Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6361
Gene name
LocationContig_65:13135..14804
Strand-
Gene length (bp)1669
Transcript length (bp)1611
Coding sequence length (bp)1611
Protein length (aa) 537

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00400 WD40 WD domain, G-beta repeat 1.7E-01 267 294
PF00400 WD40 WD domain, G-beta repeat 2.4E-04 342 377
PF00400 WD40 WD domain, G-beta repeat 1.2E-01 389 423
PF00400 WD40 WD domain, G-beta repeat 4.1E-02 433 465
PF00400 WD40 WD domain, G-beta repeat 5.0E-02 476 508
PF12894 ANAPC4_WD40 Anaphase-promoting complex subunit 4 WD40 domain 1.3E-06 250 318
PF12894 ANAPC4_WD40 Anaphase-promoting complex subunit 4 WD40 domain 1.1E-04 337 401

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P78972|SLP1_SCHPO WD repeat-containing protein slp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=slp1 PE=1 SV=1 6 511 6.0E-164
sp|Q12834|CDC20_HUMAN Cell division cycle protein 20 homolog OS=Homo sapiens GN=CDC20 PE=1 SV=2 89 511 5.0E-113
sp|Q54MZ3|CDC20_DICDI Anaphase-promoting complex subunit cdc20 OS=Dictyostelium discoideum GN=cdc20 PE=1 SV=1 156 513 5.0E-113
sp|Q5H7C0|CDC20_PIG Cell division cycle protein 20 homolog OS=Sus scrofa GN=CDC20 PE=2 SV=1 89 511 8.0E-112
sp|Q9JJ66|CDC20_MOUSE Cell division cycle protein 20 homolog OS=Mus musculus GN=Cdc20 PE=1 SV=2 89 511 9.0E-112
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P78972|SLP1_SCHPO WD repeat-containing protein slp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=slp1 PE=1 SV=1 6 511 6.0E-164
sp|Q12834|CDC20_HUMAN Cell division cycle protein 20 homolog OS=Homo sapiens GN=CDC20 PE=1 SV=2 89 511 5.0E-113
sp|Q54MZ3|CDC20_DICDI Anaphase-promoting complex subunit cdc20 OS=Dictyostelium discoideum GN=cdc20 PE=1 SV=1 156 513 5.0E-113
sp|Q5H7C0|CDC20_PIG Cell division cycle protein 20 homolog OS=Sus scrofa GN=CDC20 PE=2 SV=1 89 511 8.0E-112
sp|Q9JJ66|CDC20_MOUSE Cell division cycle protein 20 homolog OS=Mus musculus GN=Cdc20 PE=1 SV=2 89 511 9.0E-112
sp|Q62623|CDC20_RAT Cell division cycle protein 20 homolog OS=Rattus norvegicus GN=Cdc20 PE=1 SV=2 89 511 1.0E-111
sp|P26309|CDC20_YEAST APC/C activator protein CDC20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC20 PE=1 SV=2 88 522 1.0E-111
sp|Q9S7I8|CDC22_ARATH Cell division cycle 20.2, cofactor of APC complex OS=Arabidopsis thaliana GN=CDC20-2 PE=1 SV=1 90 510 2.0E-105
sp|Q9SZA4|CDC21_ARATH Cell division cycle 20.1, cofactor of APC complex OS=Arabidopsis thaliana GN=CDC20-1 PE=1 SV=1 90 510 5.0E-105
sp|Q3E906|CD205_ARATH Cell division cycle 20.5, cofactor of APC complex OS=Arabidopsis thaliana GN=CDC20-5 PE=1 SV=2 70 510 3.0E-100
sp|Q9S7H3|CD203_ARATH Cell division cycle 20.3, cofactor of APC complex OS=Arabidopsis thaliana GN=CDC20-3 PE=3 SV=1 90 510 2.0E-99
sp|Q4PSE4|CDC24_ARATH Cell division cycle 20.4, cofactor of APC complex OS=Arabidopsis thaliana GN=CDC20-4 PE=2 SV=1 90 510 7.0E-96
sp|Q8LPL5|FZR3_ARATH Protein FIZZY-RELATED 3 OS=Arabidopsis thaliana GN=FZR3 PE=1 SV=1 215 510 4.0E-93
sp|Q8L3Z8|FZR2_ARATH Protein FIZZY-RELATED 2 OS=Arabidopsis thaliana GN=FZR2 PE=1 SV=1 87 510 1.0E-88
sp|Q9UM11|FZR_HUMAN Fizzy-related protein homolog OS=Homo sapiens GN=FZR1 PE=1 SV=2 88 512 1.0E-87
sp|Q9R1K5|FZR_MOUSE Fizzy-related protein homolog OS=Mus musculus GN=Fzr1 PE=1 SV=1 60 512 2.0E-87
sp|O13286|SRW1_SCHPO WD repeat-containing protein srw1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srw1 PE=1 SV=1 207 514 3.0E-85
sp|Q8VZS9|FZR1_ARATH Protein FIZZY-RELATED 1 OS=Arabidopsis thaliana GN=FZR1 PE=1 SV=1 87 528 5.0E-85
sp|Q54KM3|CDH1_DICDI Anaphase-promoting complex subunit cdh1 OS=Dictyostelium discoideum GN=cdh1 PE=3 SV=1 187 510 1.0E-84
sp|O94423|MFR1_SCHPO Meiotic fizzy-related protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfr1 PE=1 SV=1 194 513 5.0E-80
sp|F4K5R6|CDC26_ARATH Cell division cycle 20.6, cofactor of APC complex OS=Arabidopsis thaliana GN=CDC20-6 PE=3 SV=1 243 510 3.0E-74
sp|P53197|CDH1_YEAST APC/C activator protein CDH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDH1 PE=1 SV=1 207 512 2.0E-73
sp|Q86Y33|CD20B_HUMAN Cell division cycle protein 20 homolog B OS=Homo sapiens GN=CDC20B PE=1 SV=3 213 510 6.0E-67
sp|O94411|MFR2_SCHPO Meiotic fizzy-related protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfr2 PE=1 SV=1 72 510 3.0E-60
sp|Q09786|YA98_SCHPO Uncharacterized WD repeat-containing protein C13G6.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13G6.08 PE=3 SV=1 213 512 7.0E-52
sp|P50082|AMA1_YEAST Meiosis-specific APC/C activator protein AMA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AMA1 PE=1 SV=2 205 513 8.0E-45
sp|Q09373|FZY1_CAEEL WD repeat-containing protein fzy-1 OS=Caenorhabditis elegans GN=fzy-1 PE=3 SV=2 67 510 2.0E-36
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 236 507 1.0E-17
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 247 514 5.0E-16
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 242 514 8.0E-16
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 244 509 2.0E-15
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 244 507 2.0E-14
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 244 509 3.0E-14
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 244 509 5.0E-14
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 244 516 8.0E-14
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 236 509 5.0E-13
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 234 507 5.0E-13
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 244 509 7.0E-13
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 269 507 1.0E-12
sp|Q9DAW6|PRP4_MOUSE U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 288 507 1.0E-12
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 236 507 2.0E-12
sp|O43172|PRP4_HUMAN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 288 507 2.0E-12
sp|Q3MHE2|PRP4_BOVIN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 270 507 2.0E-12
sp|Q5NVD0|PRP4_PONAB U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 288 507 2.0E-12
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 240 509 3.0E-12
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 244 509 5.0E-12
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 244 508 6.0E-12
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 236 513 7.0E-12
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 230 423 9.0E-12
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 244 509 1.0E-11
sp|Q09715|TUP11_SCHPO Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 234 509 1.0E-11
sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 236 507 1.0E-11
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 234 508 1.0E-11
sp|Q9FLX9|NLE1_ARATH Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 256 508 1.0E-11
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 244 508 2.0E-11
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 256 507 3.0E-11
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 345 507 5.0E-11
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 244 508 6.0E-11
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 348 513 7.0E-11
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 230 423 8.0E-11
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 244 508 9.0E-11
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 244 508 1.0E-10
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 244 508 1.0E-10
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 244 508 1.0E-10
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 244 507 1.0E-10
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 244 508 1.0E-10
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 242 446 1.0E-10
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 244 508 1.0E-10
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 230 423 1.0E-10
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 269 467 1.0E-10
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 244 508 1.0E-10
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 244 509 2.0E-10
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 209 509 2.0E-10
sp|Q93847|YZLL_CAEEL Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 269 509 2.0E-10
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 244 507 2.0E-10
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 244 509 2.0E-10
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 244 508 2.0E-10
sp|A1C6X5|SEC31_ASPCL Protein transport protein sec31 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sec31 PE=3 SV=1 281 466 2.0E-10
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 290 513 3.0E-10
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 244 507 3.0E-10
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 320 509 4.0E-10
sp|A1DHK2|SEC31_NEOFI Protein transport protein sec31 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sec31 PE=3 SV=1 281 466 4.0E-10
sp|P93107|PF20_CHLRE Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 268 507 6.0E-10
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 244 507 6.0E-10
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 242 509 7.0E-10
sp|P0CS46|PFS2_CRYNJ Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PFS2 PE=3 SV=1 272 507 9.0E-10
sp|Q9EPV5|APAF_RAT Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 175 508 9.0E-10
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 244 507 9.0E-10
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 269 509 1.0E-09
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 236 508 1.0E-09
sp|P0CS47|PFS2_CRYNB Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PFS2 PE=3 SV=1 272 507 1.0E-09
sp|Q4X0M4|SEC31_ASPFU Protein transport protein sec31 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sec31 PE=3 SV=1 281 466 1.0E-09
sp|O13637|SEC31_SCHPO Protein transport protein sec31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec31 PE=1 SV=1 281 446 1.0E-09
sp|Q42384|PRL1_ARATH Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 244 508 1.0E-09
sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 266 509 2.0E-09
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 165 507 2.0E-09
sp|P74598|Y1491_SYNY3 Uncharacterized WD repeat-containing protein sll1491 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1491 PE=3 SV=1 275 509 3.0E-09
sp|Q5RF51|SNR40_PONAB U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 242 509 3.0E-09
sp|Q9UTC7|YIDC_SCHPO Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 269 507 3.0E-09
sp|Q969H0|FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 217 509 3.0E-09
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 270 507 5.0E-09
sp|Q6NLV4|FY_ARATH Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 228 507 5.0E-09
sp|Q8VBV4|FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 217 509 5.0E-09
sp|Q54JS5|WDR24_DICDI WD repeat-containing protein 24 homolog OS=Dictyostelium discoideum GN=wdr24 PE=3 SV=1 281 478 5.0E-09
sp|F1MNN4|FBXW7_BOVIN F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 217 509 6.0E-09
sp|A2QBZ0|SEC31_ASPNC Protein transport protein sec31 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sec31 PE=3 SV=1 249 466 6.0E-09
sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 278 507 6.0E-09
sp|Q9M2Z2|WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 269 507 6.0E-09
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 172 507 6.0E-09
sp|Q8JZX3|POC1A_MOUSE POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 269 513 7.0E-09
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 244 507 7.0E-09
sp|C4YFX2|TUP1_CANAW Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 269 507 7.0E-09
sp|P0CY34|TUP1_CANAL Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 269 507 7.0E-09
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 244 507 8.0E-09
sp|Q8W1K8|MUT11_CHLRE Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 337 507 1.0E-08
sp|Q6PE01|SNR40_MOUSE U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 242 509 1.0E-08
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 230 423 1.0E-08
sp|O48847|LUH_ARATH Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana GN=LUH PE=1 SV=1 242 508 1.0E-08
sp|Q3Y8L7|DAW1_CHLRE Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 235 507 1.0E-08
sp|Q96DI7|SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 242 509 1.0E-08
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 244 507 1.0E-08
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 244 507 1.0E-08
sp|O88879|APAF_MOUSE Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 236 508 1.0E-08
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 345 507 2.0E-08
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 270 495 2.0E-08
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 230 433 2.0E-08
sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 230 433 2.0E-08
sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 239 378 2.0E-08
sp|Q2HJH6|SNR40_BOVIN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 242 509 2.0E-08
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 239 378 3.0E-08
sp|Q91854|TRCB_XENLA Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 257 509 3.0E-08
sp|Q8SRK1|HAT2_ENCCU Histone acetyltransferase type B subunit 2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=HAT2 PE=1 SV=1 316 468 3.0E-08
sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 239 423 3.0E-08
sp|P20053|PRP4_YEAST U4/U6 small nuclear ribonucleoprotein PRP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP4 PE=1 SV=1 348 507 3.0E-08
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 239 509 3.0E-08
sp|O82266|SWA1_ARATH Protein SLOW WALKER 1 OS=Arabidopsis thaliana GN=SWA1 PE=2 SV=1 269 443 3.0E-08
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 265 507 4.0E-08
sp|Q6PH57|GBB1_DANRE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1 267 507 4.0E-08
sp|Q5S580|SEC31_AJECA Protein transport protein SEC31 OS=Ajellomyces capsulatus GN=SEC31 PE=1 SV=1 281 466 5.0E-08
sp|Q9FLX9|NLE1_ARATH Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 268 507 6.0E-08
sp|Q96J01|THOC3_HUMAN THO complex subunit 3 OS=Homo sapiens GN=THOC3 PE=1 SV=1 341 511 7.0E-08
sp|B5X3C4|LIS1B_SALSA Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 244 509 7.0E-08
sp|Q9Y297|FBW1A_HUMAN F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1 257 509 8.0E-08
sp|Q9QXE7|TBL1X_MOUSE F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 266 507 8.0E-08
sp|Q873A1|SEC31_NEUCR Protein transport protein sec31 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sec31 PE=3 SV=1 281 466 8.0E-08
sp|Q873A1|SEC31_NEUCR Protein transport protein sec31 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sec31 PE=3 SV=1 284 501 9.0E-08
sp|Q3ULA2|FBW1A_MOUSE F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 257 510 9.0E-08
sp|P38968|SEC31_YEAST Protein transport protein SEC31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC31 PE=1 SV=3 225 471 9.0E-08
sp|Q2TBP4|POC1A_BOVIN POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 269 513 9.0E-08
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 269 467 1.0E-07
sp|Q95RJ9|EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 262 507 1.0E-07
sp|O75529|TAF5L_HUMAN TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 364 536 1.0E-07
sp|Q1DX43|SEC31_COCIM Protein transport protein SEC31 OS=Coccidioides immitis (strain RS) GN=SEC31 PE=3 SV=1 281 457 1.0E-07
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 278 501 2.0E-07
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 270 465 2.0E-07
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 276 495 2.0E-07
sp|Q5AZM3|SEC31_EMENI Protein transport protein sec31 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sec31 PE=3 SV=2 281 466 2.0E-07
sp|O74319|TAF73_SCHPO Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 249 425 2.0E-07
sp|Q6L4F8|GBLPB_ORYSJ Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1 268 509 2.0E-07
sp|Q7SZM9|TB1RA_XENLA F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 266 536 2.0E-07
sp|P49027|GBLPA_ORYSJ Guanine nucleotide-binding protein subunit beta-like protein A OS=Oryza sativa subsp. japonica GN=RACK1A PE=1 SV=1 268 509 2.0E-07
sp|Q6GPC6|TB1RB_XENLA F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 266 536 2.0E-07
sp|Q0CYG9|SEC31_ASPTN Protein transport protein sec31 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sec31 PE=3 SV=1 281 466 2.0E-07
sp|Q9BZK7|TBL1R_HUMAN F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 266 536 2.0E-07
sp|Q91WQ5|TAF5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 364 509 2.0E-07
sp|Q8BHJ5|TBL1R_MOUSE F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 266 536 2.0E-07
sp|Q9BQ87|TBL1Y_HUMAN F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 266 507 2.0E-07
sp|Q9XGN1|TTG1_ARATH Protein TRANSPARENT TESTA GLABRA 1 OS=Arabidopsis thaliana GN=TTG1 PE=1 SV=1 292 445 2.0E-07
sp|P79959|GBB1_XENLA Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Xenopus laevis GN=gnb1 PE=2 SV=1 267 507 2.0E-07
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 269 507 3.0E-07
sp|O02482|UNC37_CAEEL Transcription factor unc-37 OS=Caenorhabditis elegans GN=unc-37 PE=1 SV=1 256 509 3.0E-07
sp|Q9UTN4|PFS2_SCHPO Polyadenylation factor subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfs2 PE=3 SV=1 260 507 3.0E-07
sp|P93340|GBLP_NICPL Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1 268 509 3.0E-07
sp|Q5DFU0|CIAO1_SCHJA Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Schistosoma japonicum PE=2 SV=1 347 507 3.0E-07
sp|P49026|GBLP_TOBAC Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana tabacum GN=ARCA PE=2 SV=1 268 509 3.0E-07
sp|Q6P5M2|WDR61_DANRE WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 243 468 3.0E-07
sp|P90648|MHCKB_DICDI Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 280 507 3.0E-07
sp|Q803D2|LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 244 509 3.0E-07
sp|Q1LV15|DAW1_DANRE Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 172 509 4.0E-07
sp|Q5GIS3|GBB_PINFU Guanine nucleotide-binding protein subunit beta OS=Pinctada fucata PE=1 SV=1 267 507 4.0E-07
sp|Q9Z1Z2|STRAP_MOUSE Serine-threonine kinase receptor-associated protein OS=Mus musculus GN=Strap PE=1 SV=2 292 516 4.0E-07
sp|Q26544|WSL17_SCHMA WD repeat-containing protein SL1-17 OS=Schistosoma mansoni PE=2 SV=1 243 509 4.0E-07
sp|Q9SZQ5|VIP3_ARATH WD repeat-containing protein VIP3 OS=Arabidopsis thaliana GN=VIP3 PE=1 SV=1 262 402 4.0E-07
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 335 508 5.0E-07
sp|Q2KID6|PLRG1_BOVIN Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1 181 508 5.0E-07
sp|Q10282|GBB_SCHPO Guanine nucleotide-binding protein subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=git5 PE=3 SV=2 269 507 5.0E-07
sp|Q5JTN6|WDR38_HUMAN WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 269 507 5.0E-07
sp|P0CS38|HIR1_CRYNJ Protein HIR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HIR1 PE=3 SV=1 242 508 5.0E-07
sp|P0CS39|HIR1_CRYNB Protein HIR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HIR1 PE=3 SV=1 242 508 5.0E-07
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 239 376 5.0E-07
sp|Q91WM3|U3IP2_MOUSE U3 small nucleolar RNA-interacting protein 2 OS=Mus musculus GN=Rrp9 PE=1 SV=1 348 468 5.0E-07
sp|Q6FJS0|PFS2_CANGA Polyadenylation factor subunit 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFS2 PE=3 SV=1 184 507 6.0E-07
sp|B5X3Z6|LIS1A_SALSA Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 244 508 6.0E-07
sp|O13615|PRP46_SCHPO Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1 227 508 7.0E-07
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 391 513 7.0E-07
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 391 513 7.0E-07
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 234 414 8.0E-07
sp|Q2UF60|SEC31_ASPOR Protein transport protein sec31 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sec31 PE=3 SV=2 281 466 9.0E-07
sp|Q5E959|STRAP_BOVIN Serine-threonine kinase receptor-associated protein OS=Bos taurus GN=STRAP PE=2 SV=1 292 516 9.0E-07
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 244 392 9.0E-07
sp|A1CF18|LIS12_ASPCL Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 244 446 9.0E-07
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 244 443 1.0E-06
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 360 514 1.0E-06
sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 342 522 1.0E-06
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 244 507 1.0E-06
sp|Q54LT8|STRAP_DICDI Serine-threonine kinase receptor-associated protein OS=Dictyostelium discoideum GN=strap PE=3 SV=1 275 508 1.0E-06
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 244 508 1.0E-06
sp|Q5A7Q3|PRP46_CANAL Pre-mRNA-splicing factor PRP46 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP46 PE=3 SV=1 244 507 1.0E-06
sp|Q2GVT8|SEC31_CHAGB Protein transport protein SEC31 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SEC31 PE=3 SV=1 281 466 1.0E-06
sp|P42841|PFS2_YEAST Polyadenylation factor subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFS2 PE=1 SV=1 249 507 1.0E-06
sp|O43660|PLRG1_HUMAN Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1 236 421 1.0E-06
sp|Q4RJN5|LIS1_TETNG Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 238 509 1.0E-06
sp|P23232|GBB_LOLFO Guanine nucleotide-binding protein subunit beta OS=Loligo forbesi PE=2 SV=1 267 507 1.0E-06
sp|Q9WUC8|PLRG1_RAT Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1 236 421 1.0E-06
sp|Q8NBT0|POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 269 513 1.0E-06
sp|O14727|APAF_HUMAN Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 236 508 1.0E-06
sp|Q9VZF4|FBXW7_DROME F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 224 509 1.0E-06
sp|Q6BU94|PRP46_DEBHA Pre-mRNA-splicing factor PRP46 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP46 PE=3 SV=2 269 507 1.0E-06
sp|P54311|GBB1_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Rattus norvegicus GN=Gnb1 PE=1 SV=4 267 507 1.0E-06
sp|P62874|GBB1_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus GN=Gnb1 PE=1 SV=3 267 507 1.0E-06
sp|P62873|GBB1_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homo sapiens GN=GNB1 PE=1 SV=3 267 507 1.0E-06
sp|P62872|GBB1_CANLF Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Canis lupus familiaris GN=GNB1 PE=2 SV=3 267 507 1.0E-06
sp|P62871|GBB1_BOVIN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Bos taurus GN=GNB1 PE=1 SV=3 267 507 1.0E-06
sp|P25387|GBLP_CHLRE Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 231 509 1.0E-06
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 335 508 2.0E-06
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 335 508 2.0E-06
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 335 508 2.0E-06
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 269 514 2.0E-06
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 234 414 2.0E-06
sp|Q5JTN6|WDR38_HUMAN WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 244 503 2.0E-06
sp|Q54S79|WDR3_DICDI WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 235 429 2.0E-06
sp|Q5SRY7|FBW1B_MOUSE F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 284 509 2.0E-06
sp|O43818|U3IP2_HUMAN U3 small nucleolar RNA-interacting protein 2 OS=Homo sapiens GN=RRP9 PE=1 SV=1 348 468 2.0E-06
sp|Q3UPL0|SC31A_MOUSE Protein transport protein Sec31A OS=Mus musculus GN=Sec31a PE=1 SV=2 311 466 2.0E-06
sp|Q61Y48|LIN53_CAEBR Probable histone-binding protein lin-53 OS=Caenorhabditis briggsae GN=lin-53 PE=3 SV=2 300 465 2.0E-06
sp|P33215|NEDD1_MOUSE Protein NEDD1 OS=Mus musculus GN=Nedd1 PE=1 SV=2 260 446 2.0E-06
sp|Q5XIG8|STRAP_RAT Serine-threonine kinase receptor-associated protein OS=Rattus norvegicus GN=Strap PE=1 SV=1 292 516 2.0E-06
sp|P54313|GBB2_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4 266 507 2.0E-06
sp|P62880|GBB2_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3 266 507 2.0E-06
sp|P62879|GBB2_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3 266 507 2.0E-06
sp|P11017|GBB2_BOVIN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3 266 507 2.0E-06
sp|O94979|SC31A_HUMAN Protein transport protein Sec31A OS=Homo sapiens GN=SEC31A PE=1 SV=3 311 466 2.0E-06
sp|Q5R5W8|GBB1_PONAB Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Pongo abelii GN=GNB1 PE=2 SV=3 267 507 2.0E-06
sp|Q93794|SEL10_CAEEL F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 244 509 2.0E-06
sp|Q9UKB1|FBW1B_HUMAN F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 284 509 2.0E-06
sp|Q23256|WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 244 423 2.0E-06
sp|Q9Y3F4|STRAP_HUMAN Serine-threonine kinase receptor-associated protein OS=Homo sapiens GN=STRAP PE=1 SV=1 292 516 2.0E-06
sp|Q9C0J8|WDR33_HUMAN pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens GN=WDR33 PE=1 SV=2 225 466 2.0E-06
sp|Q5R4F4|SC31A_PONAB Protein transport protein Sec31A OS=Pongo abelii GN=SEC31A PE=2 SV=1 311 466 2.0E-06
sp|Q6NZH4|LIS1_XENTR Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 244 508 2.0E-06
sp|Q922V4|PLRG1_MOUSE Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1 236 433 2.0E-06
sp|Q55AR8|SNR40_DICDI U5 small nuclear ribonucleoprotein 40 kDa protein OS=Dictyostelium discoideum GN=snrnp40 PE=3 SV=1 242 509 2.0E-06
sp|Q8K4P0|WDR33_MOUSE pre-mRNA 3' end processing protein WDR33 OS=Mus musculus GN=Wdr33 PE=1 SV=1 225 466 2.0E-06
sp|Q23256|WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 269 465 3.0E-06
sp|Q5RBW3|CORO7_PONAB Coronin-7 OS=Pongo abelii GN=CORO7 PE=2 SV=1 328 530 3.0E-06
sp|O35828|CORO7_RAT Coronin-7 OS=Rattus norvegicus GN=Coro7 PE=1 SV=2 328 507 3.0E-06
sp|Q8W117|SMU1_ARATH Suppressor of mec-8 and unc-52 protein homolog 1 OS=Arabidopsis thaliana GN=SMU1 PE=1 SV=1 269 508 3.0E-06
sp|Q90ZL4|LIS1_XENLA Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 244 508 3.0E-06
sp|Q09715|TUP11_SCHPO Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 269 519 4.0E-06
sp|O48847|LUH_ARATH Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana GN=LUH PE=1 SV=1 329 509 4.0E-06
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 269 511 4.0E-06
sp|Q9C4Z6|GPLPB_ARATH Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 268 509 4.0E-06
sp|G0SC29|NLE1_CHATD Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 244 513 4.0E-06
sp|Q75LV5|YAO_ORYSJ U3 snoRNP-associated protein-like YAOH OS=Oryza sativa subsp. japonica GN=Os03g0625900 PE=2 SV=1 332 513 4.0E-06
sp|P26308|GBB1_DROME Guanine nucleotide-binding protein subunit beta-1 OS=Drosophila melanogaster GN=Gbeta13F PE=1 SV=1 267 507 4.0E-06
sp|Q6PA72|LST8_XENLA Target of rapamycin complex subunit lst8 OS=Xenopus laevis GN=mlst8 PE=2 SV=1 357 508 4.0E-06
sp|A7S338|LIS1_NEMVE Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 244 509 4.0E-06
sp|Q5I0B4|LST8_XENTR Target of rapamycin complex subunit lst8 OS=Xenopus tropicalis GN=mlst8 PE=2 SV=1 357 508 4.0E-06
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 276 465 5.0E-06
sp|Q55AR8|SNR40_DICDI U5 small nuclear ribonucleoprotein 40 kDa protein OS=Dictyostelium discoideum GN=snrnp40 PE=3 SV=1 320 509 5.0E-06
sp|Q8NHV4|NEDD1_HUMAN Protein NEDD1 OS=Homo sapiens GN=NEDD1 PE=1 SV=1 260 446 5.0E-06
sp|Q4WEI5|HAT2_ASPFU Histone acetyltransferase type B subunit 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hat2 PE=3 SV=1 344 509 5.0E-06
sp|Q6TMK6|GBB1_CRIGR Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Cricetulus griseus GN=GNB1 PE=2 SV=3 267 507 5.0E-06
sp|Q61FW2|SEL10_CAEBR F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 244 509 5.0E-06
sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 348 511 6.0E-06
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 348 511 6.0E-06
sp|P20053|PRP4_YEAST U4/U6 small nuclear ribonucleoprotein PRP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP4 PE=1 SV=1 231 465 6.0E-06
sp|P14197|AAC3_DICDI WD repeat-containing protein AAC3 OS=Dictyostelium discoideum GN=AAC3 PE=2 SV=2 337 470 6.0E-06
sp|Q3B7M6|NEDD1_BOVIN Protein NEDD1 OS=Bos taurus GN=NEDD1 PE=2 SV=1 260 446 6.0E-06
sp|Q8BX17|GEMI5_MOUSE Gem-associated protein 5 OS=Mus musculus GN=Gemin5 PE=1 SV=2 229 414 6.0E-06
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 300 530 7.0E-06
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 335 508 7.0E-06
sp|Q9C0J8|WDR33_HUMAN pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens GN=WDR33 PE=1 SV=2 272 507 7.0E-06
sp|Q8K4P0|WDR33_MOUSE pre-mRNA 3' end processing protein WDR33 OS=Mus musculus GN=Wdr33 PE=1 SV=1 272 507 7.0E-06
sp|Q09589|HIRA_CAEEL Protein HIRA homolog OS=Caenorhabditis elegans GN=K10D2.1 PE=3 SV=2 247 453 7.0E-06
sp|Q9GL51|LIS1_PIG Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 239 509 7.0E-06
sp|Q28D01|WDR26_XENTR WD repeat-containing protein 26 OS=Xenopus tropicalis GN=wdr26 PE=2 SV=2 345 455 7.0E-06
sp|Q17963|WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 259 508 7.0E-06
sp|Q5AZX0|PFS2_EMENI Polyadenylation factor subunit 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pfs2 PE=3 SV=1 269 491 7.0E-06
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 269 514 8.0E-06
sp|O42248|GBLP_DANRE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1 268 509 8.0E-06
sp|Q9DCJ1|LST8_MOUSE Target of rapamycin complex subunit LST8 OS=Mus musculus GN=Mlst8 PE=1 SV=1 276 508 8.0E-06
sp|Q54PE0|PWP2_DICDI Periodic tryptophan protein 2 homolog OS=Dictyostelium discoideum GN=pwp2 PE=3 SV=1 348 513 8.0E-06
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 234 414 9.0E-06
sp|P87314|HIR1_SCHPO Protein hir1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hip1 PE=1 SV=1 236 527 9.0E-06
sp|B7PS00|LIS1_IXOSC Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 244 514 9.0E-06
sp|Q5REG7|LIS1_PONAB Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 239 509 9.0E-06
sp|Q4WT34|PRP46_ASPFU Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 244 508 9.0E-06
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 300 530 1.0E-05
sp|O94620|CWF17_SCHPO Pre-mRNA-splicing factor cwf17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf17 PE=1 SV=1 242 504 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6361
MSGDCRRSKDFPTPSKSVYGGNLLSHLARSVSKPSQSRESPKSNIARSTSTPRKILNLSVSEYTLIGTGKRQASS
RPKKHTNLRHKVYGDRFIPNRAASSGLSQAGSSKLRQMDSSSVLSSAADDALSAFEALSINDDDEDKPENYSRPS
PNTVAYHDSLADACGINTKTRILEFKPAPPEASRPVDIRQQYNRPLKPATAGSQARRRIGTAPDRVLDAPGIIDD
FYLNLLDWSSGNQVAIGLDRNVYVWSADEGSVNCLLESTDNTYISSVKWSSDGAYLSVGMGTGEVQIWNVGEGQK
VRSMFGHDTRVSVMGWNKHILSTGARSGLVYNHDVRVAEHKVAELISHTSEVCGLEWRSDGAQLATGGNDNLVSI
WDARSLSVPKFTKTNHKAAVKALAWCPWNHNLLATGGGDADKHIHFWNSTSGARVNSIYTGSQVTSLRWSPHYRE
IVSSGGWPDNSLSIWTYPSLVRHAEVPAHESRVLHSCLSPDGQTLATAAADESLKFWKVFEKKAGGAGASSGGSS
KARMVSAMTIR*
Coding >OphauG2|6361
ATGAGTGGCGATTGCCGACGCAGCAAAGACTTTCCCACCCCGTCAAAATCGGTTTATGGCGGAAATCTCTTATCG
CATTTGGCTCGCTCTGTTTCAAAGCCCAGTCAATCGCGAGAATCTCCCAAGTCAAACATTGCCCGCAGCACTTCG
ACACCCCGCAAAATTTTGAACTTGAGCGTATCTGAGTATACTCTGATTGGAACGGGAAAGAGGCAAGCGAGTAGC
AGGCCAAAGAAGCACACTAACCTCCGCCACAAAGTCTACGGCGACCGATTCATCCCCAATCGTGCTGCCAGCTCG
GGACTTTCTCAGGCCGGATCAAGCAAACTCAGACAGATGGACAGCTCGTCGGTTCTTTCATCGGCTGCCGACGAC
GCACTTTCTGCGTTTGAAGCCTTGAGCATCAACGACGACGATGAGGACAAGCCTGAGAATTACTCACGGCCGTCA
CCCAACACGGTGGCCTATCACGATTCCCTGGCTGATGCTTGCGGCATCAATACCAAGACTCGCATCCTTGAATTC
AAGCCCGCTCCGCCAGAGGCATCTAGGCCTGTTGATATTCGGCAGCAATACAATAGGCCGCTTAAGCCGGCGACG
GCCGGGTCGCAGGCGCGTCGACGCATCGGTACGGCGCCCGATCGAGTGCTGGACGCGCCCGGCATTATCGACGAT
TTCTATCTAAACTTGCTTGACTGGAGCTCTGGAAACCAAGTGGCGATTGGTCTGGACCGCAACGTTTACGTGTGG
TCGGCTGACGAGGGCAGTGTCAACTGTCTGCTTGAGAGCACTGACAACACGTACATCAGCAGTGTCAAGTGGTCA
AGCGATGGGGCCTATCTCAGCGTCGGCATGGGCACGGGCGAGGTGCAAATTTGGAACGTGGGCGAAGGTCAAAAA
GTGCGCAGCATGTTTGGACATGACACGCGCGTCAGTGTCATGGGATGGAACAAGCATATTCTGTCAACCGGGGCA
CGCAGTGGCCTTGTTTATAACCATGACGTTCGCGTTGCCGAGCACAAGGTGGCGGAGCTCATCTCGCACACGTCC
GAGGTGTGTGGTCTCGAATGGCGATCAGATGGCGCGCAGCTGGCTACTGGCGGCAACGATAACCTGGTCTCCATA
TGGGATGCTCGGTCGCTTTCGGTGCCCAAGTTCACAAAGACTAACCACAAGGCTGCCGTCAAGGCCCTGGCTTGG
TGCCCGTGGAACCACAACCTCCTGGCCACGGGAGGAGGAGACGCGGACAAGCACATTCACTTTTGGAACTCGACG
TCGGGTGCGCGCGTCAACAGCATCTACACGGGATCCCAGGTGACGTCGCTGCGCTGGAGCCCGCACTACCGCGAA
ATAGTCAGCTCGGGCGGCTGGCCCGACAATTCGCTCAGCATCTGGACCTATCCGAGTCTGGTTCGCCATGCCGAG
GTGCCAGCCCATGAAAGCCGAGTGCTTCACAGCTGTCTCAGTCCCGATGGGCAAACGCTAGCTACAGCTGCTGCC
GATGAAAGCTTGAAGTTCTGGAAGGTGTTTGAGAAAAAGGCTGGCGGCGCTGGCGCCTCGAGCGGAGGGTCGAGC
AAAGCTAGAATGGTGAGTGCAATGACTATTAGATAA
Transcript >OphauG2|6361
ATGAGTGGCGATTGCCGACGCAGCAAAGACTTTCCCACCCCGTCAAAATCGGTTTATGGCGGAAATCTCTTATCG
CATTTGGCTCGCTCTGTTTCAAAGCCCAGTCAATCGCGAGAATCTCCCAAGTCAAACATTGCCCGCAGCACTTCG
ACACCCCGCAAAATTTTGAACTTGAGCGTATCTGAGTATACTCTGATTGGAACGGGAAAGAGGCAAGCGAGTAGC
AGGCCAAAGAAGCACACTAACCTCCGCCACAAAGTCTACGGCGACCGATTCATCCCCAATCGTGCTGCCAGCTCG
GGACTTTCTCAGGCCGGATCAAGCAAACTCAGACAGATGGACAGCTCGTCGGTTCTTTCATCGGCTGCCGACGAC
GCACTTTCTGCGTTTGAAGCCTTGAGCATCAACGACGACGATGAGGACAAGCCTGAGAATTACTCACGGCCGTCA
CCCAACACGGTGGCCTATCACGATTCCCTGGCTGATGCTTGCGGCATCAATACCAAGACTCGCATCCTTGAATTC
AAGCCCGCTCCGCCAGAGGCATCTAGGCCTGTTGATATTCGGCAGCAATACAATAGGCCGCTTAAGCCGGCGACG
GCCGGGTCGCAGGCGCGTCGACGCATCGGTACGGCGCCCGATCGAGTGCTGGACGCGCCCGGCATTATCGACGAT
TTCTATCTAAACTTGCTTGACTGGAGCTCTGGAAACCAAGTGGCGATTGGTCTGGACCGCAACGTTTACGTGTGG
TCGGCTGACGAGGGCAGTGTCAACTGTCTGCTTGAGAGCACTGACAACACGTACATCAGCAGTGTCAAGTGGTCA
AGCGATGGGGCCTATCTCAGCGTCGGCATGGGCACGGGCGAGGTGCAAATTTGGAACGTGGGCGAAGGTCAAAAA
GTGCGCAGCATGTTTGGACATGACACGCGCGTCAGTGTCATGGGATGGAACAAGCATATTCTGTCAACCGGGGCA
CGCAGTGGCCTTGTTTATAACCATGACGTTCGCGTTGCCGAGCACAAGGTGGCGGAGCTCATCTCGCACACGTCC
GAGGTGTGTGGTCTCGAATGGCGATCAGATGGCGCGCAGCTGGCTACTGGCGGCAACGATAACCTGGTCTCCATA
TGGGATGCTCGGTCGCTTTCGGTGCCCAAGTTCACAAAGACTAACCACAAGGCTGCCGTCAAGGCCCTGGCTTGG
TGCCCGTGGAACCACAACCTCCTGGCCACGGGAGGAGGAGACGCGGACAAGCACATTCACTTTTGGAACTCGACG
TCGGGTGCGCGCGTCAACAGCATCTACACGGGATCCCAGGTGACGTCGCTGCGCTGGAGCCCGCACTACCGCGAA
ATAGTCAGCTCGGGCGGCTGGCCCGACAATTCGCTCAGCATCTGGACCTATCCGAGTCTGGTTCGCCATGCCGAG
GTGCCAGCCCATGAAAGCCGAGTGCTTCACAGCTGTCTCAGTCCCGATGGGCAAACGCTAGCTACAGCTGCTGCC
GATGAAAGCTTGAAGTTCTGGAAGGTGTTTGAGAAAAAGGCTGGCGGCGCTGGCGCCTCGAGCGGAGGGTCGAGC
AAAGCTAGAATGGTGAGTGCAATGACTATTAGATAA
Gene >OphauG2|6361
ATGAGTGGCGATTGCCGACGCAGCAAAGACTTTCCCACCCCGTCAAAATCGGTTTATGGCGGAAATCTCTTATCG
CATTTGGCTCGCTCTGTTTCAAAGCCCAGTCAATCGCGAGAATCTCCCAAGTCAAACATTGCCCGCAGCACTTCG
ACACCCCGCAAAATTTTGAACTTGAGCGTATCTGAGTATACTCTGATTGGAACGGGAAAGAGGCAAGCGAGTAGC
AGGCCAAAGAAGCACACTAACCTCCGCCACAAAGTCTACGGCGACCGATTCATCCCCAATCGTGCTGCCAGCTCG
GGACTTTCTCAGGCCGGATCAAGCAAACTCAGACAGATGGACAGCTCGTCGGTTCTTTCATCGGCTGCCGACGAC
GCACTTTCTGCGTTTGAAGCCTTGAGCATCAACGACGACGATGAGGACAAGCCTGAGAATTACTCACGGCCGTCA
CCCAACACGGTGGCCTATCACGATTCCCTGGCTGATGCTTGCGGCATCAATACCAAGACTCGCATCCTTGAATTC
AAGCCCGCTCCGCCAGAGGCATCTAGGCCTGTTGATATTCGGCAGCAATACAATAGGCCGCTTAAGCCGGCGACG
GCCGGGTCGCAGGCGCGTCGACGCATCGGTACGGCGCCCGATCGAGTGCTGGACGCGCCCGGCATTATCGACGAT
TTCTATCTAAACTTGCTTGACTGGAGCTCTGGAAACCAAGTGGCGATTGGTCTGGACCGCAACGTTTACGTGTGG
TCGGCTGACGAGGGCAGTGTCAACTGTCTGCTTGAGAGCACTGACAACACGTACATCAGCAGTGTCAAGTGGTCA
AGCGATGGGGCCTATCTCAGCGTCGGCATGGGCACGGGCGAGGTGCAAATTTGGAACGTGGGCGAAGGTCAAAAA
GTGCGCAGCATGTTTGGACATGACACGCGCGTCAGTGTCATGGGATGGAACAAGCATATTCTGTCAACCGGGGCA
CGCAGTGGCCTTGTTTATAACCATGACGTTCGCGTTGCCGAGCACAAGGTGGCGGAGCTCATCTCGCACACGTCC
GAGGTGTGTGGTCTCGAATGGCGATCAGATGGCGCGCAGCTGGCTACTGGCGGCAACGATAACCTGGTCTCCATA
TGGGATGCTCGGTCGCTTTCGGTGCCCAAGTTCACAAAGACTAACCACAAGGCTGCCGTCAAGGCCCTGGCTTGG
TGCCCGTGGAACCACAACCTCCTGGCCACGGGAGGAGGAGACGCGGACAAGCACATTCACTTTTGGAACTCGACG
TCGGGTGCGCGCGTCAACAGCATCTACACGGGATCCCAGGTGACGTCGCTGCGCTGGAGCCCGCACTACCGCGAA
ATAGTCAGCTCGGGCGGCTGGCCCGACAATTCGCTCAGCATCTGGACCTATCCGAGTCTGGTTCGCCATGCCGAG
GTGCCAGCCCATGAAAGCCGAGTGCTTCACAGCTGTCTCAGTCCCGATGGGCAAACGCTAGCTACAGCTGGTAAG
TCGCATGGAGCTGTGTGTGTGGCGGATTGGATGCTGACCAAGCCGATTGACAGCTGCCGATGAAAGCTTGAAGTT
CTGGAAGGTGTTTGAGAAAAAGGCTGGCGGCGCTGGCGCCTCGAGCGGAGGGTCGAGCAAAGCTAGAATGGTGAG
TGCAATGACTATTAGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail