Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6284
Gene name
LocationContig_633:6678..8445
Strand+
Gene length (bp)1767
Transcript length (bp)1584
Coding sequence length (bp)1584
Protein length (aa) 528

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13649 Methyltransf_25 Methyltransferase domain 6.7E-12 229 326
PF08241 Methyltransf_11 Methyltransferase domain 2.0E-10 230 329
PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA) 1.3E-10 225 300
PF13847 Methyltransf_31 Methyltransferase domain 1.2E-08 225 334
PF13489 Methyltransf_23 Methyltransferase domain 9.2E-07 223 329
PF05175 MTS Methyltransferase small domain 7.0E-06 225 298

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13648|ANM3_SCHPO Ribosomal protein arginine N-methyltransferase rmt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rmt3 PE=1 SV=3 6 517 1.0E-114
sp|O60678|ANM3_HUMAN Protein arginine N-methyltransferase 3 OS=Homo sapiens GN=PRMT3 PE=1 SV=3 2 507 8.0E-89
sp|O70467|ANM3_RAT Protein arginine N-methyltransferase 3 OS=Rattus norvegicus GN=Prmt3 PE=1 SV=1 13 507 7.0E-86
sp|Q9URX7|ANM1_SCHPO Protein arginine N-methyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rmt1 PE=1 SV=2 189 515 4.0E-83
sp|Q922H1|ANM3_MOUSE Protein arginine N-methyltransferase 3 OS=Mus musculus GN=Prmt3 PE=1 SV=2 13 507 7.0E-82
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13648|ANM3_SCHPO Ribosomal protein arginine N-methyltransferase rmt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rmt3 PE=1 SV=3 6 517 1.0E-114
sp|O60678|ANM3_HUMAN Protein arginine N-methyltransferase 3 OS=Homo sapiens GN=PRMT3 PE=1 SV=3 2 507 8.0E-89
sp|O70467|ANM3_RAT Protein arginine N-methyltransferase 3 OS=Rattus norvegicus GN=Prmt3 PE=1 SV=1 13 507 7.0E-86
sp|Q9URX7|ANM1_SCHPO Protein arginine N-methyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rmt1 PE=1 SV=2 189 515 4.0E-83
sp|Q922H1|ANM3_MOUSE Protein arginine N-methyltransferase 3 OS=Mus musculus GN=Prmt3 PE=1 SV=2 13 507 7.0E-82
sp|O82210|ANM12_ARATH Probable protein arginine N-methyltransferase 1.2 OS=Arabidopsis thaliana GN=PRMT12 PE=1 SV=1 186 526 3.0E-77
sp|Q9SU94|ANM11_ARATH Protein arginine N-methyltransferase 1.1 OS=Arabidopsis thaliana GN=PRMT11 PE=1 SV=1 172 517 2.0E-74
sp|P38074|HMT1_YEAST Protein arginine N-methyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HMT1 PE=1 SV=1 177 515 3.0E-74
sp|Q6VRB0|ANM1B_XENLA Protein arginine N-methyltransferase 1-B OS=Xenopus laevis GN=prmt1-b PE=2 SV=1 185 517 4.0E-74
sp|Q99873|ANM1_HUMAN Protein arginine N-methyltransferase 1 OS=Homo sapiens GN=PRMT1 PE=1 SV=2 177 517 5.0E-74
sp|Q28F07|ANM1_XENTR Protein arginine N-methyltransferase 1 OS=Xenopus tropicalis GN=prmt1 PE=2 SV=1 185 517 6.0E-74
sp|Q54EF2|ANM1_DICDI Protein arginine N-methyltransferase 1 OS=Dictyostelium discoideum GN=prmt1 PE=3 SV=1 175 517 9.0E-74
sp|Q6PAK3|ANM8_MOUSE Protein arginine N-methyltransferase 8 OS=Mus musculus GN=Prmt8 PE=1 SV=2 185 517 2.0E-73
sp|Q9NR22|ANM8_HUMAN Protein arginine N-methyltransferase 8 OS=Homo sapiens GN=PRMT8 PE=1 SV=2 185 517 2.0E-73
sp|Q0J2C6|ANM1_ORYSJ Probable protein arginine N-methyltransferase 1 OS=Oryza sativa subsp. japonica GN=PRMT1 PE=2 SV=1 184 517 3.0E-73
sp|Q8AV13|ANM1A_XENLA Protein arginine N-methyltransferase 1-A OS=Xenopus laevis GN=prmt1-a PE=1 SV=1 185 507 3.0E-73
sp|A2Z0C0|ANM1_ORYSI Probable protein arginine N-methyltransferase 1 OS=Oryza sativa subsp. indica GN=PRMT1 PE=3 SV=1 184 517 3.0E-73
sp|Q63009|ANM1_RAT Protein arginine N-methyltransferase 1 OS=Rattus norvegicus GN=Prmt1 PE=1 SV=1 177 517 3.0E-73
sp|Q9JIF0|ANM1_MOUSE Protein arginine N-methyltransferase 1 OS=Mus musculus GN=Prmt1 PE=1 SV=1 177 517 4.0E-73
sp|Q08A71|ANM6_ARATH Probable protein arginine N-methyltransferase 6 OS=Arabidopsis thaliana GN=PRMT6 PE=2 SV=1 187 517 6.0E-73
sp|Q5RGQ2|ANM8B_DANRE Protein arginine N-methyltransferase 8-B OS=Danio rerio GN=prmt8b PE=2 SV=2 185 526 8.0E-72
sp|A8IEF3|ANM1_CHLRE Protein arginine N-methyltransferase 1 OS=Chlamydomonas reinhardtii GN=PRMT1 PE=1 SV=1 186 517 1.0E-71
sp|Q75G68|ANM62_ORYSJ Probable protein arginine N-methyltransferase 6.2 OS=Oryza sativa subsp. japonica GN=PRMT6.2 PE=2 SV=1 187 509 6.0E-70
sp|A2Z8S0|ANM62_ORYSI Probable protein arginine N-methyltransferase 6.2 OS=Oryza sativa subsp. indica GN=PRMT6.2 PE=3 SV=2 187 509 6.0E-70
sp|Q7XKC0|ANM61_ORYSJ Probable protein arginine N-methyltransferase 6.1 OS=Oryza sativa subsp. japonica GN=PRMT6.1 PE=3 SV=2 187 517 1.0E-69
sp|Q0WVD6|ANM3_ARATH Probable protein arginine N-methyltransferase 3 OS=Arabidopsis thaliana GN=PRMT3 PE=2 SV=1 16 488 2.0E-69
sp|A2XYY8|ANM61_ORYSI Probable protein arginine N-methyltransferase 6.1 OS=Oryza sativa subsp. indica GN=PRMT6.1 PE=3 SV=1 187 515 3.0E-68
sp|A3BMN9|ANM3_ORYSJ Probable protein arginine N-methyltransferase 3 OS=Oryza sativa subsp. japonica GN=PRMT3 PE=2 SV=1 33 506 1.0E-67
sp|A2YP56|ANM3_ORYSI Probable protein arginine N-methyltransferase 3 OS=Oryza sativa subsp. indica GN=PRMT3 PE=3 SV=1 33 506 2.0E-67
sp|Q68EZ3|ANM6_XENLA Protein arginine N-methyltransferase 6 OS=Xenopus laevis GN=prmt6 PE=2 SV=1 181 523 9.0E-60
sp|B0JYW5|ANM6_XENTR Protein arginine N-methyltransferase 6 OS=Xenopus tropicalis GN=prmt6 PE=2 SV=1 181 523 6.0E-58
sp|Q6NWG4|ANM6_DANRE Protein arginine N-methyltransferase 6 OS=Danio rerio GN=prmt6 PE=2 SV=2 187 527 2.0E-57
sp|Q96LA8|ANM6_HUMAN Protein arginine N-methyltransferase 6 OS=Homo sapiens GN=PRMT6 PE=1 SV=1 187 507 6.0E-56
sp|Q6NZB1|ANM6_MOUSE Protein arginine N-methyltransferase 6 OS=Mus musculus GN=Prmt6 PE=1 SV=2 187 507 2.0E-54
sp|Q5E9L5|ANM6_BOVIN Protein arginine N-methyltransferase 6 OS=Bos taurus GN=PRMT6 PE=2 SV=1 187 507 3.0E-54
sp|P55345|ANM2_HUMAN Protein arginine N-methyltransferase 2 OS=Homo sapiens GN=PRMT2 PE=1 SV=1 164 515 6.0E-50
sp|Q9R144|ANM2_MOUSE Protein arginine N-methyltransferase 2 OS=Mus musculus GN=Prmt2 PE=1 SV=1 130 477 1.0E-49
sp|Q54HI0|ANM2_DICDI Protein arginine N-methyltransferase 2 OS=Dictyostelium discoideum GN=prmt2 PE=3 SV=1 187 430 3.0E-49
sp|B3DLB3|ANM2_XENTR Protein arginine N-methyltransferase 2 OS=Xenopus tropicalis GN=prmt2 PE=2 SV=1 187 517 9.0E-45
sp|Q9SNQ2|ANM10_ORYSJ Protein arginine N-methyltransferase PRMT10 OS=Oryza sativa subsp. japonica GN=PRMT10 PE=2 SV=1 190 515 1.0E-40
sp|A2Y953|ANM10_ORYSI Protein arginine N-methyltransferase PRMT10 OS=Oryza sativa subsp. indica GN=PRMT10 PE=3 SV=1 190 515 1.0E-40
sp|Q9MAT5|ANM10_ARATH Protein arginine N-methyltransferase PRMT10 OS=Arabidopsis thaliana GN=PRMT10 PE=1 SV=1 190 485 4.0E-40
sp|D9IVE5|ANM2_XENLA Protein arginine N-methyltransferase 2 OS=Xenopus laevis GN=prmt2 PE=1 SV=2 187 516 5.0E-40
sp|A3KPF2|ANM14_ARATH Probable histone-arginine methyltransferase 1.4 OS=Arabidopsis thaliana GN=PRMT14 PE=1 SV=1 181 517 2.0E-37
sp|Q84W92|ANM13_ARATH Probable histone-arginine methyltransferase 1.3 OS=Arabidopsis thaliana GN=PRMT13 PE=2 SV=3 181 517 4.0E-37
sp|Q7XI75|CARM1_ORYSJ Probable histone-arginine methyltransferase CARM1 OS=Oryza sativa subsp. japonica GN=CARM1 PE=2 SV=1 182 517 2.0E-36
sp|A2YPT7|CARM1_ORYSI Probable histone-arginine methyltransferase CARM1 OS=Oryza sativa subsp. indica GN=CARM1 PE=3 SV=2 182 517 2.0E-36
sp|B4GZ20|CARM1_DROPE Histone-arginine methyltransferase CARMER OS=Drosophila persimilis GN=Art4 PE=3 SV=1 179 471 1.0E-35
sp|Q29B63|CARM1_DROPS Histone-arginine methyltransferase CARMER OS=Drosophila pseudoobscura pseudoobscura GN=Art4 PE=3 SV=1 179 471 1.0E-35
sp|B4JXV2|CARM1_DROGR Histone-arginine methyltransferase CARMER OS=Drosophila grimshawi GN=Art4 PE=3 SV=1 179 471 2.0E-35
sp|B4PVH6|CARM1_DROYA Histone-arginine methyltransferase CARMER OS=Drosophila yakuba GN=Art4 PE=3 SV=1 179 471 5.0E-35
sp|B4NKI9|CARM1_DROWI Histone-arginine methyltransferase CARMER OS=Drosophila willistoni GN=Art4 PE=3 SV=1 179 471 7.0E-35
sp|Q6DC04|CARM1_DANRE Histone-arginine methyltransferase CARM1 OS=Danio rerio GN=carm1 PE=2 SV=1 181 478 7.0E-35
sp|B3P4N5|CARM1_DROER Histone-arginine methyltransferase CARMER OS=Drosophila erecta GN=Art4 PE=3 SV=1 179 471 8.0E-35
sp|B4HJC0|CARM1_DROSE Histone-arginine methyltransferase CARMER OS=Drosophila sechellia GN=Art4 PE=3 SV=1 179 471 8.0E-35
sp|Q9VH48|CARM1_DROME Probable histone-arginine methyltransferase CARMER OS=Drosophila melanogaster GN=Art4 PE=1 SV=1 179 471 8.0E-35
sp|B4QVW6|CARM1_DROSI Histone-arginine methyltransferase CARMER OS=Drosophila simulans GN=Art4 PE=3 SV=1 179 471 8.0E-35
sp|B4KA23|CARM1_DROMO Histone-arginine methyltransferase CARMER OS=Drosophila mojavensis GN=Art4 PE=3 SV=1 179 471 9.0E-35
sp|Q9WVG6|CARM1_MOUSE Histone-arginine methyltransferase CARM1 OS=Mus musculus GN=Carm1 PE=1 SV=2 160 471 1.0E-34
sp|B3M1E1|CARM1_DROAN Histone-arginine methyltransferase CARMER OS=Drosophila ananassae GN=Art4 PE=3 SV=1 179 471 1.0E-34
sp|Q86X55|CARM1_HUMAN Histone-arginine methyltransferase CARM1 OS=Homo sapiens GN=CARM1 PE=1 SV=3 160 471 1.0E-34
sp|B4LVS8|CARM1_DROVI Histone-arginine methyltransferase CARMER OS=Drosophila virilis GN=Art4 PE=3 SV=1 179 471 1.0E-34
sp|Q4AE70|CARM1_RAT Histone-arginine methyltransferase CARM1 OS=Rattus norvegicus GN=Carm1 PE=1 SV=1 160 471 2.0E-34
sp|Q5XK84|CARM1_XENLA Histone-arginine methyltransferase CARM1 OS=Xenopus laevis GN=carm1 PE=2 SV=1 174 485 3.0E-34
sp|B0W3L6|CARM1_CULQU Histone-arginine methyltransferase CARMER OS=Culex quinquefasciatus GN=Art4 PE=3 SV=1 150 505 6.0E-34
sp|Q174R2|CARM1_AEDAE Histone-arginine methyltransferase CARMER OS=Aedes aegypti GN=CARM1 PE=3 SV=1 181 505 3.0E-33
sp|Q7Q2B7|CARM1_ANOGA Histone-arginine methyltransferase CARMER OS=Anopheles gambiae GN=CARM1 PE=1 SV=5 181 505 4.0E-33
sp|Q582G4|ANM7_TRYB2 Protein arginine N-methyltransferase 7 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=PRMT7 PE=1 SV=1 195 364 1.0E-16
sp|B8I303|PRMA_CLOCE Ribosomal protein L11 methyltransferase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=prmA PE=3 SV=1 220 332 7.0E-09
sp|A0JMU5|ANM9_XENLA Putative protein arginine N-methyltransferase 9 OS=Xenopus laevis GN=prmt9 PE=2 SV=1 184 335 2.0E-08
sp|C3L3G5|PRMA_CLOB6 Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=prmA PE=3 SV=1 221 350 3.0E-08
sp|Q9XW42|ANM7_CAEEL Protein arginine N-methyltransferase 7 OS=Caenorhabditis elegans GN=prmt-7 PE=1 SV=2 164 340 5.0E-08
sp|B4JWL5|ANM7_DROGR Protein arginine N-methyltransferase 7 OS=Drosophila grimshawi GN=Art7 PE=3 SV=1 183 334 2.0E-07
sp|Q5U4E8|ANM7_RAT Protein arginine N-methyltransferase 7 OS=Rattus norvegicus GN=Prmt7 PE=2 SV=1 184 402 3.0E-07
sp|Q665E3|PRMA_YERPS Ribosomal protein L11 methyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=prmA PE=3 SV=2 224 350 5.0E-07
sp|B2K467|PRMA_YERPB Ribosomal protein L11 methyltransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=prmA PE=3 SV=1 224 350 5.0E-07
sp|A6TSL8|PRMA_ALKMQ Ribosomal protein L11 methyltransferase OS=Alkaliphilus metalliredigens (strain QYMF) GN=prmA PE=3 SV=1 229 335 6.0E-07
sp|B4GA28|ANM7_DROPE Protein arginine N-methyltransferase 7 OS=Drosophila persimilis GN=Art7 PE=3 SV=1 183 333 6.0E-07
sp|B5DZN7|ANM7_DROPS Protein arginine N-methyltransferase 7 OS=Drosophila pseudoobscura pseudoobscura GN=Art7 PE=3 SV=1 183 333 6.0E-07
sp|B3MF31|ANM7_DROAN Protein arginine N-methyltransferase 7 OS=Drosophila ananassae GN=Art7 PE=3 SV=1 183 333 7.0E-07
sp|Q0AWM5|PRMA_SYNWW Ribosomal protein L11 methyltransferase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=prmA PE=3 SV=1 229 287 9.0E-07
sp|B1KZN5|PRMA_CLOBM Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=prmA PE=3 SV=1 221 350 1.0E-06
sp|B1JKF2|PRMA_YERPY Ribosomal protein L11 methyltransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=prmA PE=3 SV=1 224 350 2.0E-06
sp|A2AV36|ANM7_DANRE Protein arginine N-methyltransferase 7 OS=Danio rerio GN=prmt7 PE=2 SV=1 184 343 2.0E-06
sp|A3DF23|PRMA_CLOTH Ribosomal protein L11 methyltransferase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=prmA PE=3 SV=1 229 332 2.0E-06
sp|A7FXL3|PRMA_CLOB1 Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=prmA PE=3 SV=1 221 350 2.0E-06
sp|A5I638|PRMA_CLOBH Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=prmA PE=3 SV=1 221 350 2.0E-06
sp|C1FVT8|PRMA_CLOBJ Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=prmA PE=3 SV=1 221 350 2.0E-06
sp|A6LRN8|PRMA_CLOB8 Ribosomal protein L11 methyltransferase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=prmA PE=3 SV=1 220 366 2.0E-06
sp|A7FDQ3|PRMA_YERP3 Ribosomal protein L11 methyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=prmA PE=3 SV=1 224 350 2.0E-06
sp|Q8ZAX6|PRMA_YERPE Ribosomal protein L11 methyltransferase OS=Yersinia pestis GN=prmA PE=3 SV=1 224 350 2.0E-06
sp|Q6P2P2|ANM9_HUMAN Putative protein arginine N-methyltransferase 9 OS=Homo sapiens GN=PRMT9 PE=2 SV=1 184 322 2.0E-06
sp|B1ILM1|PRMA_CLOBK Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain Okra / Type B1) GN=prmA PE=3 SV=1 221 350 2.0E-06
sp|A7GHH4|PRMA_CLOBL Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=prmA PE=3 SV=1 221 350 2.0E-06
sp|A9B5V4|PRMA_HERA2 Ribosomal protein L11 methyltransferase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=prmA PE=3 SV=1 224 303 3.0E-06
sp|B4KSL6|ANM7_DROMO Protein arginine N-methyltransferase 7 OS=Drosophila mojavensis GN=Art7 PE=3 SV=1 184 334 4.0E-06
sp|Q6PCI6|ANM7_XENLA Protein arginine N-methyltransferase 7 OS=Xenopus laevis GN=prmt7 PE=2 SV=1 184 335 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6284
MAIDSSDTDPSCSSDSDQSEWLDMEPDDEPTTFISLLDSRAFTTLDSMLAYCKQRHGFDLVGEIERLRLDYIGGI
KLVNFIRRRVKQGEALPREIAQTDLDSTELLQPVLENDTVLFSLEDAVDFERHAENDPEDGGAQTRNRQLEAELE
RLETAFADYRVCVQKTLDRKWGDEQDADAAKKHEASDSYYFESYAAHEIHETMLKDRVRTDAYRDFIYGNKHLFK
DKVVLDIGCGTGILSMFCAKAGASRVIAVDKSDIIDKARENIFNNGLSSTITCLRGAIEDVQLPVAKVDIIVSEW
MGYCLLYEAMLPSVLFARDKYLKPDGLLVPSAATLVLAPVHDDDYVVDTVTYWRDVYGFDMKAMQQGIYDDARIH
AMSSDSVCGSAAVFKTLNLHHVQPQDLVFTAKWESSLDRPVDQIHGFLIWFDCFFSTSRDDATPDASQTPVAWRA
QKPGRVVMTTSPYATETHWKQGLLLVEAQPTVSQAPASSRIVGQITLSVPASNARSLGLEASWSMAGCDRRHKWK
LS*
Coding >OphauG2|6284
ATGGCCATTGACAGCAGCGACACAGACCCGTCTTGTAGCTCCGACTCGGACCAGAGCGAGTGGCTAGACATGGAG
CCAGATGACGAACCAACGACATTTATATCGCTGCTCGACTCGCGGGCCTTTACTACGCTTGACTCGATGCTGGCA
TATTGCAAGCAGCGCCACGGCTTCGACTTGGTAGGCGAGATTGAGCGCCTGCGCCTCGACTACATTGGCGGCATC
AAGCTAGTCAACTTTATTCGCAGGCGCGTCAAGCAAGGCGAGGCGCTTCCAAGGGAGATTGCACAGACGGACCTC
GACTCGACGGAGCTGCTGCAGCCGGTGCTGGAAAACGACACCGTCTTGTTTTCGCTAGAAGACGCCGTCGACTTT
GAGCGCCACGCAGAGAATGACCCAGAGGATGGGGGTGCGCAGACGCGTAATCGCCAGCTCGAGGCTGAGCTGGAG
CGTCTCGAGACTGCGTTTGCAGACTATCGCGTCTGCGTGCAAAAGACGCTTGATAGGAAATGGGGCGACGAGCAA
GACGCAGACGCGGCCAAGAAGCACGAGGCGTCGGATTCATATTACTTTGAATCATATGCCGCTCATGAGATTCAC
GAGACGATGCTCAAGGACCGTGTGCGGACAGATGCCTACCGAGACTTTATTTACGGAAACAAGCACCTCTTCAAA
GACAAGGTAGTCCTTGATATTGGCTGTGGCACAGGCATTCTCAGCATGTTTTGCGCAAAGGCTGGCGCGTCAAGA
GTAATTGCAGTCGACAAGTCTGACATTATCGACAAGGCGCGAGAAAACATCTTCAACAACGGCCTGTCAAGCACC
ATTACCTGTCTCCGGGGTGCCATTGAAGACGTCCAGCTGCCCGTGGCCAAGGTTGATATCATTGTCAGCGAGTGG
ATGGGTTACTGCCTTCTCTACGAGGCAATGCTTCCCAGTGTCCTTTTTGCCCGCGACAAGTATCTCAAGCCCGAC
GGCTTGCTTGTGCCCAGTGCCGCGACGCTTGTCTTGGCCCCCGTCCACGACGACGACTACGTAGTTGACACCGTC
ACCTACTGGCGAGACGTCTATGGCTTCGACATGAAGGCCATGCAGCAGGGCATCTACGACGATGCGCGCATCCAC
GCTATGTCCTCTGACTCAGTTTGCGGCTCAGCCGCCGTCTTCAAAACTCTCAACCTGCATCACGTGCAGCCTCAA
GACTTGGTCTTTACAGCAAAGTGGGAATCGAGCCTCGATAGGCCCGTCGACCAAATCCACGGTTTCCTCATTTGG
TTCGACTGCTTCTTCTCCACGTCACGCGATGATGCAACACCCGACGCGTCTCAGACGCCAGTGGCATGGCGTGCG
CAAAAACCGGGCCGTGTGGTCATGACGACGAGCCCATATGCCACCGAGACACACTGGAAGCAGGGCCTCTTGCTT
GTAGAGGCACAGCCCACAGTGTCTCAGGCGCCCGCGTCGAGCCGCATCGTTGGGCAAATCACACTGTCAGTCCCC
GCGTCCAATGCGCGGTCCCTTGGCCTTGAGGCCTCGTGGTCCATGGCGGGCTGTGACAGACGCCATAAGTGGAAG
CTTAGTTGA
Transcript >OphauG2|6284
ATGGCCATTGACAGCAGCGACACAGACCCGTCTTGTAGCTCCGACTCGGACCAGAGCGAGTGGCTAGACATGGAG
CCAGATGACGAACCAACGACATTTATATCGCTGCTCGACTCGCGGGCCTTTACTACGCTTGACTCGATGCTGGCA
TATTGCAAGCAGCGCCACGGCTTCGACTTGGTAGGCGAGATTGAGCGCCTGCGCCTCGACTACATTGGCGGCATC
AAGCTAGTCAACTTTATTCGCAGGCGCGTCAAGCAAGGCGAGGCGCTTCCAAGGGAGATTGCACAGACGGACCTC
GACTCGACGGAGCTGCTGCAGCCGGTGCTGGAAAACGACACCGTCTTGTTTTCGCTAGAAGACGCCGTCGACTTT
GAGCGCCACGCAGAGAATGACCCAGAGGATGGGGGTGCGCAGACGCGTAATCGCCAGCTCGAGGCTGAGCTGGAG
CGTCTCGAGACTGCGTTTGCAGACTATCGCGTCTGCGTGCAAAAGACGCTTGATAGGAAATGGGGCGACGAGCAA
GACGCAGACGCGGCCAAGAAGCACGAGGCGTCGGATTCATATTACTTTGAATCATATGCCGCTCATGAGATTCAC
GAGACGATGCTCAAGGACCGTGTGCGGACAGATGCCTACCGAGACTTTATTTACGGAAACAAGCACCTCTTCAAA
GACAAGGTAGTCCTTGATATTGGCTGTGGCACAGGCATTCTCAGCATGTTTTGCGCAAAGGCTGGCGCGTCAAGA
GTAATTGCAGTCGACAAGTCTGACATTATCGACAAGGCGCGAGAAAACATCTTCAACAACGGCCTGTCAAGCACC
ATTACCTGTCTCCGGGGTGCCATTGAAGACGTCCAGCTGCCCGTGGCCAAGGTTGATATCATTGTCAGCGAGTGG
ATGGGTTACTGCCTTCTCTACGAGGCAATGCTTCCCAGTGTCCTTTTTGCCCGCGACAAGTATCTCAAGCCCGAC
GGCTTGCTTGTGCCCAGTGCCGCGACGCTTGTCTTGGCCCCCGTCCACGACGACGACTACGTAGTTGACACCGTC
ACCTACTGGCGAGACGTCTATGGCTTCGACATGAAGGCCATGCAGCAGGGCATCTACGACGATGCGCGCATCCAC
GCTATGTCCTCTGACTCAGTTTGCGGCTCAGCCGCCGTCTTCAAAACTCTCAACCTGCATCACGTGCAGCCTCAA
GACTTGGTCTTTACAGCAAAGTGGGAATCGAGCCTCGATAGGCCCGTCGACCAAATCCACGGTTTCCTCATTTGG
TTCGACTGCTTCTTCTCCACGTCACGCGATGATGCAACACCCGACGCGTCTCAGACGCCAGTGGCATGGCGTGCG
CAAAAACCGGGCCGTGTGGTCATGACGACGAGCCCATATGCCACCGAGACACACTGGAAGCAGGGCCTCTTGCTT
GTAGAGGCACAGCCCACAGTGTCTCAGGCGCCCGCGTCGAGCCGCATCGTTGGGCAAATCACACTGTCAGTCCCC
GCGTCCAATGCGCGGTCCCTTGGCCTTGAGGCCTCGTGGTCCATGGCGGGCTGTGACAGACGCCATAAGTGGAAG
CTTAGTTGA
Gene >OphauG2|6284
ATGGCCATTGACAGCAGCGACACAGACCCGTCTTGTAGCTCCGACTCGGACCAGAGCGAGTGGCTAGACATGGAG
CCAGATGACGAACCAACGACATTTATATCGCTGCTCGACTCGCGGGCCTTTACTACGCTTGACTCGATGCTGGCA
TATTGCAAGCAGCGCCACGGCTTCGACTTGGTAGGCGAGATTGAGCGCCTGCGCCTCGACTACATTGGCGGCATC
AAGCTAGTCAACTTTATTCGCAGGCGCGTCAAGCAAGGCGAGGCGCTTCCAAGGGAGATTGCACAGACGGACCTC
GACTCGACGGAGCTGCTGCAGCCGGTGCTGGAAAACGACACCGTCTTGTTTTCGCTAGAAGACGCCGTCGACTTT
GAGCGCCACGCAGAGAATGACCCAGAGGATGGGGGTGCGCAGACGCGTAATCGCCAGCTCGAGGCTGAGCTGGAG
CGTCTCGAGACTGCGTTTGCAGACTATCGCGTCTGCGTGCAAAAGACGCTTGATAGGAAATGGGGCGACGAGCAA
GACGCAGACGCGGCCAAGAAGCACGAGGCGTCGGATTCATATTACTTTGAATCATATGCCGCTCATGGTATGCTG
CGCCGCTTTGCATTACATGGCTGCCCGACTCGCGGAAAGAAGAGAAAAAAAAATAATGCTAGACAACTGACACGG
GCGTGCTAGAGATTCACGAGACGATGCTCAAGGACCGTGTGCGGACAGATGCCTACCGAGACTTTATTTACGGAA
ACAAGCACCTCTTCAAAGACAAGGTAGTCCTTGATATTGGCTGTGGCACAGGTGAGAGGAACAAGAGGAACAAGA
AACATCAAGCCCCTTTCTCCATCTGTCTCCTGCTACACAAGCCAAGCTAAGACTGTGCCACCAACAGGCATTCTC
AGCATGTTTTGCGCAAAGGCTGGCGCGTCAAGAGTAATTGCAGTCGACAAGTCTGACATTATCGACAAGGCGCGA
GAAAACATCTTCAACAACGGCCTGTCAAGCACCATTACCTGTCTCCGGGGTGCCATTGAAGACGTCCAGCTGCCC
GTGGCCAAGGTTGATATCATTGTCAGCGAGTGGATGGGTTACTGCCTTCTCTACGAGGCAATGCTTCCCAGTGTC
CTTTTTGCCCGCGACAAGTATCTCAAGCCCGACGGCTTGCTTGTGCCCAGTGCCGCGACGCTTGTCTTGGCCCCC
GTCCACGACGACGACTACGTAGTTGACACCGTCACCTACTGGCGAGACGTCTATGGCTTCGACATGAAGGCCATG
CAGCAGGGCATCTACGACGATGCGCGCATCCACGCTATGTCCTCTGACTCAGTTTGCGGCTCAGCCGCCGTCTTC
AAAACTCTCAACCTGCATCACGTGCAGCCTCAAGACTTGGTCTTTACAGCAAAGTGGGAATCGAGCCTCGATAGG
CCCGTCGACCAAATCCACGGTTTCCTCATTTGGTTCGACTGCTTCTTCTCCACGTCACGCGATGATGCAACACCC
GACGCGTCTCAGACGCCAGTGGCATGGCGTGCGCAAAAACCGGGCCGTGTGGTCATGACGACGAGCCCATATGCC
ACCGAGACACACTGGAAGCAGGGCCTCTTGCTTGTAGAGGCACAGCCCACAGTGTCTCAGGCGCCCGCGTCGAGC
CGCATCGTTGGGCAAATCACACTGTCAGTCCCCGCGTCCAATGCGCGGTCCCTTGGCCTTGAGGCCTCGTGGTCC
ATGGCGGGCTGTGACAGACGCCATAAGTGGAAGCTTAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail