Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6351
Gene name
LocationContig_647:7564..7962
Strand-
Gene length (bp)398
Transcript length (bp)321
Coding sequence length (bp)321
Protein length (aa) 107

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00380 Ribosomal_S9 Ribosomal protein S9/S16 2.1E-24 5 106

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q759L8|RS16_ASHGO 40S ribosomal protein S16 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPS16 PE=3 SV=1 1 106 3.0E-59
sp|Q6FR56|RS16_CANGA 40S ribosomal protein S16 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPS16 PE=3 SV=1 1 106 1.0E-58
sp|Q875N2|RS16_KLULA 40S ribosomal protein S16 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RPS16 PE=1 SV=1 1 106 2.0E-58
sp|P0CX52|RS16B_YEAST 40S ribosomal protein S16-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS16B PE=1 SV=1 1 106 1.0E-57
sp|P0CX51|RS16A_YEAST 40S ribosomal protein S16-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS16A PE=1 SV=1 1 106 1.0E-57
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q759L8|RS16_ASHGO 40S ribosomal protein S16 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPS16 PE=3 SV=1 1 106 3.0E-59
sp|Q6FR56|RS16_CANGA 40S ribosomal protein S16 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPS16 PE=3 SV=1 1 106 1.0E-58
sp|Q875N2|RS16_KLULA 40S ribosomal protein S16 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RPS16 PE=1 SV=1 1 106 2.0E-58
sp|P0CX52|RS16B_YEAST 40S ribosomal protein S16-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS16B PE=1 SV=1 1 106 1.0E-57
sp|P0CX51|RS16A_YEAST 40S ribosomal protein S16-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS16A PE=1 SV=1 1 106 1.0E-57
sp|Q876B4|RS16_SACEX 40S ribosomal protein S16 OS=Saccharomyces exiguus GN=RPS16 PE=3 SV=3 1 106 1.0E-56
sp|Q6BSI7|RS16_DEBHA 40S ribosomal protein S16 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RPS16 PE=3 SV=1 1 106 1.0E-55
sp|Q7SFJ9|RS16_NEUCR 40S ribosomal protein S16 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rps-16 PE=3 SV=1 4 106 2.0E-55
sp|P0CT65|RS16B_SCHPO 40S ribosomal protein S16-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps1602 PE=3 SV=1 1 106 2.0E-55
sp|P0CT64|RS16A_SCHPO 40S ribosomal protein S16-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps1601 PE=2 SV=1 1 106 2.0E-55
sp|O94017|RS16_CANAX 40S ribosomal protein S16 OS=Candida albicans GN=RPS16 PE=3 SV=1 1 106 9.0E-55
sp|P16149|RS16_LUPPO 40S ribosomal protein S16 OS=Lupinus polyphyllus GN=RPS16 PE=2 SV=1 1 106 1.0E-52
sp|Q9W237|RS16_DROME 40S ribosomal protein S16 OS=Drosophila melanogaster GN=RpS16 PE=1 SV=1 2 106 4.0E-51
sp|Q9SK22|RS161_ARATH 40S ribosomal protein S16-1 OS=Arabidopsis thaliana GN=RPS16A PE=2 SV=1 1 106 4.0E-51
sp|Q9M8X9|RS162_ARATH 40S ribosomal protein S16-2 OS=Arabidopsis thaliana GN=RPS16B PE=2 SV=1 1 106 5.0E-51
sp|Q42340|RS163_ARATH 40S ribosomal protein S16-3 OS=Arabidopsis thaliana GN=RPS16C PE=2 SV=1 1 106 6.0E-51
sp|P46293|RS16_GOSHI 40S ribosomal protein S16 OS=Gossypium hirsutum GN=RPS16 PE=2 SV=1 1 106 1.0E-50
sp|P62251|RS16_AEDAE 40S ribosomal protein S16 OS=Aedes aegypti GN=RpS16 PE=2 SV=1 2 106 2.0E-50
sp|Q9XEK7|RS16_TORRU 40S ribosomal protein S16 OS=Tortula ruralis GN=RPS16 PE=2 SV=1 1 106 2.0E-50
sp|P62250|RS16_RAT 40S ribosomal protein S16 OS=Rattus norvegicus GN=Rps16 PE=1 SV=2 1 106 2.0E-49
sp|Q29201|RS16_PIG 40S ribosomal protein S16 OS=Sus scrofa GN=RPS16 PE=1 SV=4 1 106 2.0E-49
sp|P14131|RS16_MOUSE 40S ribosomal protein S16 OS=Mus musculus GN=Rps16 PE=1 SV=4 1 106 2.0E-49
sp|P62249|RS16_HUMAN 40S ribosomal protein S16 OS=Homo sapiens GN=RPS16 PE=1 SV=2 1 106 2.0E-49
sp|Q3T0X6|RS16_BOVIN 40S ribosomal protein S16 OS=Bos taurus GN=RPS16 PE=2 SV=3 1 106 2.0E-49
sp|Q54Q51|RS16_DICDI 40S ribosomal protein S16 OS=Dictyostelium discoideum GN=rps16 PE=3 SV=1 2 106 2.0E-49
sp|Q95V31|RS16_SPOFR 40S ribosomal protein S16 OS=Spodoptera frugiperda GN=RpS16 PE=2 SV=1 1 106 7.0E-49
sp|Q98TR7|RS16_HETFO 40S ribosomal protein S16 OS=Heteropneustes fossilis GN=rps16 PE=2 SV=1 2 106 1.0E-48
sp|O22647|RS16_FRIAG 40S ribosomal protein S16 OS=Fritillaria agrestis GN=RPS16 PE=2 SV=1 1 106 2.0E-48
sp|Q90YQ7|RS16_ICTPU 40S ribosomal protein S16 OS=Ictalurus punctatus GN=rps16 PE=2 SV=1 2 106 3.0E-48
sp|Q0IQF7|RS16_ORYSJ 40S ribosomal protein S16 OS=Oryza sativa subsp. japonica GN=RPS16A PE=2 SV=1 1 106 7.0E-48
sp|A2ZB00|RS16_ORYSI 40S ribosomal protein S16 OS=Oryza sativa subsp. indica GN=RPS16A PE=2 SV=1 1 106 7.0E-48
sp|Q22054|RS16_CAEEL 40S ribosomal protein S16 OS=Caenorhabditis elegans GN=rps-16 PE=1 SV=3 2 106 5.0E-45
sp|Q2NFZ9|RS9_METST 30S ribosomal protein S9 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rps9 PE=3 SV=1 3 106 6.0E-26
sp|Q9HQJ2|RS9_HALSA 30S ribosomal protein S9 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rps9 PE=3 SV=3 1 106 1.0E-25
sp|P05763|RS9_HALMA 30S ribosomal protein S9 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rps9 PE=1 SV=3 1 106 3.0E-24
sp|Q8TT42|RS9_METAC 30S ribosomal protein S9 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rps9 PE=3 SV=1 4 106 1.0E-22
sp|Q8PW44|RS9_METMA 30S ribosomal protein S9 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rps9 PE=3 SV=1 4 106 2.0E-22
sp|A0B6E8|RS9_METTP 30S ribosomal protein S9 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rps9 PE=3 SV=1 1 106 3.0E-21
sp|Q9YB48|RS9_AERPE 30S ribosomal protein S9 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rps9 PE=3 SV=2 5 106 8.0E-21
sp|Q8TVB5|RS9_METKA 30S ribosomal protein S9 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rps9 PE=3 SV=1 1 106 1.0E-20
sp|B8D6F5|RS9_DESK1 30S ribosomal protein S9 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=rps9 PE=3 SV=1 2 106 4.0E-20
sp|Q8U0E7|RS9_PYRFU 30S ribosomal protein S9 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rps9 PE=1 SV=1 1 106 5.0E-20
sp|Q5JJE2|RS9_THEKO 30S ribosomal protein S9 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rps9 PE=3 SV=1 1 106 7.0E-20
sp|Q9HL08|RS9_THEAC 30S ribosomal protein S9 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rps9 PE=3 SV=1 6 106 5.0E-19
sp|O29136|RS9_ARCFU 30S ribosomal protein S9 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rps9 PE=3 SV=1 3 106 7.0E-19
sp|O26146|RLSX_METTH Fused L13/S9 ribosomal protein OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpl13/rps9 PE=3 SV=1 4 106 2.0E-18
sp|Q979K1|RS9_THEVO 30S ribosomal protein S9 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rps9 PE=3 SV=1 5 106 8.0E-18
sp|Q6L293|RS9_PICTO 30S ribosomal protein S9 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rps9 PE=3 SV=1 5 106 1.0E-17
sp|A6VGR2|RS9_METM7 30S ribosomal protein S9 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rps9 PE=3 SV=1 1 106 2.0E-17
sp|Q6LXM5|RS9_METMP 30S ribosomal protein S9 OS=Methanococcus maripaludis (strain S2 / LL) GN=rps9 PE=3 SV=1 1 106 2.0E-17
sp|A6UPX0|RS9_METVS 30S ribosomal protein S9 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rps9 PE=3 SV=1 1 106 3.0E-17
sp|A4FWK9|RS9_METM5 30S ribosomal protein S9 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rps9 PE=3 SV=1 1 106 9.0E-17
sp|Q9V195|RS9_PYRAB 30S ribosomal protein S9 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rps9 PE=3 SV=1 1 106 8.0E-16
sp|P54024|RS9_METJA 30S ribosomal protein S9 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rps9 PE=3 SV=1 1 106 9.0E-16
sp|O59299|RS9_PYRHO 30S ribosomal protein S9 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rps9 PE=3 SV=1 1 106 2.0E-15
sp|C6A1B6|RS9_THESM 30S ribosomal protein S9 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rps9 PE=3 SV=1 1 106 3.0E-15
sp|A6UW00|RS9_META3 30S ribosomal protein S9 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rps9 PE=3 SV=1 1 106 4.0E-14
sp|Q8ZYQ0|RS9_PYRAE 30S ribosomal protein S9 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rps9 PE=3 SV=2 5 106 4.0E-13
sp|C6C1K0|RS9_DESAD 30S ribosomal protein S9 OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=rpsI PE=3 SV=1 5 106 2.0E-10
sp|B3E0U1|RS9_METI4 30S ribosomal protein S9 OS=Methylacidiphilum infernorum (isolate V4) GN=rpsI PE=3 SV=1 6 106 3.0E-09
sp|A9EYT5|RS9_SORC5 30S ribosomal protein S9 OS=Sorangium cellulosum (strain So ce56) GN=rpsI PE=3 SV=1 20 106 7.0E-09
sp|A6GWU3|RS9_FLAPJ 30S ribosomal protein S9 OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=rpsI PE=3 SV=1 6 106 9.0E-09
sp|C4XNQ1|RS9_DESMR 30S ribosomal protein S9 OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=rpsI PE=3 SV=1 24 106 9.0E-09
sp|A1BHZ6|RS9_CHLPD 30S ribosomal protein S9 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=rpsI PE=3 SV=1 5 106 1.0E-08
sp|A0LXM9|RS9_GRAFK 30S ribosomal protein S9 OS=Gramella forsetii (strain KT0803) GN=rpsI PE=3 SV=1 6 106 1.0E-08
sp|B4UBJ2|RS9_ANASK 30S ribosomal protein S9 OS=Anaeromyxobacter sp. (strain K) GN=rpsI PE=3 SV=1 5 106 3.0E-08
sp|Q2IEX8|RS9_ANADE 30S ribosomal protein S9 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rpsI PE=3 SV=1 5 106 3.0E-08
sp|B8J5I5|RS9_ANAD2 30S ribosomal protein S9 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=rpsI PE=3 SV=1 5 106 3.0E-08
sp|B8IZP3|RS9_DESDA 30S ribosomal protein S9 OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=rpsI PE=3 SV=1 5 106 5.0E-08
sp|Q3A3B7|RS9_PELCD 30S ribosomal protein S9 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=rpsI PE=3 SV=1 5 106 7.0E-08
sp|Q3B5U1|RS9_CHLL7 30S ribosomal protein S9 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=rpsI PE=3 SV=1 5 106 7.0E-08
sp|Q661S9|RS9_BORBP 30S ribosomal protein S9 OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=rpsI PE=3 SV=1 2 106 9.0E-08
sp|B3EFY3|RS9_CHLL2 30S ribosomal protein S9 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=rpsI PE=3 SV=1 5 106 1.0E-07
sp|B6JPI5|RS9_HELP2 30S ribosomal protein S9 OS=Helicobacter pylori (strain P12) GN=rpsI PE=3 SV=1 5 106 2.0E-07
sp|B6YQS6|RS9_AZOPC 30S ribosomal protein S9 OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=rpsI PE=3 SV=1 6 106 3.0E-07
sp|Q0SNH4|RS9_BORAP 30S ribosomal protein S9 OS=Borrelia afzelii (strain PKo) GN=rpsI PE=3 SV=1 2 106 3.0E-07
sp|Q6FZQ5|RS9_BARQU 30S ribosomal protein S9 OS=Bartonella quintana (strain Toulouse) GN=rpsI PE=3 SV=1 6 106 3.0E-07
sp|B7J1R3|RS9_BORBZ 30S ribosomal protein S9 OS=Borrelia burgdorferi (strain ZS7) GN=rpsI PE=3 SV=1 2 106 3.0E-07
sp|O51313|RS9_BORBU 30S ribosomal protein S9 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=rpsI PE=3 SV=1 2 106 3.0E-07
sp|Q96YW3|RS9_SULTO 30S ribosomal protein S9 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rps9 PE=3 SV=1 5 106 3.0E-07
sp|P95992|RS9_SULSO 30S ribosomal protein S9 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rps9 PE=3 SV=3 1 106 3.0E-07
sp|A9BHB5|RS9_PETMO 30S ribosomal protein S9 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=rpsI PE=3 SV=1 5 106 4.0E-07
sp|P66637|RS9_HELPY 30S ribosomal protein S9 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rpsI PE=3 SV=1 5 106 4.0E-07
sp|P66638|RS9_HELPJ 30S ribosomal protein S9 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=rpsI PE=3 SV=1 5 106 4.0E-07
sp|B5Z683|RS9_HELPG 30S ribosomal protein S9 OS=Helicobacter pylori (strain G27) GN=rpsI PE=3 SV=1 5 106 4.0E-07
sp|Q1CV71|RS9_HELPH 30S ribosomal protein S9 OS=Helicobacter pylori (strain HPAG1) GN=rpsI PE=3 SV=1 5 106 5.0E-07
sp|B7GJ32|RS9_ANOFW 30S ribosomal protein S9 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rpsI PE=3 SV=1 11 106 5.0E-07
sp|B2URR4|RS9_HELPS 30S ribosomal protein S9 OS=Helicobacter pylori (strain Shi470) GN=rpsI PE=3 SV=1 5 106 6.0E-07
sp|Q17VT4|RS9_HELAH 30S ribosomal protein S9 OS=Helicobacter acinonychis (strain Sheeba) GN=rpsI PE=3 SV=1 5 106 6.0E-07
sp|Q11QN5|RS9_CYTH3 30S ribosomal protein S9 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=rpsI PE=3 SV=1 3 106 6.0E-07
sp|A1VBD2|RS9_DESVV 30S ribosomal protein S9 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=rpsI PE=3 SV=1 5 106 8.0E-07
sp|Q728T3|RS9_DESVH 30S ribosomal protein S9 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=rpsI PE=3 SV=1 5 106 8.0E-07
sp|Q5HSV2|RS9_CAMJR 30S ribosomal protein S9 OS=Campylobacter jejuni (strain RM1221) GN=rpsI PE=3 SV=1 5 106 8.0E-07
sp|A1W187|RS9_CAMJJ 30S ribosomal protein S9 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=rpsI PE=3 SV=1 5 106 8.0E-07
sp|Q9PMI3|RS9_CAMJE 30S ribosomal protein S9 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=rpsI PE=3 SV=1 5 106 8.0E-07
sp|A7H5K0|RS9_CAMJD 30S ribosomal protein S9 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=rpsI PE=3 SV=1 5 106 8.0E-07
sp|A8FNE5|RS9_CAMJ8 30S ribosomal protein S9 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=rpsI PE=3 SV=1 5 106 8.0E-07
sp|A0PXY2|RS9_CLONN 30S ribosomal protein S9 OS=Clostridium novyi (strain NT) GN=rpsI PE=3 SV=1 5 106 8.0E-07
sp|Q7VIV5|RS9_HELHP 30S ribosomal protein S9 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=rpsI PE=3 SV=1 5 106 9.0E-07
sp|A7GK54|RS9_BACCN 30S ribosomal protein S9 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rpsI PE=3 SV=1 6 106 1.0E-06
sp|Q82UK1|RS9_NITEU 30S ribosomal protein S9 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rpsI PE=3 SV=1 5 106 1.0E-06
sp|A6L0V0|RS9_BACV8 30S ribosomal protein S9 OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=rpsI PE=3 SV=1 6 106 1.0E-06
sp|Q7M7R1|RS9_WOLSU 30S ribosomal protein S9 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=rpsI PE=3 SV=1 5 106 2.0E-06
sp|Q64P28|RS9_BACFR 30S ribosomal protein S9 OS=Bacteroides fragilis (strain YCH46) GN=rpsI PE=3 SV=1 6 106 2.0E-06
sp|Q5L8W6|RS9_BACFN 30S ribosomal protein S9 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=rpsI PE=3 SV=1 6 106 2.0E-06
sp|Q0AHZ9|RS9_NITEC 30S ribosomal protein S9 OS=Nitrosomonas eutropha (strain C91) GN=rpsI PE=3 SV=1 5 106 2.0E-06
sp|Q8R7Y9|RS9_CALS4 30S ribosomal protein S9 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rpsI PE=3 SV=1 5 106 2.0E-06
sp|B9KFA8|RS9_CAMLR 30S ribosomal protein S9 OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=rpsI PE=3 SV=1 5 106 2.0E-06
sp|Q7VUV9|RS9_BORPE 30S ribosomal protein S9 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rpsI PE=3 SV=1 5 106 2.0E-06
sp|C1A3Z4|RS9_GEMAT 30S ribosomal protein S9 OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=rpsI PE=3 SV=1 21 106 2.0E-06
sp|A6LPU7|RS9_CLOB8 30S ribosomal protein S9 OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=rpsI PE=3 SV=1 5 106 2.0E-06
sp|B8DPL8|RS9_DESVM 30S ribosomal protein S9 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=rpsI PE=3 SV=1 7 106 2.0E-06
sp|Q30Y42|RS9_DESAG 30S ribosomal protein S9 OS=Desulfovibrio alaskensis (strain G20) GN=rpsI PE=3 SV=1 7 106 2.0E-06
sp|Q81VP8|RS9_BACAN 30S ribosomal protein S9 OS=Bacillus anthracis GN=rpsI PE=3 SV=1 6 106 3.0E-06
sp|C3LJX8|RS9_BACAC 30S ribosomal protein S9 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=rpsI PE=3 SV=1 6 106 3.0E-06
sp|C3PAK4|RS9_BACAA 30S ribosomal protein S9 OS=Bacillus anthracis (strain A0248) GN=rpsI PE=3 SV=1 6 106 3.0E-06
sp|Q2KV03|RS9_BORA1 30S ribosomal protein S9 OS=Bordetella avium (strain 197N) GN=rpsI PE=3 SV=1 5 106 3.0E-06
sp|Q6HPM5|RS9_BACHK 30S ribosomal protein S9 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rpsI PE=3 SV=1 6 106 3.0E-06
sp|Q63H57|RS9_BACCZ 30S ribosomal protein S9 OS=Bacillus cereus (strain ZK / E33L) GN=rpsI PE=3 SV=1 6 106 3.0E-06
sp|Q81J12|RS9_BACCR 30S ribosomal protein S9 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rpsI PE=3 SV=1 6 106 3.0E-06
sp|B9IZM8|RS9_BACCQ 30S ribosomal protein S9 OS=Bacillus cereus (strain Q1) GN=rpsI PE=3 SV=1 6 106 3.0E-06
sp|B7HQX8|RS9_BACC7 30S ribosomal protein S9 OS=Bacillus cereus (strain AH187) GN=rpsI PE=3 SV=1 6 106 3.0E-06
sp|B7HJJ1|RS9_BACC4 30S ribosomal protein S9 OS=Bacillus cereus (strain B4264) GN=rpsI PE=3 SV=1 6 106 3.0E-06
sp|C1ET73|RS9_BACC3 30S ribosomal protein S9 OS=Bacillus cereus (strain 03BB102) GN=rpsI PE=3 SV=1 6 106 3.0E-06
sp|B7IT53|RS9_BACC2 30S ribosomal protein S9 OS=Bacillus cereus (strain G9842) GN=rpsI PE=3 SV=1 6 106 3.0E-06
sp|Q73F62|RS9_BACC1 30S ribosomal protein S9 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rpsI PE=3 SV=1 6 106 3.0E-06
sp|B7JKF4|RS9_BACC0 30S ribosomal protein S9 OS=Bacillus cereus (strain AH820) GN=rpsI PE=3 SV=1 6 106 3.0E-06
sp|A0R8L3|RS9_BACAH 30S ribosomal protein S9 OS=Bacillus thuringiensis (strain Al Hakam) GN=rpsI PE=3 SV=1 6 106 3.0E-06
sp|Q2S9X3|RS9_HAHCH 30S ribosomal protein S9 OS=Hahella chejuensis (strain KCTC 2396) GN=rpsI PE=3 SV=1 5 106 3.0E-06
sp|Q9KGD4|RS9_BACHD 30S ribosomal protein S9 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rpsI PE=3 SV=1 5 106 3.0E-06
sp|Q8A0Z5|RS9_BACTN 30S ribosomal protein S9 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rpsI PE=3 SV=1 6 106 4.0E-06
sp|Q97EL3|RS9_CLOAB 30S ribosomal protein S9 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rpsI PE=3 SV=1 5 106 4.0E-06
sp|Q5P7T8|RS9_AROAE 30S ribosomal protein S9 OS=Aromatoleum aromaticum (strain EbN1) GN=rpsI PE=3 SV=1 5 106 5.0E-06
sp|A0LIV3|RS9_SYNFM 30S ribosomal protein S9 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rpsI PE=3 SV=1 2 106 7.0E-06
sp|C4ZI84|RS9_EUBR3 30S ribosomal protein S9 OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=rpsI PE=3 SV=1 5 106 8.0E-06
sp|Q5WLM8|RS9_BACSK 30S ribosomal protein S9 OS=Bacillus clausii (strain KSM-K16) GN=rpsI PE=3 SV=1 5 106 8.0E-06
sp|Q5L5W2|RS9_CHLAB 30S ribosomal protein S9 OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=rpsI PE=3 SV=1 5 106 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0008152 metabolic process No
GO:0043228 non-membrane-bounded organelle No
GO:0043603 cellular amide metabolic process No
GO:0043229 intracellular organelle No
GO:0009059 macromolecule biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0005198 structural molecule activity No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0044238 primary metabolic process No
GO:0043226 organelle No
GO:0019538 protein metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006518 peptide metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043604 amide biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0044260 cellular macromolecule metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0043043 peptide biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1321
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6351 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1098
Ophiocordyceps camponoti-floridani Ophcf2|01742
Ophiocordyceps camponoti-rufipedis Ophun1|2354
Ophiocordyceps kimflemingae Ophio5|6142
Ophiocordyceps subramaniannii Hirsu2|10683

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6351
MVQPEVLRFKVYEPLLVVGLDKFANVDIRVRVTGGGHTSQIYAIRQAIAKSLIAYYQKFVDEHSKNLLKQALVQF
DRTLLVADNRRCEPKKFGGPGARARFQKSYR*
Coding >OphauG2|6351
ATGGTTCAGCCTGAAGTCTTGCGCTTCAAGGTTTACGAGCCCCTCCTGGTCGTTGGTCTCGATAAATTCGCCAAT
GTAGATATTCGCGTACGCGTTACCGGCGGTGGCCATACTTCGCAGATATACGCCATTCGTCAAGCCATCGCCAAG
TCACTCATTGCCTACTATCAAAAATTCGTTGACGAGCACTCCAAGAACTTGCTCAAACAGGCCCTCGTTCAGTTT
GATCGCACCCTGCTTGTTGCCGATAACCGCCGCTGCGAGCCCAAGAAATTTGGCGGTCCAGGTGCCAGAGCCCGC
TTCCAAAAGTCATACCGATAA
Transcript >OphauG2|6351
ATGGTTCAGCCTGAAGTCTTGCGCTTCAAGGTTTACGAGCCCCTCCTGGTCGTTGGTCTCGATAAATTCGCCAAT
GTAGATATTCGCGTACGCGTTACCGGCGGTGGCCATACTTCGCAGATATACGCCATTCGTCAAGCCATCGCCAAG
TCACTCATTGCCTACTATCAAAAATTCGTTGACGAGCACTCCAAGAACTTGCTCAAACAGGCCCTCGTTCAGTTT
GATCGCACCCTGCTTGTTGCCGATAACCGCCGCTGCGAGCCCAAGAAATTTGGCGGTCCAGGTGCCAGAGCCCGC
TTCCAAAAGTCATACCGATAA
Gene >OphauG2|6351
ATGGTTCAGCCTGAAGTCTTGCGCTTCAAGGTAAACAAGCCTCTCGAACGCCCATGCCTTTTGCTCTCGGCCCCG
GGGCATATAACTGACCCCATGCCGCTTGTTAGGTTTACGAGCCCCTCCTGGTCGTTGGTCTCGATAAATTCGCCA
ATGTAGATATTCGCGTACGCGTTACCGGCGGTGGCCATACTTCGCAGATATACGCCATTCGTCAAGCCATCGCCA
AGTCACTCATTGCCTACTATCAAAAATTCGTTGACGAGCACTCCAAGAACTTGCTCAAACAGGCCCTCGTTCAGT
TTGATCGCACCCTGCTTGTTGCCGATAACCGCCGCTGCGAGCCCAAGAAATTTGGCGGTCCAGGTGCCAGAGCCC
GCTTCCAAAAGTCATACCGATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail