Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6272
Gene name
LocationContig_630:5610..8016
Strand+
Gene length (bp)2406
Transcript length (bp)2406
Coding sequence length (bp)2406
Protein length (aa) 802

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 2.7E-10 295 349
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.3E-10 520 577
PF10378 RRM Putative RRM domain 9.6E-08 82 122

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09702|NRD1_SCHPO Negative regulator of differentiation 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nrd1 PE=1 SV=1 94 602 7.0E-158
sp|Q08925|MRN1_YEAST RNA-binding protein MRN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRN1 PE=1 SV=1 201 597 5.0E-157
sp|O13674|MUG24_SCHPO Meiotically up-regulated gene 24 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug24 PE=1 SV=1 202 603 1.0E-80
sp|Q03735|NAB6_YEAST RNA-binding protein NAB6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAB6 PE=1 SV=1 400 615 7.0E-49
sp|O13674|MUG24_SCHPO Meiotically up-regulated gene 24 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug24 PE=1 SV=1 424 600 2.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09702|NRD1_SCHPO Negative regulator of differentiation 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nrd1 PE=1 SV=1 94 602 7.0E-158
sp|Q08925|MRN1_YEAST RNA-binding protein MRN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRN1 PE=1 SV=1 201 597 5.0E-157
sp|O13674|MUG24_SCHPO Meiotically up-regulated gene 24 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug24 PE=1 SV=1 202 603 1.0E-80
sp|Q03735|NAB6_YEAST RNA-binding protein NAB6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAB6 PE=1 SV=1 400 615 7.0E-49
sp|O13674|MUG24_SCHPO Meiotically up-regulated gene 24 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug24 PE=1 SV=1 424 600 2.0E-25
sp|O13674|MUG24_SCHPO Meiotically up-regulated gene 24 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug24 PE=1 SV=1 201 367 6.0E-25
sp|Q03735|NAB6_YEAST RNA-binding protein NAB6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAB6 PE=1 SV=1 180 372 3.0E-22
sp|Q9LJH8|UBP1C_ARATH Oligouridylate-binding protein 1C OS=Arabidopsis thaliana GN=UBP1C PE=1 SV=1 184 498 9.0E-13
sp|Q9SYG4|UBP1A_ARATH Oligouridylate-binding protein 1A OS=Arabidopsis thaliana GN=UBP1A PE=1 SV=1 160 498 4.0E-12
sp|Q8LPQ9|FPA_ARATH Flowering time control protein FPA OS=Arabidopsis thaliana GN=FPA PE=2 SV=2 201 506 3.0E-10
sp|Q1DXH0|PABP_COCIM Polyadenylate-binding protein, cytoplasmic and nuclear OS=Coccidioides immitis (strain RS) GN=PAB1 PE=3 SV=1 292 588 1.0E-09
sp|Q9M427|UBP1_NICPL Oligouridylate-binding protein 1 OS=Nicotiana plumbaginifolia GN=UBP1 PE=2 SV=1 184 506 1.0E-09
sp|Q9SX80|R47CP_ARATH Polyadenylate-binding protein RBP47C' OS=Arabidopsis thaliana GN=RBP47C' PE=2 SV=1 422 602 6.0E-09
sp|Q9SX79|RB47C_ARATH Polyadenylate-binding protein RBP47C OS=Arabidopsis thaliana GN=RBP47C PE=2 SV=1 422 602 3.0E-08
sp|Q9LQI9|UBP1B_ARATH Oligouridylate-binding protein 1B OS=Arabidopsis thaliana GN=UBP1B PE=1 SV=1 184 498 3.0E-08
sp|Q9FPJ8|RB45A_ARATH Polyadenylate-binding protein RBP45A OS=Arabidopsis thaliana GN=RBP45A PE=2 SV=1 426 613 4.0E-08
sp|Q9LEB4|RBP45_NICPL Polyadenylate-binding protein RBP45 OS=Nicotiana plumbaginifolia GN=RBP45 PE=1 SV=1 428 575 2.0E-07
sp|Q6Z358|C3H49_ORYSJ Zinc finger CCCH domain-containing protein 49 OS=Oryza sativa subsp. japonica GN=Os07g0281000 PE=2 SV=1 518 594 2.0E-06
sp|O01671|SXL_MEGSC Sex-lethal homolog OS=Megaselia scalaris GN=SXL PE=2 SV=3 468 573 4.0E-06
sp|Q9ZW36|C3H25_ARATH Zinc finger CCCH domain-containing protein 25 OS=Arabidopsis thaliana GN=At2g29580 PE=2 SV=1 518 594 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6272
MQDFSASVAQGVSGCNTTSRFQGHASKPSTSDTGFSHGAFNSNIAGFADRHPRRGHVPSLNTQNMNQQNQPASPS
IVNDVATPGTAFDMQFTPLLPSQLLLGSPFQPGSPAAFGSPQFQSLSGFQQAAQQHGSGQQHNGSMASPVQQSMS
PQTYQTIVSPSTYGAPQFYPPQSPTGAFNLQTPMQPASPVSMSSGVVTGTSRTVYLGNIPPETCAEEILGHVRSG
QIESVRLLPDKNCAFISFLDSSSATHFHSDAILKKLCIKGQDIKIGWGKPSQVPTSVALAVQQSGASRNVYLGNL
PEDVSEAELREDLGKFGAIDTIKIVREKSIAFVHYLSIANAIKAVSQLPQEPKWQPPRRVFYGKDRCAYVSKTQQ
QNAAQYLGIAPGYAHMLTGADRDLISSALAQQSVAAAAVATSAGGINNLGNRTIYLGNIHPETTIEEICNVVRGG
LLHHIRYIPDKHICFVTFIDPTAAASFYALSNIQGLMIHNRRLKIGWGKHSGALPPAIALAVSGGASRNVYVGNL
DETWTEERLRQDFTEYGEIELVNTLREKSCAFVNFTNIANAIKAIEAIRGRDDYKKFKVNFGKDRCGNPPRQMQQ
SQSPRGESLPSPPPYASQNGGSPQSSSHSNNAMFNATSNPLTMYLNQLTQQVHQQHQQQGHTQHPLVMQQGMLLN
TAQSPPNELSLDVSQQGHLGNHGQSASISNGYAAANATTSGATTIGGLLAPGPRGQHSRAVSLPVLAPGFENGGT
SPSSVPGSNNGSDSERRGHHYQASYGGMGAANYGLAIHGGLNGWVEEEVAN*
Coding >OphauG2|6272
ATGCAGGACTTTTCGGCCTCTGTGGCTCAGGGTGTTTCTGGATGCAACACGACCAGCCGCTTCCAGGGCCACGCC
TCGAAGCCGTCTACTAGCGATACTGGTTTCTCTCATGGCGCTTTCAATTCCAACATTGCCGGATTTGCTGATCGA
CACCCTCGTCGTGGCCATGTTCCCTCGCTCAACACGCAGAACATGAATCAACAGAACCAGCCGGCTTCTCCTTCC
ATTGTCAATGATGTGGCAACTCCAGGCACCGCTTTTGACATGCAATTCACGCCTCTGCTTCCTTCACAGCTTTTG
CTAGGAAGTCCCTTTCAGCCCGGAAGTCCCGCAGCTTTCGGCAGCCCTCAATTCCAGAGTCTTTCGGGCTTTCAG
CAAGCTGCACAGCAGCATGGGAGTGGGCAACAGCATAATGGAAGCATGGCAAGTCCAGTCCAGCAAAGCATGTCG
CCCCAGACTTACCAGACAATTGTCTCTCCCTCGACATATGGGGCCCCTCAGTTTTACCCTCCACAGTCGCCTACC
GGAGCCTTTAATTTGCAGACACCTATGCAGCCCGCGTCTCCAGTGTCCATGTCATCTGGTGTCGTCACGGGAACA
AGCCGCACCGTCTACCTCGGCAACATTCCTCCCGAGACATGCGCCGAAGAGATATTGGGTCACGTTCGCAGTGGT
CAAATCGAATCTGTCCGCCTGTTGCCCGACAAGAATTGTGCCTTTATTTCCTTCCTCGACTCTAGCTCCGCCACC
CACTTTCACTCGGATGCCATTCTCAAGAAGCTTTGCATTAAGGGCCAGGACATCAAGATTGGCTGGGGAAAGCCC
TCGCAGGTTCCCACGTCGGTGGCACTAGCTGTCCAACAGTCAGGTGCCTCCCGCAACGTTTATCTGGGCAACCTA
CCCGAGGATGTTTCCGAGGCTGAGCTGCGTGAGGACCTGGGCAAGTTTGGTGCCATTGACACCATCAAGATTGTT
CGCGAGAAGAGCATCGCCTTTGTCCACTATCTCTCCATTGCCAATGCCATCAAGGCCGTTTCGCAACTTCCTCAG
GAGCCCAAGTGGCAGCCACCTCGGCGTGTCTTCTATGGCAAGGATCGGTGCGCCTATGTGTCCAAGACGCAGCAG
CAAAATGCAGCACAGTATCTCGGCATTGCCCCCGGTTACGCTCATATGCTCACTGGCGCTGACAGAGACCTCATT
TCGAGTGCTCTAGCCCAACAATCTGTCGCTGCTGCTGCCGTTGCCACGTCGGCCGGCGGTATTAATAACCTTGGC
AATCGCACTATTTACCTGGGCAACATTCATCCCGAAACTACGATTGAAGAAATTTGCAACGTTGTTCGAGGTGGC
TTGCTTCACCACATTCGGTATATTCCCGACAAGCATATCTGCTTCGTTACTTTCATCGATCCTACCGCAGCCGCG
TCCTTCTATGCCCTAAGCAACATTCAGGGTCTCATGATACACAACCGACGGCTCAAGATAGGATGGGGCAAGCAT
TCGGGTGCATTGCCGCCAGCCATAGCACTTGCTGTCAGTGGTGGTGCTTCGCGCAATGTCTACGTGGGCAACCTG
GATGAGACGTGGACTGAGGAGCGCCTTCGCCAGGACTTCACCGAGTACGGTGAGATTGAATTGGTCAACACGCTG
CGCGAGAAGAGCTGTGCTTTTGTCAACTTTACCAATATTGCCAATGCTATTAAGGCTATCGAGGCTATTCGGGGT
AGAGATGACTACAAAAAGTTCAAGGTCAACTTTGGCAAGGACCGCTGCGGCAACCCTCCACGGCAAATGCAACAG
AGCCAGTCGCCCCGTGGTGAAAGCCTGCCATCTCCTCCGCCATATGCATCTCAGAATGGCGGTTCACCTCAAAGC
AGCAGCCACTCCAACAATGCCATGTTCAACGCGACGAGTAACCCTCTGACCATGTACCTGAACCAATTGACCCAA
CAGGTTCACCAGCAACATCAGCAGCAAGGCCATACCCAGCACCCCTTGGTCATGCAGCAGGGCATGCTCTTGAAC
ACGGCTCAGTCGCCGCCCAATGAACTGTCGCTTGACGTATCTCAGCAAGGCCACCTTGGCAATCACGGACAGTCG
GCAAGCATCTCCAATGGTTATGCTGCAGCCAACGCCACAACGTCTGGCGCTACTACCATTGGTGGGCTACTTGCA
CCGGGGCCTAGGGGGCAGCATAGCCGAGCAGTGAGCCTGCCCGTCTTGGCTCCCGGCTTCGAGAACGGTGGTACC
AGCCCGAGCAGTGTTCCAGGTAGCAATAATGGAAGTGATAGCGAGCGCCGTGGTCACCACTATCAGGCGAGCTAC
GGCGGCATGGGAGCGGCAAACTATGGCTTAGCCATTCACGGAGGCCTGAATGGATGGGTTGAGGAAGAGGTGGCT
AACTAG
Transcript >OphauG2|6272
ATGCAGGACTTTTCGGCCTCTGTGGCTCAGGGTGTTTCTGGATGCAACACGACCAGCCGCTTCCAGGGCCACGCC
TCGAAGCCGTCTACTAGCGATACTGGTTTCTCTCATGGCGCTTTCAATTCCAACATTGCCGGATTTGCTGATCGA
CACCCTCGTCGTGGCCATGTTCCCTCGCTCAACACGCAGAACATGAATCAACAGAACCAGCCGGCTTCTCCTTCC
ATTGTCAATGATGTGGCAACTCCAGGCACCGCTTTTGACATGCAATTCACGCCTCTGCTTCCTTCACAGCTTTTG
CTAGGAAGTCCCTTTCAGCCCGGAAGTCCCGCAGCTTTCGGCAGCCCTCAATTCCAGAGTCTTTCGGGCTTTCAG
CAAGCTGCACAGCAGCATGGGAGTGGGCAACAGCATAATGGAAGCATGGCAAGTCCAGTCCAGCAAAGCATGTCG
CCCCAGACTTACCAGACAATTGTCTCTCCCTCGACATATGGGGCCCCTCAGTTTTACCCTCCACAGTCGCCTACC
GGAGCCTTTAATTTGCAGACACCTATGCAGCCCGCGTCTCCAGTGTCCATGTCATCTGGTGTCGTCACGGGAACA
AGCCGCACCGTCTACCTCGGCAACATTCCTCCCGAGACATGCGCCGAAGAGATATTGGGTCACGTTCGCAGTGGT
CAAATCGAATCTGTCCGCCTGTTGCCCGACAAGAATTGTGCCTTTATTTCCTTCCTCGACTCTAGCTCCGCCACC
CACTTTCACTCGGATGCCATTCTCAAGAAGCTTTGCATTAAGGGCCAGGACATCAAGATTGGCTGGGGAAAGCCC
TCGCAGGTTCCCACGTCGGTGGCACTAGCTGTCCAACAGTCAGGTGCCTCCCGCAACGTTTATCTGGGCAACCTA
CCCGAGGATGTTTCCGAGGCTGAGCTGCGTGAGGACCTGGGCAAGTTTGGTGCCATTGACACCATCAAGATTGTT
CGCGAGAAGAGCATCGCCTTTGTCCACTATCTCTCCATTGCCAATGCCATCAAGGCCGTTTCGCAACTTCCTCAG
GAGCCCAAGTGGCAGCCACCTCGGCGTGTCTTCTATGGCAAGGATCGGTGCGCCTATGTGTCCAAGACGCAGCAG
CAAAATGCAGCACAGTATCTCGGCATTGCCCCCGGTTACGCTCATATGCTCACTGGCGCTGACAGAGACCTCATT
TCGAGTGCTCTAGCCCAACAATCTGTCGCTGCTGCTGCCGTTGCCACGTCGGCCGGCGGTATTAATAACCTTGGC
AATCGCACTATTTACCTGGGCAACATTCATCCCGAAACTACGATTGAAGAAATTTGCAACGTTGTTCGAGGTGGC
TTGCTTCACCACATTCGGTATATTCCCGACAAGCATATCTGCTTCGTTACTTTCATCGATCCTACCGCAGCCGCG
TCCTTCTATGCCCTAAGCAACATTCAGGGTCTCATGATACACAACCGACGGCTCAAGATAGGATGGGGCAAGCAT
TCGGGTGCATTGCCGCCAGCCATAGCACTTGCTGTCAGTGGTGGTGCTTCGCGCAATGTCTACGTGGGCAACCTG
GATGAGACGTGGACTGAGGAGCGCCTTCGCCAGGACTTCACCGAGTACGGTGAGATTGAATTGGTCAACACGCTG
CGCGAGAAGAGCTGTGCTTTTGTCAACTTTACCAATATTGCCAATGCTATTAAGGCTATCGAGGCTATTCGGGGT
AGAGATGACTACAAAAAGTTCAAGGTCAACTTTGGCAAGGACCGCTGCGGCAACCCTCCACGGCAAATGCAACAG
AGCCAGTCGCCCCGTGGTGAAAGCCTGCCATCTCCTCCGCCATATGCATCTCAGAATGGCGGTTCACCTCAAAGC
AGCAGCCACTCCAACAATGCCATGTTCAACGCGACGAGTAACCCTCTGACCATGTACCTGAACCAATTGACCCAA
CAGGTTCACCAGCAACATCAGCAGCAAGGCCATACCCAGCACCCCTTGGTCATGCAGCAGGGCATGCTCTTGAAC
ACGGCTCAGTCGCCGCCCAATGAACTGTCGCTTGACGTATCTCAGCAAGGCCACCTTGGCAATCACGGACAGTCG
GCAAGCATCTCCAATGGTTATGCTGCAGCCAACGCCACAACGTCTGGCGCTACTACCATTGGTGGGCTACTTGCA
CCGGGGCCTAGGGGGCAGCATAGCCGAGCAGTGAGCCTGCCCGTCTTGGCTCCCGGCTTCGAGAACGGTGGTACC
AGCCCGAGCAGTGTTCCAGGTAGCAATAATGGAAGTGATAGCGAGCGCCGTGGTCACCACTATCAGGCGAGCTAC
GGCGGCATGGGAGCGGCAAACTATGGCTTAGCCATTCACGGAGGCCTGAATGGATGGGTTGAGGAAGAGGTGGCT
AACTAG
Gene >OphauG2|6272
ATGCAGGACTTTTCGGCCTCTGTGGCTCAGGGTGTTTCTGGATGCAACACGACCAGCCGCTTCCAGGGCCACGCC
TCGAAGCCGTCTACTAGCGATACTGGTTTCTCTCATGGCGCTTTCAATTCCAACATTGCCGGATTTGCTGATCGA
CACCCTCGTCGTGGCCATGTTCCCTCGCTCAACACGCAGAACATGAATCAACAGAACCAGCCGGCTTCTCCTTCC
ATTGTCAATGATGTGGCAACTCCAGGCACCGCTTTTGACATGCAATTCACGCCTCTGCTTCCTTCACAGCTTTTG
CTAGGAAGTCCCTTTCAGCCCGGAAGTCCCGCAGCTTTCGGCAGCCCTCAATTCCAGAGTCTTTCGGGCTTTCAG
CAAGCTGCACAGCAGCATGGGAGTGGGCAACAGCATAATGGAAGCATGGCAAGTCCAGTCCAGCAAAGCATGTCG
CCCCAGACTTACCAGACAATTGTCTCTCCCTCGACATATGGGGCCCCTCAGTTTTACCCTCCACAGTCGCCTACC
GGAGCCTTTAATTTGCAGACACCTATGCAGCCCGCGTCTCCAGTGTCCATGTCATCTGGTGTCGTCACGGGAACA
AGCCGCACCGTCTACCTCGGCAACATTCCTCCCGAGACATGCGCCGAAGAGATATTGGGTCACGTTCGCAGTGGT
CAAATCGAATCTGTCCGCCTGTTGCCCGACAAGAATTGTGCCTTTATTTCCTTCCTCGACTCTAGCTCCGCCACC
CACTTTCACTCGGATGCCATTCTCAAGAAGCTTTGCATTAAGGGCCAGGACATCAAGATTGGCTGGGGAAAGCCC
TCGCAGGTTCCCACGTCGGTGGCACTAGCTGTCCAACAGTCAGGTGCCTCCCGCAACGTTTATCTGGGCAACCTA
CCCGAGGATGTTTCCGAGGCTGAGCTGCGTGAGGACCTGGGCAAGTTTGGTGCCATTGACACCATCAAGATTGTT
CGCGAGAAGAGCATCGCCTTTGTCCACTATCTCTCCATTGCCAATGCCATCAAGGCCGTTTCGCAACTTCCTCAG
GAGCCCAAGTGGCAGCCACCTCGGCGTGTCTTCTATGGCAAGGATCGGTGCGCCTATGTGTCCAAGACGCAGCAG
CAAAATGCAGCACAGTATCTCGGCATTGCCCCCGGTTACGCTCATATGCTCACTGGCGCTGACAGAGACCTCATT
TCGAGTGCTCTAGCCCAACAATCTGTCGCTGCTGCTGCCGTTGCCACGTCGGCCGGCGGTATTAATAACCTTGGC
AATCGCACTATTTACCTGGGCAACATTCATCCCGAAACTACGATTGAAGAAATTTGCAACGTTGTTCGAGGTGGC
TTGCTTCACCACATTCGGTATATTCCCGACAAGCATATCTGCTTCGTTACTTTCATCGATCCTACCGCAGCCGCG
TCCTTCTATGCCCTAAGCAACATTCAGGGTCTCATGATACACAACCGACGGCTCAAGATAGGATGGGGCAAGCAT
TCGGGTGCATTGCCGCCAGCCATAGCACTTGCTGTCAGTGGTGGTGCTTCGCGCAATGTCTACGTGGGCAACCTG
GATGAGACGTGGACTGAGGAGCGCCTTCGCCAGGACTTCACCGAGTACGGTGAGATTGAATTGGTCAACACGCTG
CGCGAGAAGAGCTGTGCTTTTGTCAACTTTACCAATATTGCCAATGCTATTAAGGCTATCGAGGCTATTCGGGGT
AGAGATGACTACAAAAAGTTCAAGGTCAACTTTGGCAAGGACCGCTGCGGCAACCCTCCACGGCAAATGCAACAG
AGCCAGTCGCCCCGTGGTGAAAGCCTGCCATCTCCTCCGCCATATGCATCTCAGAATGGCGGTTCACCTCAAAGC
AGCAGCCACTCCAACAATGCCATGTTCAACGCGACGAGTAACCCTCTGACCATGTACCTGAACCAATTGACCCAA
CAGGTTCACCAGCAACATCAGCAGCAAGGCCATACCCAGCACCCCTTGGTCATGCAGCAGGGCATGCTCTTGAAC
ACGGCTCAGTCGCCGCCCAATGAACTGTCGCTTGACGTATCTCAGCAAGGCCACCTTGGCAATCACGGACAGTCG
GCAAGCATCTCCAATGGTTATGCTGCAGCCAACGCCACAACGTCTGGCGCTACTACCATTGGTGGGCTACTTGCA
CCGGGGCCTAGGGGGCAGCATAGCCGAGCAGTGAGCCTGCCCGTCTTGGCTCCCGGCTTCGAGAACGGTGGTACC
AGCCCGAGCAGTGTTCCAGGTAGCAATAATGGAAGTGATAGCGAGCGCCGTGGTCACCACTATCAGGCGAGCTAC
GGCGGCATGGGAGCGGCAAACTATGGCTTAGCCATTCACGGAGGCCTGAATGGATGGGTTGAGGAAGAGGTGGCT
AACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail