Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6304
Gene name
LocationContig_639:3389..5546
Strand+
Gene length (bp)2157
Transcript length (bp)2094
Coding sequence length (bp)2094
Protein length (aa) 698

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08729 HUN HPC2 and ubinuclein domain 2.1E-07 558 598

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q01448|HPC2_YEAST Histone promoter control protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HPC2 PE=1 SV=2 462 621 9.0E-13
sp|O43083|HPC2_SCHPO Histone promoter control protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hpc2 PE=1 SV=1 466 601 1.0E-10

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6304
MAAAGDKRYESSAGDLSSPPSISLSEPASPSQAATSRRRDGKHSNNQDPAATMQRGEIILGSNDQRQLAPQPRQL
TFQQYQQPSPGDGESRPPAQLHQRKYEYIDGQWVQLTAAGVPRKKPGRKPKLAAEGSASISDQKPPQPRTRKPRK
PREPRDPAAAAAPSRKRKAPPASDMDTDGGDGPRKVSSIAPGSAAQVATPNVAAASAASAMAVQQLQNHSPAHKT
HQVASEPRYSPVMAKRDVYPGSMQSILNAEPPVQPQAVAPTVPSGSLTTPVRSGGLSYDPIRGNYDPVRETMASS
HAVYSSTSGSPHAPAPLAHRSPSIASMIEPQVPVVNSPAPAQSRTQDLPSRPSSPLRRPASTPAAAVTAVTTSTS
TSTTTLTRKVPNESNKDSPRPHAPPTRPIPNQANFTTISNGPVRRVDKANNMASATPRTENLDDLGQENMGRSIL
DFGKVKPGEEQQAPSIMLKIPIKVGENNKYVNFMRLAEERYGWDALHPRLAAIRDRKARIAAAAASLKAELGRES
GDEMSLDLSDGEGSNQENGGTSGADAQTKPKRKRNCKEDQYDVEDDFVDDSELLWEAQAAASRDGFFVYSGPLVP
EVEKAPTGREAPKRGRGSRGGRGSRGATRGGANGRGGGPGSRGGNVTRKPRVTKSEKLQREREKAERENLALLSK
TPSNSYALQPTTPSFSVSELAT*
Coding >OphauG2|6304
ATGGCGGCTGCTGGAGACAAACGATACGAGTCGTCAGCCGGAGATCTCTCTTCACCGCCATCCATCTCGCTTTCG
GAGCCAGCATCGCCCTCGCAAGCCGCCACAAGCCGCCGCCGAGACGGCAAGCATAGCAACAACCAGGACCCGGCA
GCCACGATGCAGCGGGGGGAGATAATCTTGGGATCCAACGACCAACGCCAGCTGGCTCCGCAGCCTCGGCAGTTG
ACATTCCAGCAATACCAGCAACCATCTCCGGGTGATGGTGAATCACGCCCACCTGCCCAATTGCATCAGAGAAAG
TATGAGTATATTGACGGCCAGTGGGTGCAGCTTACTGCGGCTGGCGTGCCCCGTAAAAAGCCGGGCCGAAAGCCA
AAGCTAGCTGCTGAAGGATCGGCTTCCATCTCTGATCAAAAGCCGCCACAGCCCAGGACCCGAAAGCCTCGAAAG
CCGCGAGAGCCGCGCGATCCCGCCGCCGCTGCTGCGCCTTCTCGCAAGCGCAAGGCGCCTCCTGCATCAGACATG
GATACGGACGGCGGTGATGGACCGCGCAAAGTCTCTTCTATAGCTCCAGGCTCTGCCGCTCAAGTAGCAACGCCA
AACGTCGCTGCTGCGTCTGCAGCTTCAGCCATGGCTGTACAACAACTGCAGAATCATAGCCCTGCACACAAAACC
CACCAAGTAGCATCTGAGCCTCGATACTCTCCTGTCATGGCCAAGCGCGATGTATATCCAGGGTCTATGCAGAGC
ATTCTCAATGCAGAGCCGCCAGTCCAGCCGCAGGCAGTCGCCCCAACCGTCCCCTCGGGCTCCCTGACGACGCCT
GTTCGGTCAGGCGGTCTAAGCTACGACCCGATTCGCGGAAATTACGACCCTGTGCGCGAAACCATGGCCTCGTCG
CATGCTGTTTACTCTTCAACATCGGGCTCTCCACATGCGCCAGCTCCCCTGGCTCATCGATCTCCATCCATTGCC
AGCATGATAGAGCCTCAGGTTCCTGTTGTCAATTCTCCGGCGCCCGCTCAGTCAAGGACTCAGGATCTGCCGTCG
AGACCTTCGTCACCCCTGCGGCGTCCGGCTTCCACCCCTGCTGCTGCTGTCACTGCTGTCACTACCAGTACTAGT
ACTAGTACCACTACTCTCACACGCAAGGTACCCAACGAGTCAAACAAAGATAGCCCCCGTCCTCATGCACCACCT
ACTCGTCCCATACCAAACCAAGCCAACTTCACCACCATCTCGAACGGTCCGGTCCGTAGGGTAGACAAGGCAAAT
AACATGGCATCTGCAACACCGAGGACGGAAAATCTCGACGATCTTGGTCAAGAGAACATGGGAAGGTCTATTCTC
GACTTTGGCAAGGTGAAGCCGGGCGAAGAGCAACAAGCGCCCAGCATCATGCTCAAGATACCCATCAAAGTTGGC
GAGAATAACAAATATGTCAACTTCATGCGGTTAGCCGAGGAACGATATGGCTGGGATGCTCTGCACCCTCGGCTT
GCTGCCATTCGGGATCGCAAGGCTCGGATTGCCGCTGCTGCCGCGTCTCTCAAAGCTGAGCTGGGCCGCGAATCA
GGCGATGAGATGTCTCTCGATCTTTCCGACGGCGAAGGCAGCAACCAGGAAAATGGTGGGACCAGCGGCGCTGAT
GCTCAAACAAAGCCCAAGAGGAAACGCAATTGCAAAGAGGACCAATACGACGTTGAGGACGATTTTGTTGATGAT
TCCGAGTTGCTGTGGGAAGCTCAGGCAGCTGCAAGTAGGGATGGCTTCTTCGTGTATTCAGGGCCCTTGGTGCCC
GAGGTTGAAAAGGCACCCACTGGTCGAGAAGCACCCAAGCGTGGAAGAGGCAGCCGTGGAGGGCGCGGCAGCCGA
GGAGCCACTAGAGGCGGCGCAAATGGCCGGGGCGGCGGTCCTGGCTCGCGGGGCGGGAATGTCACGCGCAAGCCT
CGCGTCACAAAGTCGGAAAAGCTGCAGCGGGAGCGCGAAAAGGCGGAGCGGGAAAATCTCGCCCTCTTGTCCAAG
ACGCCCAGCAACAGCTATGCACTTCAACCCACGACGCCGTCTTTCTCAGTCAGTGAACTCGCCACTTAG
Transcript >OphauG2|6304
ATGGCGGCTGCTGGAGACAAACGATACGAGTCGTCAGCCGGAGATCTCTCTTCACCGCCATCCATCTCGCTTTCG
GAGCCAGCATCGCCCTCGCAAGCCGCCACAAGCCGCCGCCGAGACGGCAAGCATAGCAACAACCAGGACCCGGCA
GCCACGATGCAGCGGGGGGAGATAATCTTGGGATCCAACGACCAACGCCAGCTGGCTCCGCAGCCTCGGCAGTTG
ACATTCCAGCAATACCAGCAACCATCTCCGGGTGATGGTGAATCACGCCCACCTGCCCAATTGCATCAGAGAAAG
TATGAGTATATTGACGGCCAGTGGGTGCAGCTTACTGCGGCTGGCGTGCCCCGTAAAAAGCCGGGCCGAAAGCCA
AAGCTAGCTGCTGAAGGATCGGCTTCCATCTCTGATCAAAAGCCGCCACAGCCCAGGACCCGAAAGCCTCGAAAG
CCGCGAGAGCCGCGCGATCCCGCCGCCGCTGCTGCGCCTTCTCGCAAGCGCAAGGCGCCTCCTGCATCAGACATG
GATACGGACGGCGGTGATGGACCGCGCAAAGTCTCTTCTATAGCTCCAGGCTCTGCCGCTCAAGTAGCAACGCCA
AACGTCGCTGCTGCGTCTGCAGCTTCAGCCATGGCTGTACAACAACTGCAGAATCATAGCCCTGCACACAAAACC
CACCAAGTAGCATCTGAGCCTCGATACTCTCCTGTCATGGCCAAGCGCGATGTATATCCAGGGTCTATGCAGAGC
ATTCTCAATGCAGAGCCGCCAGTCCAGCCGCAGGCAGTCGCCCCAACCGTCCCCTCGGGCTCCCTGACGACGCCT
GTTCGGTCAGGCGGTCTAAGCTACGACCCGATTCGCGGAAATTACGACCCTGTGCGCGAAACCATGGCCTCGTCG
CATGCTGTTTACTCTTCAACATCGGGCTCTCCACATGCGCCAGCTCCCCTGGCTCATCGATCTCCATCCATTGCC
AGCATGATAGAGCCTCAGGTTCCTGTTGTCAATTCTCCGGCGCCCGCTCAGTCAAGGACTCAGGATCTGCCGTCG
AGACCTTCGTCACCCCTGCGGCGTCCGGCTTCCACCCCTGCTGCTGCTGTCACTGCTGTCACTACCAGTACTAGT
ACTAGTACCACTACTCTCACACGCAAGGTACCCAACGAGTCAAACAAAGATAGCCCCCGTCCTCATGCACCACCT
ACTCGTCCCATACCAAACCAAGCCAACTTCACCACCATCTCGAACGGTCCGGTCCGTAGGGTAGACAAGGCAAAT
AACATGGCATCTGCAACACCGAGGACGGAAAATCTCGACGATCTTGGTCAAGAGAACATGGGAAGGTCTATTCTC
GACTTTGGCAAGGTGAAGCCGGGCGAAGAGCAACAAGCGCCCAGCATCATGCTCAAGATACCCATCAAAGTTGGC
GAGAATAACAAATATGTCAACTTCATGCGGTTAGCCGAGGAACGATATGGCTGGGATGCTCTGCACCCTCGGCTT
GCTGCCATTCGGGATCGCAAGGCTCGGATTGCCGCTGCTGCCGCGTCTCTCAAAGCTGAGCTGGGCCGCGAATCA
GGCGATGAGATGTCTCTCGATCTTTCCGACGGCGAAGGCAGCAACCAGGAAAATGGTGGGACCAGCGGCGCTGAT
GCTCAAACAAAGCCCAAGAGGAAACGCAATTGCAAAGAGGACCAATACGACGTTGAGGACGATTTTGTTGATGAT
TCCGAGTTGCTGTGGGAAGCTCAGGCAGCTGCAAGTAGGGATGGCTTCTTCGTGTATTCAGGGCCCTTGGTGCCC
GAGGTTGAAAAGGCACCCACTGGTCGAGAAGCACCCAAGCGTGGAAGAGGCAGCCGTGGAGGGCGCGGCAGCCGA
GGAGCCACTAGAGGCGGCGCAAATGGCCGGGGCGGCGGTCCTGGCTCGCGGGGCGGGAATGTCACGCGCAAGCCT
CGCGTCACAAAGTCGGAAAAGCTGCAGCGGGAGCGCGAAAAGGCGGAGCGGGAAAATCTCGCCCTCTTGTCCAAG
ACGCCCAGCAACAGCTATGCACTTCAACCCACGACGCCGTCTTTCTCAGTCAGTGAACTCGCCACTTAG
Gene >OphauG2|6304
ATGGCGGCTGCTGGAGACAAACGATACGAGTCGTCAGCCGGAGATCTCTCTTCACCGCCATCCATCTCGCTTTCG
GAGCCAGCATCGCCCTCGCAAGCCGCCACAAGCCGCCGCCGAGACGGCAAGCATAGCAACAACCAGGACCCGGCA
GCCACGATGCAGCGGGGGGAGATAATCTTGGGATCCAACGACCAACGCCAGCTGGCTCCGCAGCCTCGGCAGTTG
ACATTCCAGCAATACCAGCAACCATCTCCGGGTGATGGTGAATCACGCCCACCTGCCCAATTGCATCAGAGAAAG
TATGAGTATATTGACGGCCAGTGGGTGCAGCTTACTGCGGCTGGCGTGCCCCGTAAAAAGCCGGGCCGAAAGCCA
AAGCTAGCTGCTGAAGGATCGGCTTCCATCTCTGATCAAAAGCCGCCACAGCCCAGGACCCGAAAGCCTCGAAAG
CCGCGAGAGCCGCGCGATCCCGCCGCCGCTGCTGCGCCTTCTCGCAAGCGCAAGGCGCCTCCTGCATCAGACATG
GATACGGACGGCGGTGATGGACCGCGCAAAGTCTCTTCTATAGCTCCAGGCTCTGCCGCTCAAGTAGCAACGCCA
AACGTCGCTGCTGCGTCTGCAGCTTCAGCCATGGCTGTACAACAACTGCAGAATCATAGCCCTGCACACAAAACC
CACCAAGTAGCATCTGAGCCTCGATACTCTCCTGTCATGGCCAAGCGCGATGTATATCCAGGGTCTATGCAGAGC
ATTCTCAATGCAGAGCCGCCAGTCCAGCCGCAGGCAGTCGCCCCAACCGTCCCCTCGGGCTCCCTGACGACGCCT
GTTCGGTCAGGCGGTCTAAGCTACGACCCGATTCGCGGAAATTACGACCCTGTGCGCGAAACCATGGCCTCGTCG
CATGCTGTTTACTCTTCAACATCGGGCTCTCCACATGCGCCAGCTCCCCTGGCTCATCGATCTCCATCCATTGCC
AGCATGATAGAGCCTCAGGTTCCTGTTGTCAATTCTCCGGCGCCCGCTCAGTCAAGGACTCAGGATCTGCCGTCG
AGACCTTCGTCACCCCTGCGGCGTCCGGCTTCCACCCCTGCTGCTGCTGTCACTGCTGTCACTACCAGTACTAGT
ACTAGTACCACTACTCTCACACGCAAGGTACCCAACGAGTCAAACAAAGATAGCCCCCGTCCTCATGCACCACCT
ACTCGTCCCATACCAAACCAAGCCAACTTCACCACCATCTCGAACGGTCCGGTCCGTAGGGTAGACAAGGCAAAT
AACATGGCATCTGCAACACCGAGGACGGAAAATCTCGACGATCTTGGTCAAGAGAACATGGGAAGGTCTATTCTC
GACTTTGGCAAGGTGAAGCCGGGCGAAGAGCAACAAGCGCCCAGCATCATGCTCAAGATACCCATCAAAGTTGGC
GAGAATAACAAATATGTCAACTTCATGCGGTTAGCCGAGGAACGATATGGCTGGGATGCTCTGCACCCTCGGCTT
GCTGCCATTCGGGATCGCAAGGCTCGGATTGCCGCTGCTGCCGCGTCTCTCAAAGCTGAGCTGGGCCGCGAATCA
GGCGATGAGATGTCTCTCGATCTTTCCGACGGCGAAGGCAGCAACCAGGAAAATGGTGGGACCAGCGGCGCTGAT
GCTCAAACAAAGCCCAAGAGGAAACGCAATTGCAAAGAGGACCAATACGACGTTGAGGACGATTTTGTTGATGAT
TCCGAGTTGCTGTGGGAAGCTCAGGCAGCTGCAAGTAGGGATGGCTTCTTCGTGTATTCAGGGCCCTTGGTGCCC
GAGGTTGAAAAGGCACCCACTGGGTATGTACTGCACTTGGTTGGCCATTGTTAGCCATGCTGGCGTGATGCTGAT
TCTTTGAATAGTCGAGAAGCACCCAAGCGTGGAAGAGGCAGCCGTGGAGGGCGCGGCAGCCGAGGAGCCACTAGA
GGCGGCGCAAATGGCCGGGGCGGCGGTCCTGGCTCGCGGGGCGGGAATGTCACGCGCAAGCCTCGCGTCACAAAG
TCGGAAAAGCTGCAGCGGGAGCGCGAAAAGGCGGAGCGGGAAAATCTCGCCCTCTTGTCCAAGACGCCCAGCAAC
AGCTATGCACTTCAACCCACGACGCCGTCTTTCTCAGTCAGTGAACTCGCCACTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail