OphauG2|6362
ATGGCACAACCGTCCACGCCTCCTCATCAGAAGACAACTCCATCGTCCATCTTTGGCCGCTTGGCCTCGGACTCT
CATTCTCCCCCCCCCACTCCCACTTACTCAGCCCCGGCCATCGTGGGCCCTTCGACGTCGGATTCGGCTGCACAG
TCTTTTCTGCCTTCTGCCACTCTCAACTCGGCCATGACGACGCCTTCCTCGCCCGCTTCATCCTCAAAAACGTAC
ATCATGCCCAACTCGCCCGCCAAGACTCGTCCTTTCGCCGACGGCTATCGGCCAAAAATCACGCGAACCTTGGGC
CAGCGGCCGGCCTGCTTGGTCAACGCATCTGTCACTTATTGCGGCAATAACCAGATATATGCCTTTGGAGGCTTC
GACCAGTATACAGATGAAGTGTACAACCATGTCTTGCGTCTTGATCTCGCCAGCCATCAGTGGAGCCTGGTTGAT
AACTATGGCGACATACCTGGTGTTCGCATGGGACACACGGCTACCCTCTACCAGGGAGACAAGCTTCTTGTATTT
GGCGGAGAAAACGAGCACCGGACATACCTCTCGGACCTCATTGTCTTTGACCTCAAGACTGCCCACTGGACTCAG
CCCCAGGTTTCTGGTCCGATACCCAAGGGACGAGCTCGGCATGCAGCTGTACTTCACGAAGACAAGCTGTTTGTC
ATTGGCGGCATCACTGGGCAGAACAACTATGTGTTGGATGACATTTGCTACCTCGACTTGCGCACCTTTACCTGG
TCCAAGGCATGGCGCTTTGTCGGTCGATTCGACCACTCTGCCTACATATGGGGCGATCGTGTATGGGTTTTTGGA
GGCTTGAGTGAAGACATGGACAAGATTAGCGATCTCTGGTGGCTTGACCTCAAAGGCAGTCCTGAATTCGACTCT
CGTCCTCAATTTGGAATCTTGGACCGCCACTCCATGGCAAATCGAGCCAATGGCTCTCCTAGACCGCCCTACACC
GTCACCTCGGCGCCTGTTGTAGGAACCTCTGGCTATGCTGCCAACTCACGTACCGCACAGGTCAACACACCCTCG
TTCCAGCTCAAGACGTATGCTCTCATGGCACCAGGCTCTATATCAGCTCTCAAGTTTGTTTCCGGGTCTACGATT
CCCTCTCAGGGGTCTGGTATCCACTACCATGCATATTCTTCGGGCACTCTGCTCGACTTTGTGACGCCAGCGGCC
ACAATTACTCCGCGAGAGTGTTCACTTTCGGCTTTGGATCTGTCATCTTTGCGGTGGCAGAAATTGGCCGAGGGC
CGTGAGATCTTCAAACCGGGGTATAGATGGCATTACTGTACCATGAATGAGGACGGCACTAAAGCATGGCTCCTT
GGATGTCCAACAGATCCTGCATCGGCCGACCTCGGGCCCAACGGCTATGAAGAATACCTCAGTGACATTATGGAG
ATTGATCTTCGACGATATGGCTTCCTCGGCAACCACATGACGCCCGAGTCGCGAATCGAGTCGCGGCCATTGAAT
GCTTCGCGCCTTGTCGATTTTCCTTCCAAGGGACTGGGTTCGGATCTGGCCAAGCTCTTCAACCATGCACCCGAG
ACGGGCAGCGGCACAGACTTTGTCGTGACGGCCTTGGCCGATGACTATGAGCAAGACGACGGCCTTGGCTCGGGG
CTTGTGAGAGGCGATGAAGTGTCTTGCGATGAAACGTGGTTGGCACAGGATGCTCCCACGTCTCAGCCAATCCAC
GTTCACAAGCTGATATTGCAGGCGCGCTGGCCTCATTTCGCACGCCTCTACAGCGCGCAAATGGCCGAGTTTCAC
ACCAAGCGGATGCACATTCCCGAGCCGTACCCGGTTGTCCGGGCCTTTCTCTTGTATCTCTACACGGACAGCATT
CGCGGCACGGCCGAGCCAGATGGCGACGCAACGACCGACTTGTCCGACGTGGCTGGCCTGCTCGTCATGTCCAAC
ATCTACAATATTCCGCATCTGCGCCTCTTGTGCGTCAACCGCCTTGCCAAGGAACTCGACGTTGAACATGCCTGC
GTGACGTGGTACTGCGCTGGCCTGGCCAATGAAGAGTGGCTGCGCAAGCGCGCCGCTACGTTTTGCATGACGCAC
TGGGGCCGCATTGTGCGCACGCAGGGCTTTGTCCGCCTGCCTCGCAGCGCTCTGGTGGAGCTGTCGCAAGAAGTC
GACATGGAAGGCCGCATCGTGGCTGGCGAAGAGCTGGAATGGAGCAGCATGACGGCACGGTATGGCGAGCTGGGC
CACGGCGCGCGAAAGGAGAGCATCAGCAGCAGCCAGGCCCAGATGGTTGAGTCCGAGGCCGACGACGATGACGGC
ATGGAGCTGGGCTAG
Gene >OphauG2|6362
ATGGCACAACCGTCCACGCCTCCTCATCAGAAGACAACTCCATCGTCCATCTTTGGCCGCTTGGCCTCGGACTCT
CATTCTCCCCCCCCCACTCCCACTTACTCAGCCCCGGCCATCGTGGGCCCTTCGACGTCGGATTCGGCTGCACAG
TCTTTTCTGCCTTCTGCCACTCTCAACTCGGCCATGACGACGCCTTCCTCGCCCGCTTCATCCTCAAAAACGTAC
ATCATGCCCAACTCGCCCGCCAAGACTCGTCCTTTCGCCGACGGCTATCGGCCAAAAATCACGCGAACCTTGGGC
CAGCGGCCGGCCTGCTTGGTCAACGCATCTGTCACTTATTGCGGCAATAACCAGATATATGCCTTTGGAGGCTTC
GACCAGTATACAGATGAAGTGTACAACCATGTCTTGCGTCTTGATCTCGCCAGCCATCAGTGGAGCCTGGTTGAT
AACTATGGCGACATACCTGGTGTTCGCATGGGTGAGACTGTTGGCTTCCGTGCCCATGCACTGCTTCTCTAACAT
GAGGCGGCATAGGACACACGGCTACCCTCTACCAGGGAGACAAGCTTCTTGTATTTGGCGGAGAAAACGAGCACC
GGACATACCTCTCGGACCTCATTGTCTTTGACCTCAAGACTGCCCACTGGACTCAGCCCCAGGTTTCTGGTCCGA
TACCCAAGGGACGAGCTCGGCATGCAGCTGTACTTCACGAAGACAAGCTGTTTGTCATTGGCGGCATCACTGGGC
AGAACAACTATGTGTTGGATGACATTTGCTACCTCGACTTGCGCACCTTTACCTGGTCCAAGGCATGGCGCTTTG
TCGGTCGATTCGACCACTCTGCCTACATATGGGGCGATCGTGTATGGGTTTTTGGAGGCTTGAGTGAAGACATGG
ACAAGATTAGCGATCTCTGGTGGCTTGACCTCAAAGGCAGTCCTGAATTCGACTCTCGTCCTCAATTTGGAATCT
TGGACCGCCACTCCATGGCAAATCGAGCCAATGGCTCTCCTAGACCGCCCTACACCGTCACCTCGGCGCCTGTTG
TAGGAACCTCTGGCTATGCTGCCAACTCACGTACCGCACAGGTCAACACACCCTCGTTCCAGCTCAAGACGTATG
CTCTCATGGCACCAGGCTCTATATCAGCTCTCAAGTTTGTTTCCGGGTCTACGATTCCCTCTCAGGGGTCTGGTA
TCCACTACCATGCATATTCTTCGGGCACTCTGCTCGACTTTGTGACGCCAGCGGCCACAATTACTCCGCGAGAGT
GTTCACTTTCGGCTTTGGATCTGTCATCTTTGCGGTGGCAGAAATTGGCCGAGGGCCGTGAGATCTTCAAACCGG
GGTATAGATGGCATTACTGTACCATGAATGAGGACGGCACTAAAGCATGGCTCCTTGGATGTCCAACAGATCCTG
CATCGGCCGACCTCGGGCCCAACGGCTATGAAGAATACCTCAGGTGAGTGTTTTGGTTGTCGACTTGGCCGAGTC
AAGCTCATTGTTGCAGTGACATTATGGAGATTGATCTTCGACGATATGGCTTCCTCGGCAACCACATGACGCCCG
AGTCGCGAATCGAGTCGCGGCCATTGAATGCTTCGCGCCTTGTCGATTTTCCTTCCAAGGGACTGGGTTCGGATC
TGGCCAAGCTCTTCAACCATGCACCCGAGACGGGCAGCGGCACAGACTTTGTCGTGACGGCCTTGGCCGATGACT
ATGAGCAAGACGACGGCCTTGGCTCGGGGCTTGTGAGAGGCGATGAAGTGTCTTGCGATGAAACGTGGTTGGCAC
AGGATGCTCCCACGTCTCAGCCAATCCACGTTCACAAGCTGATATTGCAGGCGCGCTGGCCTCATTTCGCACGCC
TCTACAGCGCGCAAATGGCCGAGTTTCACACCAAGCGGATGCACATTCCCGAGCCGTACCCGGTTGTCCGGGCCT
TTCTCTTGTATCTCTACACGGACAGCATTCGCGGCACGGCCGAGCCAGATGGCGACGCAACGACCGACTTGTCCG
ACGTGGCTGGCCTGCTCGTCATGTCCAACATCTACAATATTCCGCATCTGCGCCTCTTGTGCGTCAACCGCCTTG
CCAAGGAACTCGACGTTGAACATGCCTGCGTGACGTGGTACTGCGCTGGCCTGGCCAATGAAGAGTGGCTGCGCA
AGCGCGCCGCTACGTTTTGCATGACGCACTGGGGCCGCATTGTGCGCACGCAGGGCTTTGTCCGCCTGCCTCGCA
GCGCTCTGGTGGAGCTGTCGCAAGAAGTCGACATGGAAGGCCGCATCGTGGCTGGCGAAGAGCTGGAATGGAGCA
GCATGACGGCACGGTATGGCGAGCTGGGCCACGGCGCGCGAAAGGAGAGCATCAGCAGCAGCCAGGCCCAGATGG
TTGAGTCCGAGGCCGACGACGATGACGGCATGGAGCTGGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail