Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6275
Gene name
LocationContig_631:3381..5402
Strand+
Gene length (bp)2021
Transcript length (bp)1959
Coding sequence length (bp)1959
Protein length (aa) 653

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18826 bVLRF1 Bacteroidetes VLRF1 release factor 3.2E-62 245 401

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74977|VMS1_SCHPO VMS1 homolog C1827.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.04 PE=1 SV=1 15 647 1.0E-102
sp|Q04311|VMS1_YEAST Protein VMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMS1 PE=1 SV=1 8 646 1.0E-77
sp|Q9H8Y5|ANKZ1_HUMAN Ankyrin repeat and zinc finger domain-containing protein 1 OS=Homo sapiens GN=ANKZF1 PE=1 SV=1 66 438 2.0E-32
sp|Q66H85|ANKZ1_RAT Ankyrin repeat and zinc finger domain-containing protein 1 OS=Rattus norvegicus GN=Ankzf1 PE=2 SV=1 66 438 4.0E-30
sp|Q80UU1|ANKZ1_MOUSE Ankyrin repeat and zinc finger domain-containing protein 1 OS=Mus musculus GN=Ankzf1 PE=1 SV=2 66 404 6.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74977|VMS1_SCHPO VMS1 homolog C1827.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.04 PE=1 SV=1 15 647 1.0E-102
sp|Q04311|VMS1_YEAST Protein VMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMS1 PE=1 SV=1 8 646 1.0E-77
sp|Q9H8Y5|ANKZ1_HUMAN Ankyrin repeat and zinc finger domain-containing protein 1 OS=Homo sapiens GN=ANKZF1 PE=1 SV=1 66 438 2.0E-32
sp|Q66H85|ANKZ1_RAT Ankyrin repeat and zinc finger domain-containing protein 1 OS=Rattus norvegicus GN=Ankzf1 PE=2 SV=1 66 438 4.0E-30
sp|Q80UU1|ANKZ1_MOUSE Ankyrin repeat and zinc finger domain-containing protein 1 OS=Mus musculus GN=Ankzf1 PE=1 SV=2 66 404 6.0E-24
sp|P34511|VMS1_CAEEL Protein vms-1 OS=Caenorhabditis elegans GN=vms-1 PE=2 SV=2 245 421 8.0E-21
sp|Q58CQ5|ANKZ1_BOVIN Ankyrin repeat and zinc finger domain-containing protein 1 OS=Bos taurus GN=ANKZF1 PE=2 SV=2 241 438 4.0E-16
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6275
MAAADQELLQRPLYVYNLPDQILESLSLKTDAEPTPSAHQDPVHPSLSQNVSAVPAVDGVVISQSCALCSLTFAT
VQEQRNHIKSDLHRYNLKQKLRGLHPVSEVDFERLIIDLDESLSGSDSSGSDEDDDDNDDRQESTLTALLKRQAR
VAGKGQDVSNHDLDDEKSVGRFQNRGNPPLVWLSSSFLPENTYFGLYRAILTSEEQKTTDFVGVLRRKQVEPIPG
PKTGKDGQPPLTTYKGPHIFLCMIGGGHFAAMVVSLAPRMGKGPTAMNREAIVLAHKTFHRYTTRRKQGGAQSSN
DSSKGNAHSAGSSLRRYNEQALVVDVRTLLQDWKALLDSSELLFVRATGSTNRRTLFGPYDGQVLQNNDTRLRGF
PFSTKRATQKELMRCFIELTRLKMQEFEPEKRASHEASLTPEKKIASSKTVKTKLSEEEETALLHTSQLQAFVRR
SKLPALLSYLEKSAISPDFEFYPREQNHHTPRLLHLAAAQCSAPLVLGLLVRAGANPLLGNGDGKVAFELAGDRS
TRDAFRVARSELGEDKWAWNKAKVPTAMTKVEADDRWKRERDDAEKIESERRKAEEERLRSQGPSLDSFADKPKA
KGNTLAASLSKTPQERREEEARGLTPEMRKRLERERRARAAEERMRSLRGSG*
Coding >OphauG2|6275
ATGGCGGCCGCCGACCAAGAGTTACTTCAGCGACCACTCTATGTATACAACTTGCCAGACCAAATATTGGAGAGC
TTATCACTCAAAACTGATGCCGAGCCCACTCCAAGTGCACATCAGGATCCAGTCCACCCATCACTCTCTCAAAAT
GTCTCAGCTGTTCCCGCCGTGGATGGCGTGGTGATATCACAATCTTGTGCTCTTTGCAGCTTGACCTTTGCTACG
GTTCAGGAGCAAAGGAACCACATCAAGTCAGACTTGCACCGCTATAATCTCAAACAAAAGCTTCGGGGTCTCCAC
CCTGTCTCTGAAGTAGACTTCGAGAGGCTCATCATAGACTTGGATGAATCTTTGTCCGGATCTGACTCGAGTGGT
TCTGATGAGGACGACGACGACAATGATGACCGACAAGAGTCAACCCTAACAGCTCTATTGAAGCGTCAAGCTCGG
GTGGCAGGAAAGGGTCAAGATGTCTCCAATCATGATCTGGACGACGAGAAAAGTGTTGGCAGATTTCAAAATCGG
GGCAACCCACCCCTCGTATGGCTCAGCTCCTCTTTCCTCCCGGAAAACACATATTTTGGCCTCTATCGCGCAATC
CTGACATCCGAAGAGCAAAAAACAACAGACTTTGTCGGCGTATTGAGAAGGAAGCAAGTTGAGCCCATTCCAGGC
CCCAAAACCGGCAAAGACGGCCAACCTCCGTTGACAACCTACAAGGGGCCGCACATTTTTCTTTGCATGATTGGC
GGTGGCCACTTCGCTGCCATGGTTGTATCTCTTGCGCCTCGAATGGGAAAAGGGCCAACTGCCATGAATCGGGAG
GCCATTGTACTGGCACACAAGACCTTTCATCGCTACACGACAAGACGGAAACAAGGCGGTGCTCAGTCGTCCAAC
GACAGCTCCAAAGGAAATGCTCATTCAGCTGGTTCCAGCCTGCGTCGATATAATGAGCAGGCCCTAGTGGTTGAT
GTCAGAACGTTGCTTCAGGACTGGAAGGCCTTGCTGGATTCATCGGAGCTTCTTTTTGTGCGAGCAACCGGGTCC
ACAAACAGAAGGACTTTGTTTGGACCATATGATGGACAGGTGCTGCAGAATAATGATACACGCCTGCGAGGATTT
CCGTTTAGTACCAAGCGTGCCACACAGAAAGAGCTGATGCGATGTTTTATTGAACTGACTCGCCTCAAGATGCAA
GAGTTTGAACCGGAGAAGAGGGCTTCGCATGAAGCATCGTTGACCCCAGAAAAAAAGATTGCAAGCTCCAAAACA
GTCAAAACAAAGCTCTCAGAGGAGGAAGAGACGGCGCTTTTACACACCTCACAACTTCAAGCCTTTGTCCGACGG
TCAAAACTACCAGCACTGCTCTCTTATCTTGAAAAGAGTGCCATCAGCCCTGATTTTGAATTTTATCCTCGAGAG
CAAAATCATCACACCCCTCGTCTACTTCATCTTGCCGCGGCCCAGTGCTCCGCGCCACTAGTCCTTGGGCTCTTG
GTCCGAGCTGGAGCCAATCCGCTTCTAGGCAATGGCGATGGTAAGGTGGCTTTTGAACTGGCTGGAGATCGCTCG
ACCCGCGATGCTTTTCGTGTTGCCCGCTCGGAGCTTGGAGAGGACAAGTGGGCCTGGAATAAAGCAAAAGTCCCT
ACAGCAATGACCAAAGTCGAGGCAGACGATAGATGGAAGCGGGAGAGAGACGATGCGGAGAAGATAGAGTCTGAG
AGGCGCAAAGCCGAAGAAGAACGATTACGCTCGCAAGGGCCATCCTTGGACTCTTTTGCAGATAAGCCCAAGGCA
AAGGGCAACACTCTAGCGGCATCGCTTTCGAAAACGCCACAGGAAAGGCGTGAAGAGGAGGCTCGTGGCCTAACG
CCGGAAATGAGGAAGCGACTGGAGCGTGAGAGGAGAGCTCGAGCTGCTGAGGAACGAATGCGAAGTCTGAGAGGC
AGCGGATAA
Transcript >OphauG2|6275
ATGGCGGCCGCCGACCAAGAGTTACTTCAGCGACCACTCTATGTATACAACTTGCCAGACCAAATATTGGAGAGC
TTATCACTCAAAACTGATGCCGAGCCCACTCCAAGTGCACATCAGGATCCAGTCCACCCATCACTCTCTCAAAAT
GTCTCAGCTGTTCCCGCCGTGGATGGCGTGGTGATATCACAATCTTGTGCTCTTTGCAGCTTGACCTTTGCTACG
GTTCAGGAGCAAAGGAACCACATCAAGTCAGACTTGCACCGCTATAATCTCAAACAAAAGCTTCGGGGTCTCCAC
CCTGTCTCTGAAGTAGACTTCGAGAGGCTCATCATAGACTTGGATGAATCTTTGTCCGGATCTGACTCGAGTGGT
TCTGATGAGGACGACGACGACAATGATGACCGACAAGAGTCAACCCTAACAGCTCTATTGAAGCGTCAAGCTCGG
GTGGCAGGAAAGGGTCAAGATGTCTCCAATCATGATCTGGACGACGAGAAAAGTGTTGGCAGATTTCAAAATCGG
GGCAACCCACCCCTCGTATGGCTCAGCTCCTCTTTCCTCCCGGAAAACACATATTTTGGCCTCTATCGCGCAATC
CTGACATCCGAAGAGCAAAAAACAACAGACTTTGTCGGCGTATTGAGAAGGAAGCAAGTTGAGCCCATTCCAGGC
CCCAAAACCGGCAAAGACGGCCAACCTCCGTTGACAACCTACAAGGGGCCGCACATTTTTCTTTGCATGATTGGC
GGTGGCCACTTCGCTGCCATGGTTGTATCTCTTGCGCCTCGAATGGGAAAAGGGCCAACTGCCATGAATCGGGAG
GCCATTGTACTGGCACACAAGACCTTTCATCGCTACACGACAAGACGGAAACAAGGCGGTGCTCAGTCGTCCAAC
GACAGCTCCAAAGGAAATGCTCATTCAGCTGGTTCCAGCCTGCGTCGATATAATGAGCAGGCCCTAGTGGTTGAT
GTCAGAACGTTGCTTCAGGACTGGAAGGCCTTGCTGGATTCATCGGAGCTTCTTTTTGTGCGAGCAACCGGGTCC
ACAAACAGAAGGACTTTGTTTGGACCATATGATGGACAGGTGCTGCAGAATAATGATACACGCCTGCGAGGATTT
CCGTTTAGTACCAAGCGTGCCACACAGAAAGAGCTGATGCGATGTTTTATTGAACTGACTCGCCTCAAGATGCAA
GAGTTTGAACCGGAGAAGAGGGCTTCGCATGAAGCATCGTTGACCCCAGAAAAAAAGATTGCAAGCTCCAAAACA
GTCAAAACAAAGCTCTCAGAGGAGGAAGAGACGGCGCTTTTACACACCTCACAACTTCAAGCCTTTGTCCGACGG
TCAAAACTACCAGCACTGCTCTCTTATCTTGAAAAGAGTGCCATCAGCCCTGATTTTGAATTTTATCCTCGAGAG
CAAAATCATCACACCCCTCGTCTACTTCATCTTGCCGCGGCCCAGTGCTCCGCGCCACTAGTCCTTGGGCTCTTG
GTCCGAGCTGGAGCCAATCCGCTTCTAGGCAATGGCGATGGTAAGGTGGCTTTTGAACTGGCTGGAGATCGCTCG
ACCCGCGATGCTTTTCGTGTTGCCCGCTCGGAGCTTGGAGAGGACAAGTGGGCCTGGAATAAAGCAAAAGTCCCT
ACAGCAATGACCAAAGTCGAGGCAGACGATAGATGGAAGCGGGAGAGAGACGATGCGGAGAAGATAGAGTCTGAG
AGGCGCAAAGCCGAAGAAGAACGATTACGCTCGCAAGGGCCATCCTTGGACTCTTTTGCAGATAAGCCCAAGGCA
AAGGGCAACACTCTAGCGGCATCGCTTTCGAAAACGCCACAGGAAAGGCGTGAAGAGGAGGCTCGTGGCCTAACG
CCGGAAATGAGGAAGCGACTGGAGCGTGAGAGGAGAGCTCGAGCTGCTGAGGAACGAATGCGAAGTCTGAGAGGC
AGCGGATAA
Gene >OphauG2|6275
ATGGCGGCCGCCGACCAAGAGTTACTTCAGCGACCACTCTATGGTGCGTGGGGAACAACATCTAGACAAATCTTG
TCATGATACTGACAATGTCTCGCCATTTAGTATACAACTTGCCAGACCAAATATTGGAGAGCTTATCACTCAAAA
CTGATGCCGAGCCCACTCCAAGTGCACATCAGGATCCAGTCCACCCATCACTCTCTCAAAATGTCTCAGCTGTTC
CCGCCGTGGATGGCGTGGTGATATCACAATCTTGTGCTCTTTGCAGCTTGACCTTTGCTACGGTTCAGGAGCAAA
GGAACCACATCAAGTCAGACTTGCACCGCTATAATCTCAAACAAAAGCTTCGGGGTCTCCACCCTGTCTCTGAAG
TAGACTTCGAGAGGCTCATCATAGACTTGGATGAATCTTTGTCCGGATCTGACTCGAGTGGTTCTGATGAGGACG
ACGACGACAATGATGACCGACAAGAGTCAACCCTAACAGCTCTATTGAAGCGTCAAGCTCGGGTGGCAGGAAAGG
GTCAAGATGTCTCCAATCATGATCTGGACGACGAGAAAAGTGTTGGCAGATTTCAAAATCGGGGCAACCCACCCC
TCGTATGGCTCAGCTCCTCTTTCCTCCCGGAAAACACATATTTTGGCCTCTATCGCGCAATCCTGACATCCGAAG
AGCAAAAAACAACAGACTTTGTCGGCGTATTGAGAAGGAAGCAAGTTGAGCCCATTCCAGGCCCCAAAACCGGCA
AAGACGGCCAACCTCCGTTGACAACCTACAAGGGGCCGCACATTTTTCTTTGCATGATTGGCGGTGGCCACTTCG
CTGCCATGGTTGTATCTCTTGCGCCTCGAATGGGAAAAGGGCCAACTGCCATGAATCGGGAGGCCATTGTACTGG
CACACAAGACCTTTCATCGCTACACGACAAGACGGAAACAAGGCGGTGCTCAGTCGTCCAACGACAGCTCCAAAG
GAAATGCTCATTCAGCTGGTTCCAGCCTGCGTCGATATAATGAGCAGGCCCTAGTGGTTGATGTCAGAACGTTGC
TTCAGGACTGGAAGGCCTTGCTGGATTCATCGGAGCTTCTTTTTGTGCGAGCAACCGGGTCCACAAACAGAAGGA
CTTTGTTTGGACCATATGATGGACAGGTGCTGCAGAATAATGATACACGCCTGCGAGGATTTCCGTTTAGTACCA
AGCGTGCCACACAGAAAGAGCTGATGCGATGTTTTATTGAACTGACTCGCCTCAAGATGCAAGAGTTTGAACCGG
AGAAGAGGGCTTCGCATGAAGCATCGTTGACCCCAGAAAAAAAGATTGCAAGCTCCAAAACAGTCAAAACAAAGC
TCTCAGAGGAGGAAGAGACGGCGCTTTTACACACCTCACAACTTCAAGCCTTTGTCCGACGGTCAAAACTACCAG
CACTGCTCTCTTATCTTGAAAAGAGTGCCATCAGCCCTGATTTTGAATTTTATCCTCGAGAGCAAAATCATCACA
CCCCTCGTCTACTTCATCTTGCCGCGGCCCAGTGCTCCGCGCCACTAGTCCTTGGGCTCTTGGTCCGAGCTGGAG
CCAATCCGCTTCTAGGCAATGGCGATGGTAAGGTGGCTTTTGAACTGGCTGGAGATCGCTCGACCCGCGATGCTT
TTCGTGTTGCCCGCTCGGAGCTTGGAGAGGACAAGTGGGCCTGGAATAAAGCAAAAGTCCCTACAGCAATGACCA
AAGTCGAGGCAGACGATAGATGGAAGCGGGAGAGAGACGATGCGGAGAAGATAGAGTCTGAGAGGCGCAAAGCCG
AAGAAGAACGATTACGCTCGCAAGGGCCATCCTTGGACTCTTTTGCAGATAAGCCCAAGGCAAAGGGCAACACTC
TAGCGGCATCGCTTTCGAAAACGCCACAGGAAAGGCGTGAAGAGGAGGCTCGTGGCCTAACGCCGGAAATGAGGA
AGCGACTGGAGCGTGAGAGGAGAGCTCGAGCTGCTGAGGAACGAATGCGAAGTCTGAGAGGCAGCGGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail