Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6339
Gene name
LocationContig_643:9967..10405
Strand+
Gene length (bp)438
Transcript length (bp)438
Coding sequence length (bp)438
Protein length (aa) 146

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07367 FB_lectin Fungal fruit body lectin 1.0E-52 1 142

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q00022|ABL_AGABI Agaricus bisporus lectin OS=Agaricus bisporus PE=1 SV=3 1 144 1.0E-34
sp|F2Z266|BEL_BOLED Boletus edulis lectin OS=Boletus edulis PE=1 SV=2 1 145 2.0E-31

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup7952
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6339 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5231

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6339
MSYTITTRVYQTNHNAFFAPVEFCVFNNGSWTSCSYEPVLTMGGSGTSGCIRFVADTGENFIVAIGVHNYKPWGD
IVTKLDTNQTGVKLLPEYYETEWGGTQKKERVDVRWKTLSSYEVTRDGRKYAFKFTVTEGKNLKVNIIIS*
Coding >OphauG2|6339
ATGTCCTACACCATCACTACGCGGGTCTACCAGACCAACCATAACGCTTTTTTCGCGCCTGTCGAATTCTGCGTC
TTTAACAACGGTTCTTGGACCTCGTGTTCTTATGAGCCCGTCCTCACCATGGGGGGCAGCGGTACTAGCGGTTGC
ATCCGCTTCGTCGCCGATACTGGCGAGAACTTCATCGTCGCCATTGGCGTACACAACTATAAGCCGTGGGGCGAC
ATTGTGACCAAGTTGGATACGAATCAGACTGGAGTTAAGTTGCTCCCGGAGTACTACGAGACGGAGTGGGGTGGC
ACTCAGAAGAAGGAGCGTGTCGATGTTCGATGGAAGACGCTCTCGTCGTATGAAGTTACTCGTGATGGGCGAAAG
TATGCTTTTAAATTTACCGTGACAGAAGGAAAGAATCTTAAGGTCAATATTATTATTAGCTAG
Transcript >OphauG2|6339
ATGTCCTACACCATCACTACGCGGGTCTACCAGACCAACCATAACGCTTTTTTCGCGCCTGTCGAATTCTGCGTC
TTTAACAACGGTTCTTGGACCTCGTGTTCTTATGAGCCCGTCCTCACCATGGGGGGCAGCGGTACTAGCGGTTGC
ATCCGCTTCGTCGCCGATACTGGCGAGAACTTCATCGTCGCCATTGGCGTACACAACTATAAGCCGTGGGGCGAC
ATTGTGACCAAGTTGGATACGAATCAGACTGGAGTTAAGTTGCTCCCGGAGTACTACGAGACGGAGTGGGGTGGC
ACTCAGAAGAAGGAGCGTGTCGATGTTCGATGGAAGACGCTCTCGTCGTATGAAGTTACTCGTGATGGGCGAAAG
TATGCTTTTAAATTTACCGTGACAGAAGGAAAGAATCTTAAGGTCAATATTATTATTAGCTAG
Gene >OphauG2|6339
ATGTCCTACACCATCACTACGCGGGTCTACCAGACCAACCATAACGCTTTTTTCGCGCCTGTCGAATTCTGCGTC
TTTAACAACGGTTCTTGGACCTCGTGTTCTTATGAGCCCGTCCTCACCATGGGGGGCAGCGGTACTAGCGGTTGC
ATCCGCTTCGTCGCCGATACTGGCGAGAACTTCATCGTCGCCATTGGCGTACACAACTATAAGCCGTGGGGCGAC
ATTGTGACCAAGTTGGATACGAATCAGACTGGAGTTAAGTTGCTCCCGGAGTACTACGAGACGGAGTGGGGTGGC
ACTCAGAAGAAGGAGCGTGTCGATGTTCGATGGAAGACGCTCTCGTCGTATGAAGTTACTCGTGATGGGCGAAAG
TATGCTTTTAAATTTACCGTGACAGAAGGAAAGAATCTTAAGGTCAATATTATTATTAGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail