Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6312
Gene name
LocationContig_64:10851..11971
Strand-
Gene length (bp)1120
Transcript length (bp)960
Coding sequence length (bp)960
Protein length (aa) 320

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01522 Polysacc_deac_1 Polysaccharide deacetylase 3.4E-16 54 159
PF10096 DUF2334 Uncharacterized protein conserved in bacteria (DUF2334) 5.0E-06 82 159

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|B5ZA76|PGDAE_HELPG Peptidoglycan deacetylase OS=Helicobacter pylori (strain G27) GN=pgdA PE=1 SV=1 4 303 1.0E-114
sp|O25080|PGDAE_HELPY Peptidoglycan deacetylase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=pgdA PE=1 SV=1 4 303 9.0E-112

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds Yes
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6312
MGKKRALICYGVDVDAVSGWIGSYGGQDSVNDISRGELAMFQAGDKETGVFAGTVGVERLVKLFGKYDVKSTWFV
PGHSLESFPEALEAVRLAGHEFGLHGYLHENATALTDQQQRDVLDKSYRLLTEFTGKPPRGYTAPWWEMSHQGAR
LLLEYGIEYDHSMSHHDTQPYWLPIDMSWTQLDTSKAASSWMQPMGHGRPTGLVEVPANWHLDDLPPLLYIKDMP
NSHGFVNVRDVEDTWRDHFDWLWRESDDFVLALTIHPDVSGRPHVLLMHERLIEYFASHEGVEFVTMGTAVDEFK
KKNRPPEGALMPAAPRGQE*
Coding >OphauG2|6312
ATGGGCAAGAAGCGGGCACTTATATGCTACGGGGTGGATGTGGATGCGGTGTCTGGGTGGATTGGATCATACGGA
GGACAAGACTCGGTCAACGACATTAGCAGAGGCGAGTTGGCAATGTTCCAAGCGGGCGACAAGGAAACAGGCGTG
TTTGCGGGAACGGTGGGCGTGGAGCGACTGGTCAAGCTGTTTGGCAAATACGACGTCAAAAGCACCTGGTTCGTG
CCCGGCCACAGCCTGGAGTCCTTCCCAGAGGCGCTCGAGGCGGTGCGATTGGCAGGCCACGAGTTTGGGCTGCAT
GGCTACCTCCATGAAAACGCCACCGCCTTGACGGATCAACAGCAGCGCGATGTGCTAGACAAGTCGTACCGGCTG
CTCACCGAGTTTACGGGCAAGCCGCCTCGAGGGTATACGGCACCGTGGTGGGAAATGAGCCACCAAGGAGCGCGC
CTCCTCCTCGAATATGGCATCGAGTATGATCACTCCATGAGCCACCACGACACGCAGCCATACTGGCTCCCGATT
GACATGTCGTGGACGCAGCTCGACACATCCAAAGCGGCGTCGTCATGGATGCAGCCCATGGGGCACGGTCGGCCG
ACGGGACTGGTTGAGGTGCCGGCCAACTGGCATCTGGATGACTTGCCGCCGCTGCTGTACATCAAGGACATGCCC
AACAGCCACGGGTTTGTCAATGTGCGCGATGTCGAGGATACGTGGCGCGACCACTTTGACTGGCTGTGGCGCGAG
AGCGACGACTTTGTGCTTGCCTTGACCATACACCCAGACGTGAGCGGACGGCCGCACGTGCTGCTGATGCACGAA
CGACTGATTGAGTATTTTGCGAGCCACGAGGGCGTCGAGTTTGTGACAATGGGGACCGCTGTGGATGAGTTTAAG
AAGAAGAATCGGCCGCCCGAGGGAGCCTTGATGCCGGCGGCGCCGAGGGGGCAGGAGTAG
Transcript >OphauG2|6312
ATGGGCAAGAAGCGGGCACTTATATGCTACGGGGTGGATGTGGATGCGGTGTCTGGGTGGATTGGATCATACGGA
GGACAAGACTCGGTCAACGACATTAGCAGAGGCGAGTTGGCAATGTTCCAAGCGGGCGACAAGGAAACAGGCGTG
TTTGCGGGAACGGTGGGCGTGGAGCGACTGGTCAAGCTGTTTGGCAAATACGACGTCAAAAGCACCTGGTTCGTG
CCCGGCCACAGCCTGGAGTCCTTCCCAGAGGCGCTCGAGGCGGTGCGATTGGCAGGCCACGAGTTTGGGCTGCAT
GGCTACCTCCATGAAAACGCCACCGCCTTGACGGATCAACAGCAGCGCGATGTGCTAGACAAGTCGTACCGGCTG
CTCACCGAGTTTACGGGCAAGCCGCCTCGAGGGTATACGGCACCGTGGTGGGAAATGAGCCACCAAGGAGCGCGC
CTCCTCCTCGAATATGGCATCGAGTATGATCACTCCATGAGCCACCACGACACGCAGCCATACTGGCTCCCGATT
GACATGTCGTGGACGCAGCTCGACACATCCAAAGCGGCGTCGTCATGGATGCAGCCCATGGGGCACGGTCGGCCG
ACGGGACTGGTTGAGGTGCCGGCCAACTGGCATCTGGATGACTTGCCGCCGCTGCTGTACATCAAGGACATGCCC
AACAGCCACGGGTTTGTCAATGTGCGCGATGTCGAGGATACGTGGCGCGACCACTTTGACTGGCTGTGGCGCGAG
AGCGACGACTTTGTGCTTGCCTTGACCATACACCCAGACGTGAGCGGACGGCCGCACGTGCTGCTGATGCACGAA
CGACTGATTGAGTATTTTGCGAGCCACGAGGGCGTCGAGTTTGTGACAATGGGGACCGCTGTGGATGAGTTTAAG
AAGAAGAATCGGCCGCCCGAGGGAGCCTTGATGCCGGCGGCGCCGAGGGGGCAGGAGTAG
Gene >OphauG2|6312
ATGGGCAAGAAGCGGGCACTTATATGCTACGGGGTGGATGTGGATGCGGTGTCTGGGTGGATTGGATCATACGGA
GGACAAGACTCGGTCAACGACATTAGCAGAGGCGAGTTGGCAATGTTCCAAGCGGGCGTGAATTTTGCTTTTTAC
CTGGTTGAAGACGGAGACGGGCTGACAAGGGAGAGGACAAGGAAACAGGCGTGTTTGCGGGAACGGTGGGCGTGG
AGCGACTGGTCAAGCTGTTTGGCAAATACGACGTCAAAAGCACCTGGTTCGTGCCCGGCCACAGCCTGGAGTCCT
TCCCAGAGGCGCTCGAGGCGGTGCGATTGGCAGGCCACGAGTTTGGGCTGCATGGCTACCTCCATGAAAACGCCA
CCGCCTTGACGGATCAACAGCAGCGCGATGTGCTAGACAAGTCGTACCGGCTGCTCACCGAGTTTACGGGCAAGC
CGCCTCGAGGGTATACGGCACCGTGGTGAGTCGGCTCTTGGATGGGATTGGGGGAGAGATGTAAAAATGAGAGGC
AAAGAGGCAAAATGAGGCAAAATGAGGCAAAGAGGCTGACGTGAGCAACTGTTCAAGGTGGGAAATGAGCCACCA
AGGAGCGCGCCTCCTCCTCGAATATGGCATCGAGTATGATCACTCCATGAGCCACCACGACACGCAGCCATACTG
GCTCCCGATTGACATGTCGTGGACGCAGCTCGACACATCCAAAGCGGCGTCGTCATGGATGCAGCCCATGGGGCA
CGGTCGGCCGACGGGACTGGTTGAGGTGCCGGCCAACTGGCATCTGGATGACTTGCCGCCGCTGCTGTACATCAA
GGACATGCCCAACAGCCACGGGTTTGTCAATGTGCGCGATGTCGAGGATACGTGGCGCGACCACTTTGACTGGCT
GTGGCGCGAGAGCGACGACTTTGTGCTTGCCTTGACCATACACCCAGACGTGAGCGGACGGCCGCACGTGCTGCT
GATGCACGAACGACTGATTGAGTATTTTGCGAGCCACGAGGGCGTCGAGTTTGTGACAATGGGGACCGCTGTGGA
TGAGTTTAAGAAGAAGAATCGGCCGCCCGAGGGAGCCTTGATGCCGGCGGCGCCGAGGGGGCAGGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail