Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6308
Gene name
LocationContig_64:2437..4212
Strand-
Gene length (bp)1775
Transcript length (bp)1377
Coding sequence length (bp)1377
Protein length (aa) 459

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04142 Nuc_sug_transp Nucleotide-sugar transporter 5.5E-96 23 387

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87041|GMS1_SCHPO UDP-galactose transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gms1 PE=2 SV=3 21 390 5.0E-83
sp|Q6AXR5|S35A3_RAT UDP-N-acetylglucosamine transporter OS=Rattus norvegicus GN=Slc35a3 PE=2 SV=1 21 396 3.0E-67
sp|Q8R1T4|S35A3_MOUSE UDP-N-acetylglucosamine transporter OS=Mus musculus GN=Slc35a3 PE=2 SV=1 21 396 2.0E-65
sp|O77592|S35A3_CANLF UDP-N-acetylglucosamine transporter OS=Canis lupus familiaris GN=SLC35A3 PE=2 SV=1 21 396 7.0E-65
sp|Q6YC49|S35A3_BOVIN UDP-N-acetylglucosamine transporter OS=Bos taurus GN=SLC35A3 PE=2 SV=1 21 396 1.0E-64
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87041|GMS1_SCHPO UDP-galactose transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gms1 PE=2 SV=3 21 390 5.0E-83
sp|Q6AXR5|S35A3_RAT UDP-N-acetylglucosamine transporter OS=Rattus norvegicus GN=Slc35a3 PE=2 SV=1 21 396 3.0E-67
sp|Q8R1T4|S35A3_MOUSE UDP-N-acetylglucosamine transporter OS=Mus musculus GN=Slc35a3 PE=2 SV=1 21 396 2.0E-65
sp|O77592|S35A3_CANLF UDP-N-acetylglucosamine transporter OS=Canis lupus familiaris GN=SLC35A3 PE=2 SV=1 21 396 7.0E-65
sp|Q6YC49|S35A3_BOVIN UDP-N-acetylglucosamine transporter OS=Bos taurus GN=SLC35A3 PE=2 SV=1 21 396 1.0E-64
sp|Q9Y2D2|S35A3_HUMAN UDP-N-acetylglucosamine transporter OS=Homo sapiens GN=SLC35A3 PE=1 SV=1 21 396 2.0E-63
sp|Q9R0M8|S35A2_MOUSE UDP-galactose translocator OS=Mus musculus GN=Slc35a2 PE=1 SV=1 21 435 2.0E-56
sp|Q61420|S35A1_MOUSE CMP-sialic acid transporter OS=Mus musculus GN=Slc35a1 PE=1 SV=2 24 391 7.0E-46
sp|O08520|S35A1_CRIGR CMP-sialic acid transporter OS=Cricetulus griseus GN=SLC35A1 PE=2 SV=1 24 391 7.0E-45
sp|Q02334|UGTP1_CAEEL UDP-galactose translocator 1 OS=Caenorhabditis elegans GN=ugtp-1 PE=3 SV=2 27 387 6.0E-39
sp|Q93890|SRF3_CAEEL UDP-galactose/UDP-N-acetylglucosamine transporter srf-3 OS=Caenorhabditis elegans GN=srf-3 PE=1 SV=5 8 386 5.0E-34
sp|P78382|S35A1_HUMAN CMP-sialic acid transporter OS=Homo sapiens GN=SLC35A1 PE=2 SV=1 245 412 5.0E-33
sp|Q58DA6|S35A2_BOVIN UDP-galactose translocator OS=Bos taurus GN=SLC35A2 PE=2 SV=1 237 390 7.0E-33
sp|Q8WMS0|S35A2_CANLF UDP-galactose translocator OS=Canis lupus familiaris GN=SLC35A2 PE=2 SV=2 237 390 2.0E-32
sp|P78381|S35A2_HUMAN UDP-galactose translocator OS=Homo sapiens GN=SLC35A2 PE=1 SV=1 237 390 3.0E-32
sp|B8B7Q4|CSTR2_ORYSI CMP-sialic acid transporter 2 OS=Oryza sativa subsp. indica GN=CSTLP2 PE=3 SV=1 13 390 4.0E-28
sp|Q6ZL17|CSTR2_ORYSJ CMP-sialic acid transporter 2 OS=Oryza sativa subsp. japonica GN=CSTLP2 PE=2 SV=1 13 390 5.0E-28
sp|F4JN00|CSTR4_ARATH CMP-sialic acid transporter 4 OS=Arabidopsis thaliana GN=At4g35335 PE=2 SV=1 32 386 2.0E-27
sp|Q6DCG9|S35A5_XENLA Probable UDP-sugar transporter protein SLC35A5 OS=Xenopus laevis GN=slc35a5 PE=2 SV=1 108 387 5.0E-26
sp|Q921R7|S35A5_MOUSE Probable UDP-sugar transporter protein SLC35A5 OS=Mus musculus GN=Slc35a5 PE=1 SV=3 32 401 2.0E-24
sp|Q5R4D7|S35A5_PONAB Probable UDP-sugar transporter protein SLC35A5 OS=Pongo abelii GN=SLC35A5 PE=2 SV=1 32 416 4.0E-23
sp|Q654D9|CSTR1_ORYSJ CMP-sialic acid transporter 1 OS=Oryza sativa subsp. japonica GN=CSTLP1 PE=2 SV=1 49 389 7.0E-22
sp|B8B350|CSTR1_ORYSI CMP-sialic acid transporter 1 OS=Oryza sativa subsp. indica GN=CSTLP1 PE=3 SV=1 49 389 1.0E-21
sp|Q9BS91|S35A5_HUMAN Probable UDP-sugar transporter protein SLC35A5 OS=Homo sapiens GN=SLC35A5 PE=1 SV=2 110 416 5.0E-21
sp|P78381|S35A2_HUMAN UDP-galactose translocator OS=Homo sapiens GN=SLC35A2 PE=1 SV=1 21 174 8.0E-21
sp|Q58DA6|S35A2_BOVIN UDP-galactose translocator OS=Bos taurus GN=SLC35A2 PE=2 SV=1 21 174 2.0E-20
sp|Q90X48|S35A5_DANRE Probable UDP-sugar transporter protein SLC35A5 OS=Danio rerio GN=slc35a5 PE=2 SV=1 36 436 2.0E-20
sp|Q8WMS0|S35A2_CANLF UDP-galactose translocator OS=Canis lupus familiaris GN=SLC35A2 PE=2 SV=2 21 174 3.0E-20
sp|A6QPI1|S35A5_BOVIN Probable UDP-sugar transporter protein SLC35A5 OS=Bos taurus GN=SLC35A5 PE=2 SV=1 25 416 3.0E-18
sp|Q8LGE9|CSTR1_ARATH CMP-sialic acid transporter 1 OS=Arabidopsis thaliana GN=At5g41760 PE=2 SV=1 49 389 7.0E-18
sp|A4IHW3|S35A4_XENTR Probable UDP-sugar transporter protein SLC35A4 OS=Xenopus tropicalis GN=slc35a4 PE=2 SV=1 49 386 3.0E-14
sp|Q5N855|CSTR3_ORYSJ CMP-sialic acid transporter 3 OS=Oryza sativa subsp. japonica GN=CSTLP3 PE=2 SV=1 49 401 1.0E-13
sp|B8A7Q8|CSTR3_ORYSI CMP-sialic acid transporter 3 OS=Oryza sativa subsp. indica GN=CSTLP3 PE=3 SV=1 49 401 1.0E-13
sp|A0JMG9|S35A4_DANRE Probable UDP-sugar transporter protein SLC35A4 OS=Danio rerio GN=slc35a4 PE=2 SV=1 108 386 2.0E-13
sp|P78382|S35A1_HUMAN CMP-sialic acid transporter OS=Homo sapiens GN=SLC35A1 PE=2 SV=1 24 174 5.0E-12
sp|Q91ZR7|S35A4_RAT Probable UDP-sugar transporter protein SLC35A4 OS=Rattus norvegicus GN=Slc35a4 PE=2 SV=2 256 386 3.0E-07
sp|Q9D321|S35A4_MOUSE Probable UDP-sugar transporter protein SLC35A4 OS=Mus musculus GN=Slc35a4 PE=2 SV=1 256 386 2.0E-06
sp|Q96G79|S35A4_HUMAN Probable UDP-sugar transporter protein SLC35A4 OS=Homo sapiens GN=SLC35A4 PE=2 SV=1 256 386 3.0E-06
sp|Q7X7C4|CSTR4_ORYSJ CMP-sialic acid transporter 4 OS=Oryza sativa subsp. japonica GN=CSTLP4 PE=3 SV=2 60 178 5.0E-06
sp|Q01IU9|CSTR4_ORYSI CMP-sialic acid transporter 4 OS=Oryza sativa subsp. indica GN=CSTLP4 PE=3 SV=1 60 178 5.0E-06
sp|Q8GY97|CSTR2_ARATH CMP-sialic acid transporter 2 OS=Arabidopsis thaliana GN=At2g43240 PE=2 SV=1 60 178 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0090481 pyrimidine nucleotide-sugar transmembrane transport Yes
GO:0000139 Golgi membrane Yes
GO:0015165 pyrimidine nucleotide-sugar transmembrane transporter activity Yes
GO:0015780 nucleotide-sugar transmembrane transport No
GO:0015932 nucleobase-containing compound transmembrane transporter activity No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0071702 organic substance transport No
GO:0055085 transmembrane transport No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0071705 nitrogen compound transport No
GO:0015931 nucleobase-containing compound transport No
GO:0009987 cellular process No
GO:1901264 carbohydrate derivative transport No
GO:0005575 cellular_component No
GO:0031090 organelle membrane No
GO:0005338 nucleotide-sugar transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0098588 bounding membrane of organelle No
GO:1901505 carbohydrate derivative transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0016020 membrane No
GO:0006810 transport No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

Domain # Start End Length
1 98 120 22
2 130 152 22
3 161 178 17
4 243 265 22
5 278 300 22
6 315 337 22
7 342 364 22
8 369 388 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6308
MTILETAVPRAVAGRGHGTGRDLSLITLTFQNSALILIMHYSRIMPPAGDHRYFTSTAVFLNEVIKLAVSLTLVI
YETSQTLAPSTPATVLFEQIYNAVFSADAWLLAFPAAFYTLQNLLQFVAVENLDPVHFQVLYQVKILTTAIFSVI
LLRRHLGLQRWVSLVVLTLGVSIVSLPSSERSVDSLLLHGVPNHYFARSKHELGQVGAAVADLSSPDFHLSRRSA
TYQGIANDLPPPDPVMNYSVGATAAVVSAVVSGLAGVYFEKVLKEGPAAQTSVWIRNIQLSLYSLVTAGLGGILW
QDGSGIREHGFFEGYNGIVWTAVLLQAAGGLIASLVIRDADNIVKNFATSISIIISFIVSVWVFEFSVTLTFLLG
TSLVLLATYLYGVPERSRHRPPAVRIVSFEKPSIERLATPRITDVARLNADPFEPATAAVTSSRPSSPMLPRQAS
RTHVLRDD*
Coding >OphauG2|6308
ATGACGATTCTCGAGACTGCCGTCCCCAGGGCCGTTGCTGGCAGGGGCCACGGCACGGGACGAGACCTGTCGCTC
ATTACGCTGACGTTTCAAAACTCGGCCCTCATCTTGATTATGCACTACTCGCGCATCATGCCGCCTGCAGGCGAC
CACCGCTACTTTACCTCAACCGCAGTCTTTCTCAACGAGGTTATCAAGCTTGCCGTCTCCCTCACATTGGTCATA
TACGAGACGTCCCAGACGCTTGCTCCCAGCACCCCTGCCACGGTTCTCTTTGAGCAAATCTACAATGCTGTCTTT
TCTGCCGATGCCTGGCTGCTGGCCTTTCCTGCCGCTTTTTATACCCTCCAGAACCTGCTGCAGTTTGTCGCTGTC
GAGAACCTCGATCCAGTACACTTCCAGGTGCTCTACCAGGTCAAGATCCTCACCACTGCTATATTCAGCGTCATT
CTGCTTCGCCGCCACCTGGGCCTTCAGCGCTGGGTCTCGCTTGTAGTCCTTACCCTTGGCGTCTCCATTGTCTCC
CTCCCTTCATCTGAGAGGAGCGTCGACTCGCTACTCCTCCATGGCGTTCCCAACCACTACTTTGCGCGCTCCAAG
CACGAGCTTGGCCAGGTTGGCGCTGCCGTTGCCGACTTGTCCTCACCCGACTTCCATCTTTCGCGCCGCTCTGCC
ACATACCAAGGCATCGCCAACGACTTGCCGCCCCCCGACCCCGTAATGAATTACTCGGTTGGCGCCACTGCTGCC
GTGGTCTCGGCCGTGGTCTCGGGCCTCGCTGGCGTCTACTTTGAAAAGGTGCTCAAGGAAGGCCCGGCCGCCCAG
ACGAGCGTATGGATACGCAACATCCAGCTCAGCCTCTACTCCCTCGTCACTGCTGGCCTCGGCGGCATCCTCTGG
CAAGACGGCAGCGGCATCCGCGAACACGGCTTCTTTGAGGGCTACAATGGCATTGTCTGGACCGCTGTCCTTTTG
CAGGCGGCAGGTGGATTGATTGCTAGCCTCGTCATTCGCGACGCGGATAATATTGTCAAGAATTTCGCCACGAGC
ATTAGCATCATTATCAGCTTTATTGTGAGCGTGTGGGTGTTTGAGTTTTCAGTCACATTGACGTTCTTGCTGGGC
ACCTCGCTCGTCTTGTTGGCCACCTATCTCTACGGCGTGCCCGAGCGCAGCCGCCACCGCCCACCAGCGGTACGC
ATCGTTAGCTTTGAAAAGCCATCGATTGAGCGCCTGGCCACGCCGCGCATCACTGACGTGGCGCGCCTCAATGCC
GATCCCTTTGAGCCCGCCACTGCCGCTGTGACTTCAAGCCGGCCTAGTAGTCCTATGCTTCCTCGGCAGGCTAGT
CGCACGCATGTGCTACGAGACGATTAG
Transcript >OphauG2|6308
ATGACGATTCTCGAGACTGCCGTCCCCAGGGCCGTTGCTGGCAGGGGCCACGGCACGGGACGAGACCTGTCGCTC
ATTACGCTGACGTTTCAAAACTCGGCCCTCATCTTGATTATGCACTACTCGCGCATCATGCCGCCTGCAGGCGAC
CACCGCTACTTTACCTCAACCGCAGTCTTTCTCAACGAGGTTATCAAGCTTGCCGTCTCCCTCACATTGGTCATA
TACGAGACGTCCCAGACGCTTGCTCCCAGCACCCCTGCCACGGTTCTCTTTGAGCAAATCTACAATGCTGTCTTT
TCTGCCGATGCCTGGCTGCTGGCCTTTCCTGCCGCTTTTTATACCCTCCAGAACCTGCTGCAGTTTGTCGCTGTC
GAGAACCTCGATCCAGTACACTTCCAGGTGCTCTACCAGGTCAAGATCCTCACCACTGCTATATTCAGCGTCATT
CTGCTTCGCCGCCACCTGGGCCTTCAGCGCTGGGTCTCGCTTGTAGTCCTTACCCTTGGCGTCTCCATTGTCTCC
CTCCCTTCATCTGAGAGGAGCGTCGACTCGCTACTCCTCCATGGCGTTCCCAACCACTACTTTGCGCGCTCCAAG
CACGAGCTTGGCCAGGTTGGCGCTGCCGTTGCCGACTTGTCCTCACCCGACTTCCATCTTTCGCGCCGCTCTGCC
ACATACCAAGGCATCGCCAACGACTTGCCGCCCCCCGACCCCGTAATGAATTACTCGGTTGGCGCCACTGCTGCC
GTGGTCTCGGCCGTGGTCTCGGGCCTCGCTGGCGTCTACTTTGAAAAGGTGCTCAAGGAAGGCCCGGCCGCCCAG
ACGAGCGTATGGATACGCAACATCCAGCTCAGCCTCTACTCCCTCGTCACTGCTGGCCTCGGCGGCATCCTCTGG
CAAGACGGCAGCGGCATCCGCGAACACGGCTTCTTTGAGGGCTACAATGGCATTGTCTGGACCGCTGTCCTTTTG
CAGGCGGCAGGTGGATTGATTGCTAGCCTCGTCATTCGCGACGCGGATAATATTGTCAAGAATTTCGCCACGAGC
ATTAGCATCATTATCAGCTTTATTGTGAGCGTGTGGGTGTTTGAGTTTTCAGTCACATTGACGTTCTTGCTGGGC
ACCTCGCTCGTCTTGTTGGCCACCTATCTCTACGGCGTGCCCGAGCGCAGCCGCCACCGCCCACCAGCGGTACGC
ATCGTTAGCTTTGAAAAGCCATCGATTGAGCGCCTGGCCACGCCGCGCATCACTGACGTGGCGCGCCTCAATGCC
GATCCCTTTGAGCCCGCCACTGCCGCTGTGACTTCAAGCCGGCCTAGTAGTCCTATGCTTCCTCGGCAGGCTAGT
CGCACGCATGTGCTACGAGACGATTAG
Gene >OphauG2|6308
ATGACGATTCTCGAGACTGCCGTCCCCAGGGCCGTTGCTGGCAGGGGCCACGGCACGGGACGAGACCTGTCGCTC
ATTACGGTAACCAACGCACCCCCGTCCGCTCGGACACGCCCAAAAAAAAAGGCGACCCAATGGCCTGGATTAGCT
GACGCTTCAAATGACAGCTGACGTTTCAAAACTCGGCCCTCATCTTGGTATGTCGTCGGGCACGGCAAACCCATA
TTGCGCACCCATATTGCTCTTCTCCTCAGCAACATGGTTGGCCTGCTAACCCGTCGTGCGCGTCCAGATTATGCA
CTACTCGCGCATCATGCCGCCTGCAGGCGACCACCGCTACTTTACCTCAACCGCAGTCTTTCTCAACGAGGTTAT
CAAGCTTGCCGTCTCCCTCACATTGGTCATATACGAGACGTCCCAGACGCTTGCTCCCAGCACCCCTGCCACGGT
TCTCTTTGAGCAAATCTACAATGCTGTCTTTTCTGCCGATGCCTGGCTGCTGGCCTTTCCTGCCGCTTTTTATAC
CCTCCAGAACCTGCTGCAGTTTGTCGCTGTCGAGAACCTCGATCCAGTACACTTCCAGGTGCTCTACCAGGTCAA
GGTGCGTCGTCTGTTGCTTTGCTTGCCTTTTGTCAAGACTTGAGCTCGACGAGACTGACGTCTATATGTGTTTTT
GTTCTGTTTGCCTCTAGATCCTCACCACTGCTATATTCAGCGTCATTCTGCTTCGCCGCCACCTGGGCCTTCAGC
GCTGGGTCTCGCTTGTAGTCCTTACCCTTGGCGTCTCCATTGTCTCCCTCCCTTCATCTGAGAGGAGCGTCGACT
CGCTACTCCTCCATGGCGTTCCCAACCACTACTTTGCGCGCTCCAAGCACGAGCTTGGCCAGGTTGGCGCTGCCG
TTGCCGACTTGTCCTCACCCGACTTCCATCTTTCGCGCCGCTCTGCCACATACCAAGGCATCGCCAACGACTTGC
CGCCCCCCGACCCCGTAATGAATTACTCGGTTGGCGCCACTGCTGCCGTGGTCTCGGCCGTGGTCTCGGGCCTCG
CTGGCGTCTACTTTGAAAAGGTGCTCAAGGAAGGCCCGGCCGCCCAGACGAGCGTATGGATACGCAACATCCAGC
TCAGCCTCTACTCCCTCGTCACTGCTGGCCTCGGCGGCATCCTCTGGCAAGACGGCAGCGGCATCCGCGAACACG
GCTTCTTTGAGGGCTACAATGGCATTGTCTGGACCGCTGTCCTTTTGCAGGCGGCAGGTGGATTGATTGCTAGCC
TCGTCATTCGCGACGCGGATAATATTGTCAAGAATTTCGCCACGAGCATTAGCATCATTATCAGCTTTATTGTGA
GCGTGTGGGTGTTTGAGTTTTCAGTCACATTGACGGTGAGTGGCTTTGCATTTTCTGCTTGTTTTAATTTCACGC
TCCCATGTCACATTTCATTTCACGCTTGCCTTGAACTTGATTCATCTTCAAGTTCTACGCTGACTCGACGTGGTA
CAAAAAAAAAGTTCTTGCTGGGCACCTCGCTCGTCTTGTTGGCCACCTATCTCTACGGCGTGCCCGAGCGCAGCC
GCCACCGCCCACCAGCGGTACGCATCGTTAGCTTTGAAAAGCCATCGATTGAGCGCCTGGCCACGCCGCGCATCA
CTGACGTGGCGCGCCTCAATGCCGATCCCTTTGAGCCCGCCACTGCCGCTGTGACTTCAAGCCGGCCTAGTAGTC
CTATGCTTCCTCGGCAGGCTAGTCGCACGCATGTGCTACGAGACGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail