Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|63
Gene name
LocationContig_10:35931..37936
Strand+
Gene length (bp)2005
Transcript length (bp)1941
Coding sequence length (bp)1941
Protein length (aa) 647

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04157 EAP30 EAP30/Vps36 family 5.1E-37 367 604
PF16988 Vps36-NZF-N Vacuolar protein sorting 36 NZF-N zinc-finger domain 4.0E-22 134 194
PF11605 Vps36_ESCRT-II Vacuolar protein sorting protein 36 Vps36 1.9E-21 9 94

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A5PK00|VPS36_BOVIN Vacuolar protein-sorting-associated protein 36 OS=Bos taurus GN=VPS36 PE=2 SV=1 307 619 2.0E-36
sp|Q06696|VPS36_YEAST Vacuolar protein-sorting-associated protein 36 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS36 PE=1 SV=1 6 615 2.0E-36
sp|P0C0A2|VPS36_RAT Vacuolar protein-sorting-associated protein 36 OS=Rattus norvegicus GN=Vps36 PE=1 SV=1 307 619 3.0E-36
sp|Q7ZVK4|VPS36_DANRE Vacuolar protein-sorting-associated protein 36 OS=Danio rerio GN=vps36 PE=2 SV=1 307 615 4.0E-36
sp|O43038|VPS36_SCHPO Vacuolar protein-sorting-associated protein 36 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps36 PE=3 SV=1 6 626 5.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A5PK00|VPS36_BOVIN Vacuolar protein-sorting-associated protein 36 OS=Bos taurus GN=VPS36 PE=2 SV=1 307 619 2.0E-36
sp|Q06696|VPS36_YEAST Vacuolar protein-sorting-associated protein 36 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS36 PE=1 SV=1 6 615 2.0E-36
sp|P0C0A2|VPS36_RAT Vacuolar protein-sorting-associated protein 36 OS=Rattus norvegicus GN=Vps36 PE=1 SV=1 307 619 3.0E-36
sp|Q7ZVK4|VPS36_DANRE Vacuolar protein-sorting-associated protein 36 OS=Danio rerio GN=vps36 PE=2 SV=1 307 615 4.0E-36
sp|O43038|VPS36_SCHPO Vacuolar protein-sorting-associated protein 36 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps36 PE=3 SV=1 6 626 5.0E-36
sp|Q6DDF4|VPS36_XENLA Vacuolar protein-sorting-associated protein 36 OS=Xenopus laevis GN=vps36 PE=2 SV=1 307 619 1.0E-35
sp|Q91XD6|VPS36_MOUSE Vacuolar protein-sorting-associated protein 36 OS=Mus musculus GN=Vps36 PE=1 SV=1 307 619 1.0E-35
sp|Q86VN1|VPS36_HUMAN Vacuolar protein-sorting-associated protein 36 OS=Homo sapiens GN=VPS36 PE=1 SV=1 307 619 1.0E-34
sp|Q9FF81|VPS36_ARATH Vacuolar protein sorting-associated protein 36 OS=Arabidopsis thaliana GN=VPS36 PE=1 SV=1 360 630 5.0E-29
sp|Q9VU87|VPS36_DROME Vacuolar protein-sorting-associated protein 36 OS=Drosophila melanogaster GN=Vps36 PE=2 SV=2 304 617 1.0E-24
sp|Q54T18|VPS36_DICDI Vacuolar protein-sorting-associated protein 36 OS=Dictyostelium discoideum GN=vps36 PE=3 SV=1 362 609 5.0E-24
[Show less]

GO

GO Term Description Terminal node
GO:0043130 ubiquitin binding Yes
GO:0032266 phosphatidylinositol-3-phosphate binding Yes
GO:0003674 molecular_function No
GO:0005515 protein binding No
GO:0008289 lipid binding No
GO:0005488 binding No
GO:0032182 ubiquitin-like protein binding No
GO:0005543 phospholipid binding No
GO:0035091 phosphatidylinositol binding No
GO:1901981 phosphatidylinositol phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|63
MLLKNLDLTTALRPSYLPDEVLLFVQDNVGLYQGKFKLPNHQMGQVYLTSHRICYVDQKKPRINSVALDLKDVER
YDFYAGFLKSSAKVTIVAKPLKRPGLHPRPLSNASSLSRPSSTSPAPLETGYTSPTDPSKATTATWVCNICTFSN
PVPANFEPSAANAHTPLPPCLTCGIKPTLSHVLKAAISHASNRSWYPQGPINTSSLPPPPPPQAPDATEQHARIG
HSSNPQPQSESIQNLDASFPCPKCTFSNHPSLLSCEICNTPLISRGVPSVGSAHAIRTQSPSPSIDDKTRVAQTS
LDVAESIKISFRGGGEKIFHERLKGAMTQRKWLLQNAPPAPQSIRRVRDGSSDAFSGSRSEGKAKAAGIAGLEQM
GISMHKNNEILIGSAFEDLETLMASAKDVIELAERFARQNGGGVSLEENTLLAESASQLGLVTTKDIVGGGGSNS
ESLYLSELSRNIAEFVTDDSRGVLKQAGGIITLVDLWAKFNVARGGVELISPTDFAKSVQLWESLKLPVRLRTFR
SGVMVVQASDRTDEATIRSLLSWLQDLHEFPPEHDVPWDWRTFGRGVTAHETAERFGWSIGVAEEELLMAEENGA
LCRQENIEGLKYWKNYIDTGDVSLPKHEGTLQQEALVKSLRDMGFL*
Coding >OphauG2|63
ATGTTGCTCAAGAATCTCGACCTGACCACTGCGCTGCGGCCGTCTTATCTTCCCGACGAAGTGCTTCTATTTGTT
CAAGACAATGTCGGTCTATATCAAGGCAAATTCAAGCTTCCAAACCATCAAATGGGCCAAGTTTACTTGACCTCC
CATCGCATATGCTATGTCGATCAAAAGAAGCCTCGCATCAACTCGGTAGCTCTAGATCTCAAAGATGTGGAGCGC
TACGACTTCTATGCCGGATTCCTCAAATCCTCGGCCAAAGTCACCATTGTCGCCAAGCCTCTAAAACGCCCTGGC
CTTCACCCTCGCCCTCTCTCCAACGCCTCTTCTCTCTCTCGGCCCTCCTCAACTTCTCCTGCTCCTCTAGAAACT
GGCTACACATCGCCAACAGACCCTTCTAAAGCCACCACTGCCACTTGGGTGTGCAATATTTGCACTTTCTCCAAT
CCGGTGCCCGCCAATTTCGAGCCTTCTGCTGCAAATGCACATACGCCTTTGCCTCCATGTCTAACATGCGGCATC
AAGCCAACCCTGTCCCACGTTCTCAAGGCTGCCATCAGCCATGCCAGCAACCGATCATGGTATCCCCAAGGCCCC
ATCAACACTTCATCTCTTCCACCACCACCACCACCACAAGCTCCCGACGCGACGGAACAGCATGCACGGATTGGC
CACTCCTCAAATCCCCAGCCTCAAAGCGAATCTATTCAAAACTTGGATGCCTCTTTTCCATGCCCCAAGTGTACC
TTCTCCAATCATCCATCACTATTGTCTTGCGAGATTTGCAACACCCCTTTAATATCTCGGGGAGTTCCTTCAGTC
GGCTCAGCTCACGCAATTCGAACTCAATCTCCCAGTCCGAGTATTGATGATAAAACCAGGGTGGCTCAGACTAGT
CTCGATGTTGCAGAAAGCATAAAGATTTCATTCCGTGGTGGCGGTGAAAAAATATTTCACGAGAGGTTAAAAGGC
GCCATGACACAACGCAAATGGCTACTTCAAAACGCGCCTCCAGCACCTCAAAGCATACGCAGAGTCAGGGATGGC
AGTTCAGATGCTTTTTCTGGCTCAAGATCTGAAGGCAAGGCAAAGGCTGCAGGAATCGCAGGCCTTGAACAAATG
GGCATAAGCATGCACAAGAACAACGAGATACTCATTGGCAGCGCGTTTGAAGACCTTGAGACATTAATGGCATCC
GCAAAAGATGTCATCGAACTAGCTGAACGATTTGCTCGTCAAAACGGGGGTGGCGTATCATTAGAAGAAAACACC
CTTTTGGCCGAGTCGGCTAGCCAACTCGGCCTCGTTACCACCAAGGATATTGTCGGAGGAGGTGGCAGCAATTCC
GAGTCACTGTACCTTTCGGAGCTCTCCCGTAACATTGCAGAGTTTGTCACTGACGACTCAAGAGGCGTTTTGAAA
CAAGCCGGAGGCATCATCACGCTGGTCGACCTATGGGCCAAGTTTAACGTCGCACGGGGCGGCGTCGAGCTTATT
AGCCCCACGGATTTCGCCAAGTCTGTTCAACTGTGGGAGAGTCTCAAGTTGCCAGTGCGGTTACGCACCTTTCGC
AGTGGTGTCATGGTGGTGCAGGCTAGCGACCGTACCGATGAGGCAACTATACGCTCCCTGCTTTCCTGGCTTCAG
GACTTGCACGAATTCCCCCCTGAGCACGACGTGCCTTGGGACTGGCGAACCTTTGGGCGTGGCGTTACGGCCCAT
GAAACAGCTGAGCGCTTTGGTTGGAGTATTGGCGTAGCTGAAGAAGAGCTGCTCATGGCAGAGGAAAATGGCGCG
CTGTGCCGCCAAGAGAATATTGAAGGTCTCAAGTATTGGAAGAATTACATTGATACGGGCGACGTGTCGCTGCCA
AAGCACGAGGGTACACTCCAGCAGGAGGCCCTTGTCAAATCACTTCGGGACATGGGATTTCTATAG
Transcript >OphauG2|63
ATGTTGCTCAAGAATCTCGACCTGACCACTGCGCTGCGGCCGTCTTATCTTCCCGACGAAGTGCTTCTATTTGTT
CAAGACAATGTCGGTCTATATCAAGGCAAATTCAAGCTTCCAAACCATCAAATGGGCCAAGTTTACTTGACCTCC
CATCGCATATGCTATGTCGATCAAAAGAAGCCTCGCATCAACTCGGTAGCTCTAGATCTCAAAGATGTGGAGCGC
TACGACTTCTATGCCGGATTCCTCAAATCCTCGGCCAAAGTCACCATTGTCGCCAAGCCTCTAAAACGCCCTGGC
CTTCACCCTCGCCCTCTCTCCAACGCCTCTTCTCTCTCTCGGCCCTCCTCAACTTCTCCTGCTCCTCTAGAAACT
GGCTACACATCGCCAACAGACCCTTCTAAAGCCACCACTGCCACTTGGGTGTGCAATATTTGCACTTTCTCCAAT
CCGGTGCCCGCCAATTTCGAGCCTTCTGCTGCAAATGCACATACGCCTTTGCCTCCATGTCTAACATGCGGCATC
AAGCCAACCCTGTCCCACGTTCTCAAGGCTGCCATCAGCCATGCCAGCAACCGATCATGGTATCCCCAAGGCCCC
ATCAACACTTCATCTCTTCCACCACCACCACCACCACAAGCTCCCGACGCGACGGAACAGCATGCACGGATTGGC
CACTCCTCAAATCCCCAGCCTCAAAGCGAATCTATTCAAAACTTGGATGCCTCTTTTCCATGCCCCAAGTGTACC
TTCTCCAATCATCCATCACTATTGTCTTGCGAGATTTGCAACACCCCTTTAATATCTCGGGGAGTTCCTTCAGTC
GGCTCAGCTCACGCAATTCGAACTCAATCTCCCAGTCCGAGTATTGATGATAAAACCAGGGTGGCTCAGACTAGT
CTCGATGTTGCAGAAAGCATAAAGATTTCATTCCGTGGTGGCGGTGAAAAAATATTTCACGAGAGGTTAAAAGGC
GCCATGACACAACGCAAATGGCTACTTCAAAACGCGCCTCCAGCACCTCAAAGCATACGCAGAGTCAGGGATGGC
AGTTCAGATGCTTTTTCTGGCTCAAGATCTGAAGGCAAGGCAAAGGCTGCAGGAATCGCAGGCCTTGAACAAATG
GGCATAAGCATGCACAAGAACAACGAGATACTCATTGGCAGCGCGTTTGAAGACCTTGAGACATTAATGGCATCC
GCAAAAGATGTCATCGAACTAGCTGAACGATTTGCTCGTCAAAACGGGGGTGGCGTATCATTAGAAGAAAACACC
CTTTTGGCCGAGTCGGCTAGCCAACTCGGCCTCGTTACCACCAAGGATATTGTCGGAGGAGGTGGCAGCAATTCC
GAGTCACTGTACCTTTCGGAGCTCTCCCGTAACATTGCAGAGTTTGTCACTGACGACTCAAGAGGCGTTTTGAAA
CAAGCCGGAGGCATCATCACGCTGGTCGACCTATGGGCCAAGTTTAACGTCGCACGGGGCGGCGTCGAGCTTATT
AGCCCCACGGATTTCGCCAAGTCTGTTCAACTGTGGGAGAGTCTCAAGTTGCCAGTGCGGTTACGCACCTTTCGC
AGTGGTGTCATGGTGGTGCAGGCTAGCGACCGTACCGATGAGGCAACTATACGCTCCCTGCTTTCCTGGCTTCAG
GACTTGCACGAATTCCCCCCTGAGCACGACGTGCCTTGGGACTGGCGAACCTTTGGGCGTGGCGTTACGGCCCAT
GAAACAGCTGAGCGCTTTGGTTGGAGTATTGGCGTAGCTGAAGAAGAGCTGCTCATGGCAGAGGAAAATGGCGCG
CTGTGCCGCCAAGAGAATATTGAAGGTCTCAAGTATTGGAAGAATTACATTGATACGGGCGACGTGTCGCTGCCA
AAGCACGAGGGTACACTCCAGCAGGAGGCCCTTGTCAAATCACTTCGGGACATGGGATTTCTATAG
Gene >OphauG2|63
ATGTTGCTCAAGAATCTCGACCTGACCACTGCGCTGCGGCCGTCTTATCTTCCCGACGAAGTGCTTCTATTTGTT
CAAGACAATGTCGGTCTATATCAAGGGTATCTTTTCCGCCCTTGGAATCACTGCCATCAAAGCCATGCTCCCGCT
AACTGTTGTCGACAGCAAATTCAAGCTTCCAAACCATCAAATGGGCCAAGTTTACTTGACCTCCCATCGCATATG
CTATGTCGATCAAAAGAAGCCTCGCATCAACTCGGTAGCTCTAGATCTCAAAGATGTGGAGCGCTACGACTTCTA
TGCCGGATTCCTCAAATCCTCGGCCAAAGTCACCATTGTCGCCAAGCCTCTAAAACGCCCTGGCCTTCACCCTCG
CCCTCTCTCCAACGCCTCTTCTCTCTCTCGGCCCTCCTCAACTTCTCCTGCTCCTCTAGAAACTGGCTACACATC
GCCAACAGACCCTTCTAAAGCCACCACTGCCACTTGGGTGTGCAATATTTGCACTTTCTCCAATCCGGTGCCCGC
CAATTTCGAGCCTTCTGCTGCAAATGCACATACGCCTTTGCCTCCATGTCTAACATGCGGCATCAAGCCAACCCT
GTCCCACGTTCTCAAGGCTGCCATCAGCCATGCCAGCAACCGATCATGGTATCCCCAAGGCCCCATCAACACTTC
ATCTCTTCCACCACCACCACCACCACAAGCTCCCGACGCGACGGAACAGCATGCACGGATTGGCCACTCCTCAAA
TCCCCAGCCTCAAAGCGAATCTATTCAAAACTTGGATGCCTCTTTTCCATGCCCCAAGTGTACCTTCTCCAATCA
TCCATCACTATTGTCTTGCGAGATTTGCAACACCCCTTTAATATCTCGGGGAGTTCCTTCAGTCGGCTCAGCTCA
CGCAATTCGAACTCAATCTCCCAGTCCGAGTATTGATGATAAAACCAGGGTGGCTCAGACTAGTCTCGATGTTGC
AGAAAGCATAAAGATTTCATTCCGTGGTGGCGGTGAAAAAATATTTCACGAGAGGTTAAAAGGCGCCATGACACA
ACGCAAATGGCTACTTCAAAACGCGCCTCCAGCACCTCAAAGCATACGCAGAGTCAGGGATGGCAGTTCAGATGC
TTTTTCTGGCTCAAGATCTGAAGGCAAGGCAAAGGCTGCAGGAATCGCAGGCCTTGAACAAATGGGCATAAGCAT
GCACAAGAACAACGAGATACTCATTGGCAGCGCGTTTGAAGACCTTGAGACATTAATGGCATCCGCAAAAGATGT
CATCGAACTAGCTGAACGATTTGCTCGTCAAAACGGGGGTGGCGTATCATTAGAAGAAAACACCCTTTTGGCCGA
GTCGGCTAGCCAACTCGGCCTCGTTACCACCAAGGATATTGTCGGAGGAGGTGGCAGCAATTCCGAGTCACTGTA
CCTTTCGGAGCTCTCCCGTAACATTGCAGAGTTTGTCACTGACGACTCAAGAGGCGTTTTGAAACAAGCCGGAGG
CATCATCACGCTGGTCGACCTATGGGCCAAGTTTAACGTCGCACGGGGCGGCGTCGAGCTTATTAGCCCCACGGA
TTTCGCCAAGTCTGTTCAACTGTGGGAGAGTCTCAAGTTGCCAGTGCGGTTACGCACCTTTCGCAGTGGTGTCAT
GGTGGTGCAGGCTAGCGACCGTACCGATGAGGCAACTATACGCTCCCTGCTTTCCTGGCTTCAGGACTTGCACGA
ATTCCCCCCTGAGCACGACGTGCCTTGGGACTGGCGAACCTTTGGGCGTGGCGTTACGGCCCATGAAACAGCTGA
GCGCTTTGGTTGGAGTATTGGCGTAGCTGAAGAAGAGCTGCTCATGGCAGAGGAAAATGGCGCGCTGTGCCGCCA
AGAGAATATTGAAGGTCTCAAGTATTGGAAGAATTACATTGATACGGGCGACGTGTCGCTGCCAAAGCACGAGGG
TACACTCCAGCAGGAGGCCCTTGTCAAATCACTTCGGGACATGGGATTTCTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail