Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6350
Gene name
LocationContig_647:4936..6583
Strand+
Gene length (bp)1647
Transcript length (bp)1647
Coding sequence length (bp)1647
Protein length (aa) 549

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05282 AAR2 AAR2 protein 5.0E-19 117 261
PF05282 AAR2 AAR2 protein 4.5E-14 312 439

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1320
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6350 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1097
Ophiocordyceps camponoti-floridani Ophcf2|01743
Ophiocordyceps camponoti-rufipedis Ophun1|1297
Ophiocordyceps kimflemingae Ophio5|6143
Ophiocordyceps subramaniannii Hirsu2|10682

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6350
MERGKLRVSNSSPPQTDYSLPAQLPFSHQDDYSQRCWYPRNRQNAIRGMYQAAQDFDRDSIHSAKSYESINVLGM
YPYGTLRLVDHVVDAEMEEPRRVLTPPSVSATDPMVHDLGGGDVCIALDIPQFAPVGYDLFQCSVNKFHGVRDIP
HGTHFFWAAHPDATHCRSGFFVVNTKSQDRTHVGQWSKWTDSFVPPIRAIRRWQGQSVKDSFYSLPSYHNPPSDS
LSQRLYQADMAHSLAGLWQDMSNCISARLLNRMLSDQELGDGWNLHTLDNPDGPYTKLVVEDQRQPKPFLQAHSL
RFCFPRRTPGTYLDASSYIVSWLHQGPDDRWTFTEEDIVGELQFVYIMAAFLHNQSCAQHWWLLVPILLRGRRLH
ISRPSLASRLISTIAAQLTHCSKSGNESLLFKNAHRTLHLRIAIANYRRRSRDRRRRRDALQAQADAEDKAAADL
HQASINLGWDPDDAPVLDGHGNNIKNTNRSQGEKKDDKKKKKASLLNRLVKLELPIFCGIALRRGQGYSQVSVVD
ENCRISQSQEKHKQQPIVSTKCI*
Coding >OphauG2|6350
ATGGAGAGAGGCAAGCTTCGAGTTTCAAACTCGAGCCCGCCCCAGACGGATTATTCTCTCCCTGCCCAGCTGCCC
TTTTCTCACCAAGATGACTACTCCCAGCGCTGCTGGTACCCGCGAAACCGCCAAAATGCCATTCGAGGCATGTAC
CAAGCAGCTCAAGACTTCGACCGAGACTCGATACACTCGGCCAAGTCTTACGAGTCCATCAATGTCTTGGGCATG
TATCCCTATGGCACTCTGCGTCTTGTCGACCATGTCGTCGATGCAGAGATGGAGGAGCCGCGCCGCGTTTTGACG
CCACCCAGTGTCTCTGCCACGGACCCCATGGTTCATGACTTGGGCGGCGGTGACGTTTGTATCGCTCTCGACATA
CCACAGTTTGCTCCCGTCGGCTATGACCTCTTCCAGTGCTCCGTCAACAAGTTCCATGGTGTCAGAGATATCCCG
CATGGCACTCACTTCTTCTGGGCTGCGCATCCCGACGCCACTCACTGCCGCTCAGGCTTCTTTGTCGTCAACACC
AAGTCTCAGGATCGCACTCATGTCGGCCAGTGGTCTAAATGGACTGATTCATTTGTTCCCCCCATTCGAGCAATC
CGTCGCTGGCAGGGCCAGTCTGTCAAGGACTCGTTTTACTCGCTGCCTAGCTACCACAACCCTCCATCTGACAGC
CTCAGTCAGCGGCTATATCAAGCCGATATGGCTCATAGTCTGGCAGGTTTGTGGCAAGACATGTCAAATTGTATC
AGCGCGCGCCTCTTGAATCGCATGCTGTCGGATCAGGAACTTGGCGACGGCTGGAATCTTCACACCTTGGACAAC
CCCGACGGCCCCTATACCAAGCTGGTAGTTGAAGACCAAAGACAGCCCAAACCCTTTTTACAAGCCCACTCGCTG
CGCTTTTGCTTTCCCAGACGAACTCCAGGCACCTATCTAGACGCATCTTCCTACATTGTCAGCTGGCTTCATCAA
GGCCCCGACGATCGTTGGACCTTTACAGAAGAGGACATTGTCGGCGAGCTCCAGTTTGTATACATCATGGCTGCA
TTTCTACACAATCAGTCATGCGCCCAGCACTGGTGGCTGCTTGTTCCTATTCTCTTGCGCGGCCGTCGTCTGCAC
ATTAGTCGCCCCAGTCTTGCTTCGCGTCTCATAAGCACCATTGCCGCGCAGCTCACGCACTGCTCCAAGAGTGGC
AATGAGTCGTTGCTGTTCAAGAATGCTCACAGGACGCTTCATTTGCGCATCGCCATTGCAAACTATCGCCGTCGC
TCCCGAGACCGTCGCCGCCGTCGAGACGCCCTTCAAGCTCAGGCTGATGCTGAGGACAAGGCTGCCGCTGATCTT
CATCAAGCCTCTATCAACTTGGGTTGGGACCCCGATGATGCTCCCGTGCTTGATGGGCATGGCAATAACATCAAG
AATACCAACCGCAGCCAAGGAGAGAAGAAGGACGACAAGAAGAAGAAGAAGGCATCGCTGCTCAATAGGCTTGTA
AAGCTCGAGCTTCCTATATTCTGCGGCATTGCCCTTCGCCGCGGCCAGGGTTACAGCCAAGTCTCCGTCGTGGAC
GAGAATTGCCGCATCTCTCAAAGCCAGGAAAAGCACAAGCAGCAACCAATCGTGTCTACCAAGTGCATCTAG
Transcript >OphauG2|6350
ATGGAGAGAGGCAAGCTTCGAGTTTCAAACTCGAGCCCGCCCCAGACGGATTATTCTCTCCCTGCCCAGCTGCCC
TTTTCTCACCAAGATGACTACTCCCAGCGCTGCTGGTACCCGCGAAACCGCCAAAATGCCATTCGAGGCATGTAC
CAAGCAGCTCAAGACTTCGACCGAGACTCGATACACTCGGCCAAGTCTTACGAGTCCATCAATGTCTTGGGCATG
TATCCCTATGGCACTCTGCGTCTTGTCGACCATGTCGTCGATGCAGAGATGGAGGAGCCGCGCCGCGTTTTGACG
CCACCCAGTGTCTCTGCCACGGACCCCATGGTTCATGACTTGGGCGGCGGTGACGTTTGTATCGCTCTCGACATA
CCACAGTTTGCTCCCGTCGGCTATGACCTCTTCCAGTGCTCCGTCAACAAGTTCCATGGTGTCAGAGATATCCCG
CATGGCACTCACTTCTTCTGGGCTGCGCATCCCGACGCCACTCACTGCCGCTCAGGCTTCTTTGTCGTCAACACC
AAGTCTCAGGATCGCACTCATGTCGGCCAGTGGTCTAAATGGACTGATTCATTTGTTCCCCCCATTCGAGCAATC
CGTCGCTGGCAGGGCCAGTCTGTCAAGGACTCGTTTTACTCGCTGCCTAGCTACCACAACCCTCCATCTGACAGC
CTCAGTCAGCGGCTATATCAAGCCGATATGGCTCATAGTCTGGCAGGTTTGTGGCAAGACATGTCAAATTGTATC
AGCGCGCGCCTCTTGAATCGCATGCTGTCGGATCAGGAACTTGGCGACGGCTGGAATCTTCACACCTTGGACAAC
CCCGACGGCCCCTATACCAAGCTGGTAGTTGAAGACCAAAGACAGCCCAAACCCTTTTTACAAGCCCACTCGCTG
CGCTTTTGCTTTCCCAGACGAACTCCAGGCACCTATCTAGACGCATCTTCCTACATTGTCAGCTGGCTTCATCAA
GGCCCCGACGATCGTTGGACCTTTACAGAAGAGGACATTGTCGGCGAGCTCCAGTTTGTATACATCATGGCTGCA
TTTCTACACAATCAGTCATGCGCCCAGCACTGGTGGCTGCTTGTTCCTATTCTCTTGCGCGGCCGTCGTCTGCAC
ATTAGTCGCCCCAGTCTTGCTTCGCGTCTCATAAGCACCATTGCCGCGCAGCTCACGCACTGCTCCAAGAGTGGC
AATGAGTCGTTGCTGTTCAAGAATGCTCACAGGACGCTTCATTTGCGCATCGCCATTGCAAACTATCGCCGTCGC
TCCCGAGACCGTCGCCGCCGTCGAGACGCCCTTCAAGCTCAGGCTGATGCTGAGGACAAGGCTGCCGCTGATCTT
CATCAAGCCTCTATCAACTTGGGTTGGGACCCCGATGATGCTCCCGTGCTTGATGGGCATGGCAATAACATCAAG
AATACCAACCGCAGCCAAGGAGAGAAGAAGGACGACAAGAAGAAGAAGAAGGCATCGCTGCTCAATAGGCTTGTA
AAGCTCGAGCTTCCTATATTCTGCGGCATTGCCCTTCGCCGCGGCCAGGGTTACAGCCAAGTCTCCGTCGTGGAC
GAGAATTGCCGCATCTCTCAAAGCCAGGAAAAGCACAAGCAGCAACCAATCGTGTCTACCAAGTGCATCTAG
Gene >OphauG2|6350
ATGGAGAGAGGCAAGCTTCGAGTTTCAAACTCGAGCCCGCCCCAGACGGATTATTCTCTCCCTGCCCAGCTGCCC
TTTTCTCACCAAGATGACTACTCCCAGCGCTGCTGGTACCCGCGAAACCGCCAAAATGCCATTCGAGGCATGTAC
CAAGCAGCTCAAGACTTCGACCGAGACTCGATACACTCGGCCAAGTCTTACGAGTCCATCAATGTCTTGGGCATG
TATCCCTATGGCACTCTGCGTCTTGTCGACCATGTCGTCGATGCAGAGATGGAGGAGCCGCGCCGCGTTTTGACG
CCACCCAGTGTCTCTGCCACGGACCCCATGGTTCATGACTTGGGCGGCGGTGACGTTTGTATCGCTCTCGACATA
CCACAGTTTGCTCCCGTCGGCTATGACCTCTTCCAGTGCTCCGTCAACAAGTTCCATGGTGTCAGAGATATCCCG
CATGGCACTCACTTCTTCTGGGCTGCGCATCCCGACGCCACTCACTGCCGCTCAGGCTTCTTTGTCGTCAACACC
AAGTCTCAGGATCGCACTCATGTCGGCCAGTGGTCTAAATGGACTGATTCATTTGTTCCCCCCATTCGAGCAATC
CGTCGCTGGCAGGGCCAGTCTGTCAAGGACTCGTTTTACTCGCTGCCTAGCTACCACAACCCTCCATCTGACAGC
CTCAGTCAGCGGCTATATCAAGCCGATATGGCTCATAGTCTGGCAGGTTTGTGGCAAGACATGTCAAATTGTATC
AGCGCGCGCCTCTTGAATCGCATGCTGTCGGATCAGGAACTTGGCGACGGCTGGAATCTTCACACCTTGGACAAC
CCCGACGGCCCCTATACCAAGCTGGTAGTTGAAGACCAAAGACAGCCCAAACCCTTTTTACAAGCCCACTCGCTG
CGCTTTTGCTTTCCCAGACGAACTCCAGGCACCTATCTAGACGCATCTTCCTACATTGTCAGCTGGCTTCATCAA
GGCCCCGACGATCGTTGGACCTTTACAGAAGAGGACATTGTCGGCGAGCTCCAGTTTGTATACATCATGGCTGCA
TTTCTACACAATCAGTCATGCGCCCAGCACTGGTGGCTGCTTGTTCCTATTCTCTTGCGCGGCCGTCGTCTGCAC
ATTAGTCGCCCCAGTCTTGCTTCGCGTCTCATAAGCACCATTGCCGCGCAGCTCACGCACTGCTCCAAGAGTGGC
AATGAGTCGTTGCTGTTCAAGAATGCTCACAGGACGCTTCATTTGCGCATCGCCATTGCAAACTATCGCCGTCGC
TCCCGAGACCGTCGCCGCCGTCGAGACGCCCTTCAAGCTCAGGCTGATGCTGAGGACAAGGCTGCCGCTGATCTT
CATCAAGCCTCTATCAACTTGGGTTGGGACCCCGATGATGCTCCCGTGCTTGATGGGCATGGCAATAACATCAAG
AATACCAACCGCAGCCAAGGAGAGAAGAAGGACGACAAGAAGAAGAAGAAGGCATCGCTGCTCAATAGGCTTGTA
AAGCTCGAGCTTCCTATATTCTGCGGCATTGCCCTTCGCCGCGGCCAGGGTTACAGCCAAGTCTCCGTCGTGGAC
GAGAATTGCCGCATCTCTCAAAGCCAGGAAAAGCACAAGCAGCAACCAATCGTGTCTACCAAGTGCATCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail