Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6317
Gene name
LocationContig_64:18772..19642
Strand+
Gene length (bp)870
Transcript length (bp)870
Coding sequence length (bp)870
Protein length (aa) 290

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13300 DUF4078 Domain of unknown function (DUF4078) 3.4E-27 191 276

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9P7B7|YK24_SCHPO Uncharacterized protein C140.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC140.04 PE=1 SV=1 39 267 5.0E-13
sp|Q6PII3|CC174_HUMAN Coiled-coil domain-containing protein 174 OS=Homo sapiens GN=CCDC174 PE=2 SV=3 55 280 1.0E-09
sp|Q3U155|CC174_MOUSE Coiled-coil domain-containing protein 174 OS=Mus musculus GN=Ccdc174 PE=2 SV=1 55 280 2.0E-07
sp|Q5ZIH9|CC174_CHICK Coiled-coil domain-containing protein 174 OS=Gallus gallus GN=CCDC174 PE=2 SV=1 25 280 1.0E-06

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3966
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6317 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1806
Ophiocordyceps camponoti-floridani Ophcf2|01507
Ophiocordyceps camponoti-rufipedis Ophun1|7620
Ophiocordyceps kimflemingae Ophio5|1653
Ophiocordyceps subramaniannii Hirsu2|7910

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6317
MSTSSGAAGATSGRPRPSREAKQDIFRTSKPSKSKTSQKGQEPRLVLKEVTGTEEETAELARARRKMEVKARQYA
AMKRGDYVPKENEAEPLVDFDRKWAEAKEQGDASSDDDSDEDEDGGGGEVVEWEDEFGRRRRGTRAEKERMERRI
RRGLLGAEELQRMSARPAAPQRLIHGDTIQAMAFQPDNPEQMEELAAKRDRSVTPPDAKHYDADSEIRTKGTGFY
KFSKEEEARVREMAQLEEERRQTEAAREGRDKQKEARRQEIEQRRKEMQARRAQRQADSFLNEL*
Coding >OphauG2|6317
ATGTCGACAAGCTCAGGCGCAGCGGGCGCAACATCAGGGCGGCCGCGGCCATCAAGAGAAGCAAAGCAAGACATT
TTCCGCACCAGCAAGCCGTCAAAAAGCAAGACGAGCCAGAAGGGGCAGGAGCCGCGGCTGGTGCTCAAGGAGGTT
ACGGGAACGGAGGAGGAGACGGCAGAGTTGGCACGCGCACGGCGCAAGATGGAGGTCAAGGCGCGGCAGTACGCA
GCCATGAAGCGAGGGGATTACGTGCCCAAGGAAAACGAGGCAGAGCCGCTGGTGGACTTTGACCGCAAGTGGGCA
GAGGCAAAGGAGCAAGGAGACGCCTCGAGCGATGATGATTCGGATGAGGACGAGGATGGCGGAGGCGGCGAGGTG
GTGGAGTGGGAGGACGAGTTTGGGCGTCGTCGGCGTGGCACTCGCGCAGAAAAGGAACGGATGGAGCGTCGTATA
CGGCGCGGTCTGCTCGGCGCAGAAGAGCTCCAGCGCATGTCGGCGCGGCCCGCGGCGCCTCAACGACTTATCCAC
GGCGACACGATTCAAGCCATGGCTTTCCAGCCTGACAACCCAGAACAAATGGAGGAGCTGGCCGCCAAGCGCGAC
CGGAGCGTTACGCCGCCCGACGCCAAGCACTACGACGCCGACTCGGAGATTCGTACCAAGGGCACTGGCTTTTAC
AAGTTTAGTAAAGAGGAAGAGGCTCGAGTACGTGAAATGGCTCAACTGGAGGAGGAGCGGCGCCAGACAGAGGCG
GCACGAGAGGGGCGCGACAAGCAAAAGGAGGCGAGAAGGCAAGAGATTGAGCAGCGTAGAAAGGAAATGCAGGCT
AGAAGGGCGCAGCGCCAGGCTGATAGCTTCCTTAATGAGCTTTAG
Transcript >OphauG2|6317
ATGTCGACAAGCTCAGGCGCAGCGGGCGCAACATCAGGGCGGCCGCGGCCATCAAGAGAAGCAAAGCAAGACATT
TTCCGCACCAGCAAGCCGTCAAAAAGCAAGACGAGCCAGAAGGGGCAGGAGCCGCGGCTGGTGCTCAAGGAGGTT
ACGGGAACGGAGGAGGAGACGGCAGAGTTGGCACGCGCACGGCGCAAGATGGAGGTCAAGGCGCGGCAGTACGCA
GCCATGAAGCGAGGGGATTACGTGCCCAAGGAAAACGAGGCAGAGCCGCTGGTGGACTTTGACCGCAAGTGGGCA
GAGGCAAAGGAGCAAGGAGACGCCTCGAGCGATGATGATTCGGATGAGGACGAGGATGGCGGAGGCGGCGAGGTG
GTGGAGTGGGAGGACGAGTTTGGGCGTCGTCGGCGTGGCACTCGCGCAGAAAAGGAACGGATGGAGCGTCGTATA
CGGCGCGGTCTGCTCGGCGCAGAAGAGCTCCAGCGCATGTCGGCGCGGCCCGCGGCGCCTCAACGACTTATCCAC
GGCGACACGATTCAAGCCATGGCTTTCCAGCCTGACAACCCAGAACAAATGGAGGAGCTGGCCGCCAAGCGCGAC
CGGAGCGTTACGCCGCCCGACGCCAAGCACTACGACGCCGACTCGGAGATTCGTACCAAGGGCACTGGCTTTTAC
AAGTTTAGTAAAGAGGAAGAGGCTCGAGTACGTGAAATGGCTCAACTGGAGGAGGAGCGGCGCCAGACAGAGGCG
GCACGAGAGGGGCGCGACAAGCAAAAGGAGGCGAGAAGGCAAGAGATTGAGCAGCGTAGAAAGGAAATGCAGGCT
AGAAGGGCGCAGCGCCAGGCTGATAGCTTCCTTAATGAGCTTTAG
Gene >OphauG2|6317
ATGTCGACAAGCTCAGGCGCAGCGGGCGCAACATCAGGGCGGCCGCGGCCATCAAGAGAAGCAAAGCAAGACATT
TTCCGCACCAGCAAGCCGTCAAAAAGCAAGACGAGCCAGAAGGGGCAGGAGCCGCGGCTGGTGCTCAAGGAGGTT
ACGGGAACGGAGGAGGAGACGGCAGAGTTGGCACGCGCACGGCGCAAGATGGAGGTCAAGGCGCGGCAGTACGCA
GCCATGAAGCGAGGGGATTACGTGCCCAAGGAAAACGAGGCAGAGCCGCTGGTGGACTTTGACCGCAAGTGGGCA
GAGGCAAAGGAGCAAGGAGACGCCTCGAGCGATGATGATTCGGATGAGGACGAGGATGGCGGAGGCGGCGAGGTG
GTGGAGTGGGAGGACGAGTTTGGGCGTCGTCGGCGTGGCACTCGCGCAGAAAAGGAACGGATGGAGCGTCGTATA
CGGCGCGGTCTGCTCGGCGCAGAAGAGCTCCAGCGCATGTCGGCGCGGCCCGCGGCGCCTCAACGACTTATCCAC
GGCGACACGATTCAAGCCATGGCTTTCCAGCCTGACAACCCAGAACAAATGGAGGAGCTGGCCGCCAAGCGCGAC
CGGAGCGTTACGCCGCCCGACGCCAAGCACTACGACGCCGACTCGGAGATTCGTACCAAGGGCACTGGCTTTTAC
AAGTTTAGTAAAGAGGAAGAGGCTCGAGTACGTGAAATGGCTCAACTGGAGGAGGAGCGGCGCCAGACAGAGGCG
GCACGAGAGGGGCGCGACAAGCAAAAGGAGGCGAGAAGGCAAGAGATTGAGCAGCGTAGAAAGGAAATGCAGGCT
AGAAGGGCGCAGCGCCAGGCTGATAGCTTCCTTAATGAGCTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail