Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6271
Gene name
LocationContig_630:251..2073
Strand+
Gene length (bp)1822
Transcript length (bp)1764
Coding sequence length (bp)1764
Protein length (aa) 588

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00152 tRNA-synt_2 tRNA synthetases class II (D, K and N) 1.7E-86 265 580
PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain 2.0E-08 160 240

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38707|SYNC_YEAST Asparagine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DED81 PE=1 SV=1 17 587 0.0E+00
sp|O94567|SYNC_SCHPO Probable asparagine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nrs1 PE=3 SV=1 10 587 0.0E+00
sp|Q6BU46|SYNC_DEBHA Asparagine--tRNA ligase, cytoplasmic OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DED81 PE=3 SV=1 16 587 0.0E+00
sp|Q8BP47|SYNC_MOUSE Asparagine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Nars PE=1 SV=2 3 587 8.0E-177
sp|O43776|SYNC_HUMAN Asparagine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=NARS PE=1 SV=1 21 587 6.0E-175
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38707|SYNC_YEAST Asparagine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DED81 PE=1 SV=1 17 587 0.0E+00
sp|O94567|SYNC_SCHPO Probable asparagine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nrs1 PE=3 SV=1 10 587 0.0E+00
sp|Q6BU46|SYNC_DEBHA Asparagine--tRNA ligase, cytoplasmic OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DED81 PE=3 SV=1 16 587 0.0E+00
sp|Q8BP47|SYNC_MOUSE Asparagine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Nars PE=1 SV=2 3 587 8.0E-177
sp|O43776|SYNC_HUMAN Asparagine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=NARS PE=1 SV=1 21 587 6.0E-175
sp|Q2KJG3|SYNC_BOVIN Asparagine--tRNA ligase, cytoplasmic OS=Bos taurus GN=NARS PE=2 SV=3 21 587 4.0E-173
sp|Q4R4Z1|SYNC_MACFA Asparagine--tRNA ligase, cytoplasmic OS=Macaca fascicularis GN=NARS PE=2 SV=1 21 587 4.0E-171
sp|Q19722|SYNC_CAEEL Asparagine--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans GN=nrs-1 PE=3 SV=1 16 587 8.0E-166
sp|P10723|SYNC_BRUMA Asparagine--tRNA ligase, cytoplasmic OS=Brugia malayi PE=1 SV=1 17 587 4.0E-155
sp|Q554D9|SYNC_DICDI Asparagine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=asnS1 PE=1 SV=1 127 587 6.0E-128
sp|Q8SQK8|SYNC_ENCCU Probable asparagine--tRNA ligase, cytoplasmic OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU09_1680 PE=3 SV=2 157 587 5.0E-97
sp|C4V847|SYNC_NOSCE Probable asparagine--tRNA ligase, cytoplasmic OS=Nosema ceranae (strain BRL01) GN=NCER_100652 PE=3 SV=1 159 587 9.0E-97
sp|Q979Y4|SYN_THEVO Asparagine--tRNA ligase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=asnS PE=3 SV=1 154 587 1.0E-88
sp|Q9HKS7|SYN_THEAC Asparagine--tRNA ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=asnS PE=3 SV=1 154 587 2.0E-87
sp|A9CTP8|SYNC_ENTBH Probable asparagine--tRNA ligase, cytoplasmic OS=Enterocytozoon bieneusi (strain H348) GN=EBI_22533 PE=3 SV=1 159 587 3.0E-82
sp|C5A4R8|SYN_THEGJ Asparagine--tRNA ligase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=asnS PE=3 SV=1 156 587 1.0E-76
sp|Q9V251|SYN_PYRAB Asparagine--tRNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=asnS PE=3 SV=1 157 587 3.0E-75
sp|Q5JHC1|SYN_THEKO Asparagine--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=asnS PE=3 SV=1 156 587 1.0E-74
sp|Q8U4D3|SYN_PYRFU Asparagine--tRNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=asnS PE=3 SV=2 156 587 5.0E-74
sp|O57980|SYN_PYRHO Asparagine--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=asnS PE=1 SV=1 157 587 5.0E-74
sp|A9GBR2|SYN_SORC5 Asparagine--tRNA ligase OS=Sorangium cellulosum (strain So ce56) GN=asnS PE=3 SV=1 154 587 6.0E-72
sp|B2GA02|SYN_LACRJ Asparagine--tRNA ligase OS=Lactobacillus reuteri (strain JCM 1112) GN=asnS PE=3 SV=1 155 587 9.0E-72
sp|A5VMP9|SYN_LACRD Asparagine--tRNA ligase OS=Lactobacillus reuteri (strain DSM 20016) GN=asnS PE=3 SV=1 155 587 9.0E-72
sp|A5UPW5|SYN_ROSS1 Asparagine--tRNA ligase OS=Roseiflexus sp. (strain RS-1) GN=asnS PE=3 SV=1 133 587 1.0E-71
sp|B8GBG7|SYN_CHLAD Asparagine--tRNA ligase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=asnS PE=3 SV=1 133 587 4.0E-71
sp|B9LCU8|SYN_CHLSY Asparagine--tRNA ligase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=asnS PE=3 SV=1 133 587 8.0E-71
sp|A9WA97|SYN_CHLAA Asparagine--tRNA ligase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=asnS PE=3 SV=1 133 587 8.0E-71
sp|A4IQ54|SYN_GEOTN Asparagine--tRNA ligase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=asnS PE=3 SV=1 157 587 1.0E-70
sp|Q65I63|SYN_BACLD Asparagine--tRNA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=asnS PE=3 SV=1 155 587 2.0E-69
sp|P39772|SYN_BACSU Asparagine--tRNA ligase OS=Bacillus subtilis (strain 168) GN=asnS PE=3 SV=2 155 587 4.0E-69
sp|Q67P26|SYN_SYMTH Asparagine--tRNA ligase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=asnS PE=3 SV=1 155 587 6.0E-69
sp|A7NHQ4|SYN_ROSCS Asparagine--tRNA ligase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=asnS PE=3 SV=1 155 587 8.0E-69
sp|Q1IHQ3|SYN_KORVE Asparagine--tRNA ligase OS=Koribacter versatilis (strain Ellin345) GN=asnS PE=3 SV=1 153 587 4.0E-68
sp|A7Z5Y7|SYN_BACMF Asparagine--tRNA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=asnS PE=3 SV=1 155 587 6.0E-68
sp|Q8EQE2|SYN_OCEIH Asparagine--tRNA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=asnS PE=3 SV=1 170 587 1.0E-67
sp|Q9KC78|SYN_BACHD Asparagine--tRNA ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=asnS PE=3 SV=1 170 587 3.0E-67
sp|Q6G9A8|SYN_STAAS Asparagine--tRNA ligase OS=Staphylococcus aureus (strain MSSA476) GN=asnS PE=3 SV=1 170 587 9.0E-67
sp|Q72QT4|SYN_LEPIC Asparagine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=asnS PE=3 SV=1 153 587 1.0E-66
sp|Q71YB9|SYN_LISMF Asparagine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=asnS PE=3 SV=1 157 587 2.0E-66
sp|Q92AB2|SYN_LISIN Asparagine--tRNA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=asnS PE=3 SV=1 157 587 2.0E-66
sp|Q8F522|SYN_LEPIN Asparagine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=asnS PE=3 SV=1 153 587 2.0E-66
sp|P67572|SYN_STAAN Asparagine--tRNA ligase OS=Staphylococcus aureus (strain N315) GN=asnS PE=1 SV=1 155 587 2.0E-66
sp|P67571|SYN_STAAM Asparagine--tRNA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=asnS PE=3 SV=1 155 587 2.0E-66
sp|A5ISY4|SYN_STAA9 Asparagine--tRNA ligase OS=Staphylococcus aureus (strain JH9) GN=asnS PE=3 SV=1 155 587 2.0E-66
sp|A6U1S3|SYN_STAA2 Asparagine--tRNA ligase OS=Staphylococcus aureus (strain JH1) GN=asnS PE=3 SV=1 155 587 2.0E-66
sp|A7X2E9|SYN_STAA1 Asparagine--tRNA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=asnS PE=3 SV=1 155 587 2.0E-66
sp|Q5WGB1|SYN_BACSK Asparagine--tRNA ligase OS=Bacillus clausii (strain KSM-K16) GN=asnS PE=3 SV=1 153 587 2.0E-66
sp|Q88Y40|SYN1_LACPL Asparagine--tRNA ligase 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=asnS1 PE=3 SV=1 146 587 3.0E-66
sp|A5D2C2|SYN_PELTS Asparagine--tRNA ligase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=asnS PE=3 SV=1 149 587 4.0E-66
sp|Q8NWP3|SYN_STAAW Asparagine--tRNA ligase OS=Staphylococcus aureus (strain MW2) GN=asnS PE=3 SV=1 155 587 4.0E-66
sp|Q6GGV5|SYN_STAAR Asparagine--tRNA ligase OS=Staphylococcus aureus (strain MRSA252) GN=asnS PE=3 SV=1 155 587 6.0E-66
sp|P58695|SYN_LISMO Asparagine--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=asnS PE=3 SV=1 157 587 6.0E-66
sp|A8Z434|SYN_STAAT Asparagine--tRNA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=asnS PE=3 SV=1 155 587 8.0E-66
sp|A6QH05|SYN_STAAE Asparagine--tRNA ligase OS=Staphylococcus aureus (strain Newman) GN=asnS PE=3 SV=1 155 587 8.0E-66
sp|Q5HFW9|SYN_STAAC Asparagine--tRNA ligase OS=Staphylococcus aureus (strain COL) GN=asnS PE=3 SV=1 155 587 8.0E-66
sp|Q2FYH6|SYN_STAA8 Asparagine--tRNA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=asnS PE=3 SV=1 155 587 8.0E-66
sp|Q2FGY6|SYN_STAA3 Asparagine--tRNA ligase OS=Staphylococcus aureus (strain USA300) GN=asnS PE=3 SV=1 155 587 8.0E-66
sp|A4J412|SYN_DESRM Asparagine--tRNA ligase OS=Desulfotomaculum reducens (strain MI-1) GN=asnS PE=3 SV=1 153 587 1.0E-65
sp|Q2YY52|SYN_STAAB Asparagine--tRNA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=asnS PE=3 SV=1 155 587 1.0E-65
sp|A0AK01|SYN_LISW6 Asparagine--tRNA ligase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=asnS PE=3 SV=1 157 587 2.0E-65
sp|Q04EX6|SYN_OENOB Asparagine--tRNA ligase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=asnS PE=3 SV=1 157 587 2.0E-64
sp|A9AYM5|SYN_HERA2 Asparagine--tRNA ligase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=asnS PE=3 SV=1 141 587 4.0E-64
sp|Q050D9|SYN_LEPBL Asparagine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=asnS PE=3 SV=1 159 587 4.0E-64
sp|Q04SB3|SYN_LEPBJ Asparagine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=asnS PE=3 SV=1 159 587 4.0E-64
sp|Q72KF7|SYN_THET2 Asparagine--tRNA ligase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=asnS PE=3 SV=1 155 587 4.0E-64
sp|P54263|SYN_THET8 Asparagine--tRNA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=asnS PE=1 SV=2 155 587 6.0E-64
sp|Q49XR0|SYN_STAS1 Asparagine--tRNA ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=asnS PE=3 SV=1 157 587 9.0E-63
sp|Q4L6F8|SYN_STAHJ Asparagine--tRNA ligase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=asnS PE=3 SV=1 155 587 2.0E-62
sp|Q038W1|SYN_LACC3 Asparagine--tRNA ligase OS=Lactobacillus casei (strain ATCC 334) GN=asnS PE=3 SV=1 155 587 3.0E-62
sp|Q38X65|SYN_LACSS Asparagine--tRNA ligase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=asnS PE=3 SV=1 155 587 5.0E-62
sp|Q8CSI9|SYN_STAES Asparagine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=asnS PE=3 SV=1 155 587 2.0E-61
sp|Q5HP89|SYN_STAEQ Asparagine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=asnS PE=3 SV=1 155 587 2.0E-61
sp|Q88WA8|SYN2_LACPL Asparagine--tRNA ligase 2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=asnS2 PE=3 SV=1 155 587 5.0E-61
sp|P54262|SYN_LACDA Asparagine--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=asnS1 PE=3 SV=1 170 587 1.0E-60
sp|Q02X21|SYN_LACLS Asparagine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=asnS PE=3 SV=1 155 587 3.0E-59
sp|A2RMQ1|SYN_LACLM Asparagine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=asnS PE=3 SV=1 155 587 4.0E-59
sp|Q9CEK9|SYN_LACLA Asparagine--tRNA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=asnS PE=3 SV=1 155 587 3.0E-58
sp|C1CV26|SYN_DEIDV Asparagine--tRNA ligase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=asnS PE=3 SV=1 155 587 3.0E-58
sp|Q1IZA1|SYN_DEIGD Asparagine--tRNA ligase OS=Deinococcus geothermalis (strain DSM 11300) GN=asnS PE=3 SV=1 155 587 6.0E-58
sp|A3CNM0|SYN_STRSV Asparagine--tRNA ligase OS=Streptococcus sanguinis (strain SK36) GN=asnS PE=3 SV=1 157 587 6.0E-58
sp|Q8DTM2|SYN_STRMU Asparagine--tRNA ligase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=asnS PE=3 SV=1 155 587 8.0E-58
sp|Q74JA9|SYN_LACJO Asparagine--tRNA ligase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=asnS PE=3 SV=1 155 587 9.0E-58
sp|Q043G9|SYN_LACGA Asparagine--tRNA ligase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=asnS PE=3 SV=1 155 587 9.0E-58
sp|Q5M067|SYN_STRT1 Asparagine--tRNA ligase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=asnS PE=3 SV=1 155 587 2.0E-57
sp|A8YVJ7|SYN_LACH4 Asparagine--tRNA ligase OS=Lactobacillus helveticus (strain DPC 4571) GN=asnS PE=3 SV=1 155 587 3.0E-57
sp|Q5M4S8|SYN_STRT2 Asparagine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=asnS PE=3 SV=1 155 587 6.0E-57
sp|Q03L20|SYN_STRTD Asparagine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=asnS PE=3 SV=1 155 587 7.0E-57
sp|Q831X4|SYN_ENTFA Asparagine--tRNA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=asnS PE=3 SV=1 150 587 1.0E-56
sp|P67574|SYN_STRA5 Asparagine--tRNA ligase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=asnS PE=3 SV=1 157 587 3.0E-56
sp|P67573|SYN_STRA3 Asparagine--tRNA ligase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=asnS PE=3 SV=1 157 587 3.0E-56
sp|Q3K2E5|SYN_STRA1 Asparagine--tRNA ligase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=asnS PE=3 SV=1 157 587 3.0E-56
sp|A4W083|SYN_STRS2 Asparagine--tRNA ligase OS=Streptococcus suis (strain 98HAH33) GN=asnS PE=3 SV=1 157 587 4.0E-56
sp|P0DG29|SYN_STRPQ Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=asnS PE=3 SV=1 157 587 4.0E-56
sp|Q48UH6|SYN_STRPM Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=asnS PE=3 SV=1 157 587 4.0E-56
sp|A2RFM5|SYN_STRPG Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=asnS PE=3 SV=1 157 587 4.0E-56
sp|Q1JHS6|SYN_STRPD Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=asnS PE=3 SV=1 157 587 4.0E-56
sp|P67577|SYN_STRP8 Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=asnS PE=3 SV=1 157 587 4.0E-56
sp|P0DG28|SYN_STRP3 Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=asnS PE=3 SV=1 157 587 4.0E-56
sp|P67575|SYN_STRP1 Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M1 GN=asnS PE=3 SV=1 157 587 4.0E-56
sp|Q1J7K5|SYN_STRPF Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=asnS PE=3 SV=1 157 587 4.0E-56
sp|Q1JMN3|SYN_STRPC Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=asnS PE=3 SV=1 157 587 5.0E-56
sp|Q1JCQ7|SYN_STRPB Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=asnS PE=3 SV=1 157 587 5.0E-56
sp|Q5XD20|SYN_STRP6 Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=asnS PE=3 SV=1 157 587 7.0E-56
sp|Q97PR0|SYN_STRPN Asparagine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=asnS PE=1 SV=1 206 587 1.0E-55
sp|O26328|SYDND_METTH Aspartate--tRNA(Asp/Asn) ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=aspS PE=1 SV=1 157 587 2.0E-55
sp|Q8CWQ4|SYN_STRR6 Asparagine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=asnS PE=3 SV=1 206 587 4.0E-55
sp|Q04JK7|SYN_STRP2 Asparagine--tRNA ligase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=asnS PE=3 SV=1 206 587 4.0E-55
sp|Q1WU36|SYN_LACS1 Asparagine--tRNA ligase OS=Lactobacillus salivarius (strain UCC118) GN=asnS PE=3 SV=1 155 587 1.0E-54
sp|A4VTZ1|SYN_STRSY Asparagine--tRNA ligase OS=Streptococcus suis (strain 05ZYH33) GN=asnS PE=3 SV=1 155 583 1.0E-53
sp|Q55FI3|SYNM_DICDI Probable asparagine--tRNA ligase, mitochondrial OS=Dictyostelium discoideum GN=asnS2 PE=3 SV=1 157 586 2.0E-53
sp|A1SW33|SYN_PSYIN Asparagine--tRNA ligase OS=Psychromonas ingrahamii (strain 37) GN=asnS PE=3 SV=1 157 580 3.0E-52
sp|Q8BGV0|SYNM_MOUSE Probable asparagine--tRNA ligase, mitochondrial OS=Mus musculus GN=Nars2 PE=1 SV=1 156 585 4.0E-52
sp|A3DBI2|SYN_CLOTH Asparagine--tRNA ligase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=asnS PE=3 SV=1 146 580 8.0E-52
sp|A6USZ9|SYDND_META3 Aspartate--tRNA(Asp/Asn) ligase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=aspS PE=3 SV=1 152 587 1.0E-51
sp|Q96I59|SYNM_HUMAN Probable asparagine--tRNA ligase, mitochondrial OS=Homo sapiens GN=NARS2 PE=1 SV=3 150 585 1.0E-51
sp|Q8EW03|SYN_MYCPE Asparagine--tRNA ligase OS=Mycoplasma penetrans (strain HF-2) GN=asnS PE=3 SV=1 158 583 3.0E-50
sp|Q8TXG4|SYDND_METKA Aspartate--tRNA(Asp/Asn) ligase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=aspS PE=3 SV=1 157 587 7.0E-50
sp|Q97E56|SYN_CLOAB Asparagine--tRNA ligase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=asnS PE=3 SV=1 157 586 1.0E-49
sp|Q3IT59|SYDND_NATPD Aspartate--tRNA(Asp/Asn) ligase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=aspS PE=3 SV=1 154 587 1.0E-49
sp|Q7UHE1|SYN_RHOBA Asparagine--tRNA ligase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=asnS PE=3 SV=1 160 586 2.0E-49
sp|Q9HJM1|SYD_THEAC Aspartate--tRNA(Asp) ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=aspS PE=3 SV=1 266 587 2.0E-49
sp|A0PY64|SYN_CLONN Asparagine--tRNA ligase OS=Clostridium novyi (strain NT) GN=asnS PE=3 SV=1 157 580 2.0E-49
sp|Q58950|SYDND_METJA Aspartate--tRNA(Asp/Asn) ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=aspS PE=3 SV=1 157 587 3.0E-49
sp|Q24MK1|SYN_DESHY Asparagine--tRNA ligase OS=Desulfitobacterium hafniense (strain Y51) GN=asnS PE=3 SV=1 146 580 4.0E-49
sp|Q8DG51|SYN_THEEB Asparagine--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=asnS PE=3 SV=1 157 586 1.0E-48
sp|A6LIA1|SYN_PARD8 Asparagine--tRNA ligase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=asnS PE=3 SV=1 157 580 2.0E-48
sp|B5ZBH7|SYN_UREU1 Asparagine--tRNA ligase OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=asnS PE=3 SV=1 156 586 2.0E-48
sp|Q5V1N2|SYDND_HALMA Aspartate--tRNA(Asp/Asn) ligase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=aspS PE=3 SV=1 154 587 5.0E-48
sp|Q2NHT0|SYDND_METST Aspartate--tRNA(Asp/Asn) ligase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=aspS PE=3 SV=1 157 587 5.0E-48
sp|Q18KP5|SYDND_HALWD Aspartate--tRNA(Asp/Asn) ligase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=aspS PE=3 SV=1 157 587 6.0E-48
sp|A3CXH4|SYDND_METMJ Aspartate--tRNA(Asp/Asn) ligase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=aspS PE=3 SV=1 161 587 7.0E-48
sp|Q1MQG9|SYN_LAWIP Asparagine--tRNA ligase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=asnS PE=3 SV=1 160 583 8.0E-48
sp|P58693|SYN_CLOPE Asparagine--tRNA ligase OS=Clostridium perfringens (strain 13 / Type A) GN=asnS PE=3 SV=1 139 583 8.0E-48
sp|Q0TMF3|SYN_CLOP1 Asparagine--tRNA ligase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=asnS PE=3 SV=1 139 583 8.0E-48
sp|Q0SQ51|SYN_CLOPS Asparagine--tRNA ligase OS=Clostridium perfringens (strain SM101 / Type A) GN=asnS PE=3 SV=1 139 583 8.0E-48
sp|Q7MVE5|SYN_PORGI Asparagine--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=asnS PE=3 SV=1 143 580 9.0E-48
sp|P47359|SYN_MYCGE Asparagine--tRNA ligase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=asnS PE=3 SV=1 159 583 1.0E-47
sp|A2SPG1|SYDND_METLZ Aspartate--tRNA(Asp/Asn) ligase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=aspS PE=3 SV=1 161 587 1.0E-47
sp|B2RK42|SYN_PORG3 Asparagine--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=asnS PE=3 SV=1 143 580 2.0E-47
sp|A8MJ91|SYN_ALKOO Asparagine--tRNA ligase OS=Alkaliphilus oremlandii (strain OhILAs) GN=asnS PE=3 SV=1 143 580 3.0E-47
sp|A4G0V5|SYDND_METM5 Aspartate--tRNA(Asp/Asn) ligase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=aspS PE=3 SV=1 157 587 4.0E-47
sp|Q899M9|SYN_CLOTE Asparagine--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=asnS PE=3 SV=1 160 586 7.0E-47
sp|Q8A0Z8|SYN_BACTN Asparagine--tRNA ligase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=asnS PE=3 SV=1 157 580 9.0E-47
sp|B0JN99|SYN_MICAN Asparagine--tRNA ligase OS=Microcystis aeruginosa (strain NIES-843) GN=asnS PE=3 SV=1 160 580 9.0E-47
sp|A6UQQ8|SYDND_METVS Aspartate--tRNA(Asp/Asn) ligase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=aspS PE=3 SV=1 157 587 1.0E-46
sp|Q5L8W2|SYN_BACFN Asparagine--tRNA ligase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=asnS PE=3 SV=1 146 580 1.0E-46
sp|Q6LWU0|SYDND_METMP Aspartate--tRNA(Asp/Asn) ligase OS=Methanococcus maripaludis (strain S2 / LL) GN=aspS PE=3 SV=1 157 587 1.0E-46
sp|Q0HUL3|SYN_SHESR Asparagine--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=asnS PE=3 SV=1 141 580 2.0E-46
sp|Q74E08|SYN_GEOSL Asparagine--tRNA ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=asnS PE=3 SV=1 153 580 2.0E-46
sp|Q64P24|SYN_BACFR Asparagine--tRNA ligase OS=Bacteroides fragilis (strain YCH46) GN=asnS PE=3 SV=1 146 580 2.0E-46
sp|O29342|SYDND_ARCFU Aspartate--tRNA(Asp/Asn) ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=aspS PE=3 SV=1 156 587 2.0E-46
sp|Q8RH70|SYN_FUSNN Asparagine--tRNA ligase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=asnS PE=3 SV=1 160 580 2.0E-46
sp|A1S684|SYN_SHEAM Asparagine--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=asnS PE=3 SV=1 141 580 3.0E-46
sp|A8FVU8|SYN_SHESH Asparagine--tRNA ligase OS=Shewanella sediminis (strain HAW-EB3) GN=asnS PE=3 SV=1 157 580 4.0E-46
sp|Q9PQC6|SYN_UREPA Asparagine--tRNA ligase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=asnS PE=3 SV=1 156 586 4.0E-46
sp|B1AJ04|SYN_UREP2 Asparagine--tRNA ligase OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=asnS PE=3 SV=1 156 586 4.0E-46
sp|P52276|SYN_SYNY3 Asparagine--tRNA ligase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=asnS PE=3 SV=2 159 580 5.0E-46
sp|Q12MT5|SYN_SHEDO Asparagine--tRNA ligase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=asnS PE=3 SV=1 152 580 6.0E-46
sp|Q2FRU5|SYDND_METHJ Aspartate--tRNA(Asp/Asn) ligase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=aspS PE=3 SV=1 161 587 7.0E-46
sp|Q6ANL4|SYN_DESPS Asparagine--tRNA ligase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=asnS PE=3 SV=1 160 583 7.0E-46
sp|Q6D453|SYN_PECAS Asparagine--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=asnS PE=3 SV=1 158 580 7.0E-46
sp|A6L0U5|SYN_BACV8 Asparagine--tRNA ligase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=asnS PE=3 SV=1 157 580 8.0E-46
sp|Q9P6I0|SYNM_SCHPO Asparagine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=slm5 PE=3 SV=1 150 583 9.0E-46
sp|A5G5R2|SYN_GEOUR Asparagine--tRNA ligase OS=Geobacter uraniireducens (strain Rf4) GN=asnS PE=3 SV=1 157 580 2.0E-45
sp|Q8EEZ1|SYN_SHEON Asparagine--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=asnS PE=3 SV=1 141 580 2.0E-45
sp|A9A945|SYDND_METM6 Aspartate--tRNA(Asp/Asn) ligase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=aspS PE=3 SV=1 157 587 3.0E-45
sp|B1V8X4|SYN_PHYAS Asparagine--tRNA ligase OS=Phytoplasma australiense GN=asnS PE=3 SV=1 141 580 3.0E-45
sp|O48593|SYNO_ARATH Asparagine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=SYNO PE=2 SV=3 33 580 3.0E-45
sp|Q0HIB6|SYN_SHESM Asparagine--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=asnS PE=3 SV=1 141 580 3.0E-45
sp|A6VHK5|SYDND_METM7 Aspartate--tRNA(Asp/Asn) ligase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=aspS PE=3 SV=1 157 587 4.0E-45
sp|A0KXL6|SYN_SHESA Asparagine--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=asnS PE=3 SV=1 141 580 5.0E-45
sp|A5N4F7|SYN_CLOK5 Asparagine--tRNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=asnS PE=3 SV=1 160 586 5.0E-45
sp|Q1DA04|SYN_MYXXD Asparagine--tRNA ligase OS=Myxococcus xanthus (strain DK 1622) GN=asnS PE=3 SV=1 150 583 5.0E-45
sp|P25345|SYNM_YEAST Asparagine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLM5 PE=1 SV=1 160 573 6.0E-45
sp|Q081Q0|SYN_SHEFN Asparagine--tRNA ligase OS=Shewanella frigidimarina (strain NCIMB 400) GN=asnS PE=3 SV=1 141 580 7.0E-45
sp|A9KZ30|SYN_SHEB9 Asparagine--tRNA ligase OS=Shewanella baltica (strain OS195) GN=asnS PE=3 SV=1 141 580 7.0E-45
sp|A3D3V7|SYN_SHEB5 Asparagine--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=asnS PE=3 SV=1 153 580 7.0E-45
sp|Q7NBM9|SYN_MYCGA Asparagine--tRNA ligase OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=asnS PE=3 SV=2 142 584 8.0E-45
sp|Q3IGU4|SYN_PSEHT Asparagine--tRNA ligase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=asnS PE=3 SV=1 158 583 8.0E-45
sp|A6WMP4|SYN_SHEB8 Asparagine--tRNA ligase OS=Shewanella baltica (strain OS185) GN=asnS PE=3 SV=1 141 580 8.0E-45
sp|Q979P6|SYD_THEVO Aspartate--tRNA(Asp) ligase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=aspS PE=3 SV=1 266 587 1.0E-44
sp|Q15UN9|SYN_PSEA6 Asparagine--tRNA ligase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=asnS PE=3 SV=1 157 586 2.0E-44
sp|A6TVS9|SYN_ALKMQ Asparagine--tRNA ligase OS=Alkaliphilus metalliredigens (strain QYMF) GN=asnS PE=3 SV=1 143 580 3.0E-44
sp|Q2SJV9|SYN_HAHCH Asparagine--tRNA ligase OS=Hahella chejuensis (strain KCTC 2396) GN=asnS PE=3 SV=1 150 580 4.0E-44
sp|A5HZE1|SYN_CLOBH Asparagine--tRNA ligase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=asnS PE=3 SV=1 146 586 4.0E-44
sp|A7FRK8|SYN_CLOB1 Asparagine--tRNA ligase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=asnS PE=3 SV=1 146 586 4.0E-44
sp|A8H467|SYN_SHEPA Asparagine--tRNA ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=asnS PE=3 SV=1 157 580 4.0E-44
sp|A1RK52|SYN_SHESW Asparagine--tRNA ligase OS=Shewanella sp. (strain W3-18-1) GN=asnS PE=3 SV=1 141 580 4.0E-44
sp|A4Y6E4|SYN_SHEPC Asparagine--tRNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=asnS PE=3 SV=1 141 580 4.0E-44
sp|Q12XU7|SYDND_METBU Aspartate--tRNA(Asp/Asn) ligase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=aspS PE=3 SV=1 159 587 5.0E-44
sp|B0TUU1|SYN_SHEHH Asparagine--tRNA ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=asnS PE=3 SV=1 157 580 5.0E-44
sp|Q73P19|SYN_TREDE Asparagine--tRNA ligase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=asnS PE=3 SV=1 156 580 6.0E-44
sp|O24822|SYDND_HALVO Aspartate--tRNA(Asp/Asn) ligase OS=Haloferax volcanii GN=aspS PE=3 SV=2 154 587 7.0E-44
sp|Q39SY7|SYN_GEOMG Asparagine--tRNA ligase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=asnS PE=3 SV=1 153 580 8.0E-44
sp|Q6LPQ6|SYN_PHOPR Asparagine--tRNA ligase OS=Photobacterium profundum GN=asnS PE=3 SV=1 158 580 8.0E-44
sp|B0BNV4|SYN_ACTPJ Asparagine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=asnS PE=3 SV=1 157 580 9.0E-44
sp|A9NE58|SYN_ACHLI Asparagine--tRNA ligase OS=Acholeplasma laidlawii (strain PG-8A) GN=asnS PE=3 SV=1 141 580 9.0E-44
sp|O58776|SYD_PYRHO Aspartate--tRNA(Asp) ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=aspS PE=3 SV=1 157 587 1.0E-43
sp|Q52428|SYD_THEKO Aspartate--tRNA(Asp) ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=aspS PE=1 SV=2 266 587 1.0E-43
sp|Q481G3|SYN_COLP3 Asparagine--tRNA ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=asnS PE=3 SV=1 160 580 2.0E-43
sp|Q6KZQ3|SYD_PICTO Aspartate--tRNA(Asp) ligase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=aspS PE=3 SV=1 160 587 2.0E-43
sp|A6VNV7|SYN_ACTSZ Asparagine--tRNA ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=asnS PE=3 SV=1 157 580 2.0E-43
sp|B3H198|SYN_ACTP7 Asparagine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=asnS PE=3 SV=1 157 580 2.0E-43
sp|A3N039|SYN_ACTP2 Asparagine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=asnS PE=3 SV=1 157 580 2.0E-43
sp|Q72G53|SYN_DESVH Asparagine--tRNA ligase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=asnS PE=3 SV=1 160 583 2.0E-43
sp|A1V9B8|SYN_DESVV Asparagine--tRNA ligase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=asnS PE=3 SV=1 160 583 2.0E-43
sp|A7GB01|SYN_CLOBL Asparagine--tRNA ligase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=asnS PE=3 SV=1 160 586 3.0E-43
sp|Q7VLL7|SYN_HAEDU Asparagine--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=asnS PE=3 SV=1 157 580 3.0E-43
sp|Q5QZ13|SYN_IDILO Asparagine--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=asnS PE=3 SV=1 160 580 3.0E-43
sp|A3QE68|SYN_SHELP Asparagine--tRNA ligase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=asnS PE=3 SV=1 141 580 4.0E-43
sp|P59517|SYN_BUCBP Asparagine--tRNA ligase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=asnS PE=3 SV=1 167 580 5.0E-43
sp|O07683|SYDND_HALSA Aspartate--tRNA(Asp/Asn) ligase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=aspS PE=1 SV=1 157 587 1.0E-42
sp|Q87NH5|SYN_VIBPA Asparagine--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=asnS PE=3 SV=1 158 580 1.0E-42
sp|Q6MEC9|SYN_PARUW Asparagine--tRNA ligase OS=Protochlamydia amoebophila (strain UWE25) GN=asnS PE=3 SV=1 157 585 2.0E-42
sp|Q6HCW9|SYN_BACHK Asparagine--tRNA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=asnS PE=3 SV=1 146 586 2.0E-42
sp|Q633N6|SYN_BACCZ Asparagine--tRNA ligase OS=Bacillus cereus (strain ZK / E33L) GN=asnS PE=3 SV=1 146 586 2.0E-42
sp|Q81L32|SYN_BACAN Asparagine--tRNA ligase OS=Bacillus anthracis GN=asnS PE=3 SV=1 146 586 2.0E-42
sp|P58692|SYN_NOSS1 Asparagine--tRNA ligase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=asnS PE=3 SV=1 270 580 2.0E-42
sp|Q976I3|SYDND_SULTO Aspartate--tRNA(Asp/Asn) ligase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=aspS PE=1 SV=1 155 587 3.0E-42
sp|Q98PF2|SYN_MYCPU Asparagine--tRNA ligase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=asnS PE=3 SV=1 158 580 3.0E-42
sp|Q72ZI3|SYN_BACC1 Asparagine--tRNA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=asnS PE=3 SV=1 146 586 3.0E-42
sp|Q8K9I7|SYN_BUCAP Asparagine--tRNA ligase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=asnS PE=3 SV=1 157 580 3.0E-42
sp|A7GTK8|SYN_BACCN Asparagine--tRNA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=asnS PE=3 SV=1 159 586 4.0E-42
sp|Q11Q97|SYN_CYTH3 Asparagine--tRNA ligase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=asnS PE=3 SV=1 164 580 4.0E-42
sp|Q5H049|SYN_XANOR Asparagine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=asnS PE=3 SV=1 156 586 4.0E-42
sp|A0KIC3|SYN_AERHH Asparagine--tRNA ligase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=asnS PE=3 SV=1 157 580 5.0E-42
sp|Q8PM16|SYN_XANAC Asparagine--tRNA ligase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=asnS PE=3 SV=1 156 586 5.0E-42
sp|Q6MUF2|SYN_MYCMS Asparagine--tRNA ligase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=asnS PE=3 SV=1 160 580 6.0E-42
sp|Q2P326|SYN_XANOM Asparagine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=asnS PE=3 SV=1 156 586 7.0E-42
sp|Q2SR42|SYN_MYCCT Asparagine--tRNA ligase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=asnS PE=3 SV=1 160 580 7.0E-42
sp|Q317J6|SYN_DESAG Asparagine--tRNA ligase OS=Desulfovibrio alaskensis (strain G20) GN=asnS PE=3 SV=1 160 580 7.0E-42
sp|Q8D2U1|SYN_WIGBR Asparagine--tRNA ligase OS=Wigglesworthia glossinidia brevipalpis GN=asnS PE=3 SV=1 160 580 8.0E-42
sp|Q8Q0R2|SYDND_METMA Aspartate--tRNA(Asp/Asn) ligase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=aspS PE=1 SV=1 154 587 8.0E-42
sp|B2TI01|SYN_CLOBB Asparagine--tRNA ligase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=asnS PE=3 SV=1 139 580 9.0E-42
sp|B6YRL1|SYN_AZOPC Asparagine--tRNA ligase OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=asnS PE=3 SV=1 159 580 9.0E-42
sp|B2UXS0|SYN_CLOBA Asparagine--tRNA ligase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=asnS PE=3 SV=1 139 580 1.0E-41
sp|A1APP8|SYN_PELPD Asparagine--tRNA ligase OS=Pelobacter propionicus (strain DSM 2379) GN=asnS PE=3 SV=1 157 580 1.0E-41
sp|Q4A7W9|SYN_MYCH7 Asparagine--tRNA ligase OS=Mycoplasma hyopneumoniae (strain 7448) GN=asnS PE=3 SV=1 159 580 1.0E-41
sp|Q8TQ68|SYDND_METAC Aspartate--tRNA(Asp/Asn) ligase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=aspS PE=3 SV=1 157 587 1.0E-41
sp|A8GCJ5|SYN_SERP5 Asparagine--tRNA ligase OS=Serratia proteamaculans (strain 568) GN=asnS PE=3 SV=1 158 580 1.0E-41
sp|Q3BV23|SYN_XANC5 Asparagine--tRNA ligase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=asnS PE=3 SV=1 156 586 1.0E-41
sp|Q9PAF5|SYN_XYLFA Asparagine--tRNA ligase OS=Xylella fastidiosa (strain 9a5c) GN=asnS PE=3 SV=1 141 580 2.0E-41
sp|Q9KSF9|SYN_VIBCH Asparagine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=asnS PE=3 SV=2 158 580 2.0E-41
sp|Q817I8|SYN_BACCR Asparagine--tRNA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=asnS PE=3 SV=1 160 586 2.0E-41
sp|B0UTU8|SYN_HISS2 Asparagine--tRNA ligase OS=Histophilus somni (strain 2336) GN=asnS PE=3 SV=1 143 580 2.0E-41
sp|Q8PAC4|SYN_XANCP Asparagine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=asnS PE=3 SV=1 156 586 2.0E-41
sp|Q4UTA1|SYN_XANC8 Asparagine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=asnS PE=3 SV=1 156 586 2.0E-41
sp|Q600N9|SYN_MYCH2 Asparagine--tRNA ligase OS=Mycoplasma hyopneumoniae (strain 232) GN=asnS PE=3 SV=1 159 580 3.0E-41
sp|Q87A82|SYN_XYLFT Asparagine--tRNA ligase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=asnS PE=3 SV=1 141 586 3.0E-41
sp|A0LL53|SYN_SYNFM Asparagine--tRNA ligase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=asnS PE=3 SV=1 270 586 3.0E-41
sp|Q4A9S1|SYN_MYCHJ Asparagine--tRNA ligase OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=asnS PE=3 SV=1 159 580 3.0E-41
sp|Q023P9|SYN_SOLUE Asparagine--tRNA ligase OS=Solibacter usitatus (strain Ellin6076) GN=asnS PE=3 SV=1 157 586 5.0E-41
sp|Q0I2M9|SYN_HAES1 Asparagine--tRNA ligase OS=Haemophilus somnus (strain 129Pt) GN=asnS PE=3 SV=1 143 580 5.0E-41
sp|B8F3Y5|SYN_HAEPS Asparagine--tRNA ligase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=asnS PE=3 SV=1 157 580 5.0E-41
sp|P75521|SYN_MYCPN Asparagine--tRNA ligase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=asnS PE=3 SV=1 156 583 5.0E-41
sp|Q65TR1|SYN_MANSM Asparagine--tRNA ligase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=asnS PE=3 SV=1 157 580 6.0E-41
sp|Q492P3|SYN_BLOPB Asparagine--tRNA ligase OS=Blochmannia pennsylvanicus (strain BPEN) GN=asnS PE=3 SV=1 150 580 6.0E-41
sp|Q1LT63|SYN_BAUCH Asparagine--tRNA ligase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=asnS PE=3 SV=1 270 580 7.0E-41
sp|P58696|SYN_SALTY Asparagine--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=asnS PE=3 SV=2 270 580 8.0E-41
sp|Q66CG7|SYN_YERPS Asparagine--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=asnS PE=3 SV=1 154 580 1.0E-40
sp|A4TMZ6|SYN_YERPP Asparagine--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=asnS PE=3 SV=1 154 580 1.0E-40
sp|Q1CGI7|SYN_YERPN Asparagine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=asnS PE=3 SV=1 154 580 1.0E-40
sp|P58697|SYN_YERPE Asparagine--tRNA ligase OS=Yersinia pestis GN=asnS PE=3 SV=1 154 580 1.0E-40
sp|Q1CA47|SYN_YERPA Asparagine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=asnS PE=3 SV=1 154 580 1.0E-40
sp|A7FJU5|SYN_YERP3 Asparagine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=asnS PE=3 SV=1 154 580 1.0E-40
sp|Q8U2G6|SYD_PYRFU Aspartate--tRNA(Asp) ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=aspS PE=3 SV=1 157 587 1.0E-40
sp|Q466Y5|SYDND_METBF Aspartate--tRNA(Asp/Asn) ligase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=aspS PE=3 SV=1 157 587 1.0E-40
sp|Q32E51|SYN_SHIDS Asparagine--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=asnS PE=3 SV=1 158 580 1.0E-40
sp|Q3SYZ4|SYDC_BOVIN Aspartate--tRNA ligase, cytoplasmic OS=Bos taurus GN=DARS PE=2 SV=1 131 587 1.0E-40
sp|Q56112|SYN_SALTI Asparagine--tRNA ligase OS=Salmonella typhi GN=asnS PE=3 SV=3 160 580 1.0E-40
sp|Q5PGF0|SYN_SALPA Asparagine--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=asnS PE=3 SV=1 160 580 1.0E-40
sp|Q9Y9U7|SYDND_AERPE Aspartate--tRNA(Asp/Asn) ligase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=aspS PE=3 SV=2 157 587 1.0E-40
sp|Q7VR09|SYN_BLOFL Asparagine--tRNA ligase OS=Blochmannia floridanus GN=asnS PE=3 SV=1 156 580 2.0E-40
sp|Q5E5P2|SYN_VIBF1 Asparagine--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=asnS PE=3 SV=1 158 580 2.0E-40
sp|Q980V3|SYDND_SULSO Aspartate--tRNA(Asp/Asn) ligase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=aspS PE=3 SV=1 157 587 2.0E-40
sp|Q3Z3J0|SYN_SHISS Asparagine--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=asnS PE=3 SV=1 158 580 2.0E-40
sp|P0A8M2|SYN_SHIFL Asparagine--tRNA ligase OS=Shigella flexneri GN=asnS PE=3 SV=2 158 580 2.0E-40
sp|Q0T6B1|SYN_SHIF8 Asparagine--tRNA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=asnS PE=3 SV=1 158 580 2.0E-40
sp|Q31YR7|SYN_SHIBS Asparagine--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=asnS PE=3 SV=1 158 580 2.0E-40
sp|Q1RDS7|SYN_ECOUT Asparagine--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=asnS PE=3 SV=1 158 580 2.0E-40
sp|P0A8M0|SYN_ECOLI Asparagine--tRNA ligase OS=Escherichia coli (strain K12) GN=asnS PE=1 SV=2 158 580 2.0E-40
sp|B1IW01|SYN_ECOLC Asparagine--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=asnS PE=3 SV=1 158 580 2.0E-40
sp|P0A8M1|SYN_ECOL6 Asparagine--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=asnS PE=3 SV=2 158 580 2.0E-40
sp|Q0TJC3|SYN_ECOL5 Asparagine--tRNA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=asnS PE=3 SV=1 158 580 2.0E-40
sp|A7ZYN3|SYN_ECOHS Asparagine--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=asnS PE=3 SV=1 158 580 2.0E-40
sp|A7ZK21|SYN_ECO24 Asparagine--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=asnS PE=3 SV=1 158 580 2.0E-40
sp|Q57QZ8|SYN_SALCH Asparagine--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=asnS PE=3 SV=1 160 580 3.0E-40
sp|A4W8U9|SYN_ENT38 Asparagine--tRNA ligase OS=Enterobacter sp. (strain 638) GN=asnS PE=3 SV=1 160 580 4.0E-40
sp|A1JMN8|SYN_YERE8 Asparagine--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=asnS PE=3 SV=1 270 580 4.0E-40
sp|A5UCB9|SYN_HAEIE Asparagine--tRNA ligase OS=Haemophilus influenzae (strain PittEE) GN=asnS PE=3 SV=1 157 580 5.0E-40
sp|Q9RVH4|SYDND_DEIRA Aspartate--tRNA(Asp/Asn) ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=aspS2 PE=1 SV=1 155 587 6.0E-40
sp|P43829|SYN_HAEIN Asparagine--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=asnS PE=3 SV=2 157 580 7.0E-40
sp|P58694|SYN_ECO57 Asparagine--tRNA ligase OS=Escherichia coli O157:H7 GN=asnS PE=3 SV=2 158 580 7.0E-40
sp|A5UF16|SYN_HAEIG Asparagine--tRNA ligase OS=Haemophilus influenzae (strain PittGG) GN=asnS PE=3 SV=1 157 580 9.0E-40
sp|Q7MJS0|SYN_VIBVY Asparagine--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=asnS PE=3 SV=1 158 580 9.0E-40
sp|Q8DAF0|SYN_VIBVU Asparagine--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=asnS PE=3 SV=1 158 580 9.0E-40
sp|A6T726|SYN_KLEP7 Asparagine--tRNA ligase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=asnS PE=3 SV=1 270 580 1.0E-39
sp|A5IE87|SYN_LEGPC Asparagine--tRNA ligase OS=Legionella pneumophila (strain Corby) GN=asnS PE=3 SV=1 270 583 1.0E-39
sp|Q5R9I5|SYDC_PONAB Aspartate--tRNA ligase, cytoplasmic OS=Pongo abelii GN=DARS PE=2 SV=1 160 587 2.0E-39
sp|Q7N622|SYN_PHOLL Asparagine--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=asnS PE=3 SV=1 158 580 2.0E-39
sp|Q9SW96|SYNC1_ARATH Asparagine--tRNA ligase, cytoplasmic 1 OS=Arabidopsis thaliana GN=SYNC1 PE=1 SV=1 325 584 2.0E-39
sp|Q9V036|SYD_PYRAB Aspartate--tRNA(Asp) ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=aspS PE=3 SV=1 266 587 2.0E-39
sp|P15178|SYDC_RAT Aspartate--tRNA ligase, cytoplasmic OS=Rattus norvegicus GN=Dars PE=2 SV=1 160 587 3.0E-39
sp|Q9CN06|SYN_PASMU Asparagine--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=asnS PE=3 SV=2 157 580 3.0E-39
sp|Q5X300|SYN_LEGPA Asparagine--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=asnS PE=3 SV=1 270 583 3.0E-39
sp|O51128|SYN_BORBU Asparagine--tRNA ligase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=asnS PE=3 SV=2 157 580 4.0E-39
sp|Q922B2|SYDC_MOUSE Aspartate--tRNA ligase, cytoplasmic OS=Mus musculus GN=Dars PE=1 SV=2 131 587 4.0E-39
sp|Q6YPH3|SYN_ONYPE Asparagine--tRNA ligase OS=Onion yellows phytoplasma (strain OY-M) GN=asnS PE=3 SV=1 159 580 4.0E-39
sp|Q6F0Y5|SYN_MESFL Asparagine--tRNA ligase OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=asnS PE=3 SV=1 156 580 7.0E-39
sp|Q662R1|SYN_BORBP Asparagine--tRNA ligase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=asnS PE=3 SV=1 157 580 9.0E-39
sp|Q5WUG0|SYN_LEGPL Asparagine--tRNA ligase OS=Legionella pneumophila (strain Lens) GN=asnS PE=3 SV=1 270 583 9.0E-39
sp|B2S3J9|SYN_TREPS Asparagine--tRNA ligase OS=Treponema pallidum subsp. pallidum (strain SS14) GN=asnS PE=3 SV=1 138 580 1.0E-38
sp|O83618|SYN_TREPA Asparagine--tRNA ligase OS=Treponema pallidum (strain Nichols) GN=asnS PE=3 SV=1 138 580 1.0E-38
sp|A6LPI6|SYN_CLOB8 Asparagine--tRNA ligase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=asnS PE=3 SV=1 270 580 2.0E-38
sp|P14868|SYDC_HUMAN Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens GN=DARS PE=1 SV=2 160 587 2.0E-38
sp|B1XKH1|SYN_SYNP2 Asparagine--tRNA ligase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=asnS PE=3 SV=1 270 580 3.0E-38
sp|Q5SIC2|SYDND_THET8 Aspartate--tRNA(Asp/Asn) ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=aspS2 PE=1 SV=1 154 587 3.0E-38
sp|Q2NU85|SYN_SODGM Asparagine--tRNA ligase OS=Sodalis glossinidius (strain morsitans) GN=asnS PE=3 SV=1 158 580 4.0E-38
sp|Q9SSK1|SYNC3_ARATH Asparagine--tRNA ligase, cytoplasmic 3 OS=Arabidopsis thaliana GN=SYNC3 PE=1 SV=1 325 584 4.0E-38
sp|B3PNG8|SYN_MYCA5 Asparagine--tRNA ligase OS=Mycoplasma arthritidis (strain 158L3-1) GN=asnS PE=3 SV=1 146 586 8.0E-38
sp|P57441|SYN_BUCAI Asparagine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=asnS PE=3 SV=1 160 580 1.0E-37
sp|Q0SP63|SYN_BORAP Asparagine--tRNA ligase OS=Borrelia afzelii (strain PKo) GN=asnS PE=3 SV=1 157 580 1.0E-37
sp|P41908|SYNC_SACPA Asparagine--tRNA ligase, cytoplasmic (Fragment) OS=Saccharomyces paradoxus GN=DED81 PE=3 SV=1 501 587 1.0E-37
sp|Q2NIF5|SYN_AYWBP Asparagine--tRNA ligase OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=asnS PE=3 SV=1 270 580 4.0E-37
sp|Q8ZYM8|SYD_PYRAE Aspartate--tRNA(Asp) ligase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=aspS PE=1 SV=1 157 587 6.0E-36
sp|B3R0I1|SYN_PHYMT Asparagine--tRNA ligase OS=Phytoplasma mali (strain AT) GN=asnS PE=3 SV=1 141 579 1.0E-35
sp|Q03577|SYDC_CAEEL Aspartate--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans GN=drs-1 PE=3 SV=1 152 587 3.0E-35
sp|Q6KHD7|SYN_MYCMO Asparagine--tRNA ligase OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=asnS PE=3 SV=1 170 580 4.0E-33
sp|Q8SRQ8|SYDC_ENCCU Probable aspartate--tRNA ligase, cytoplasmic OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU06_0790 PE=3 SV=1 152 587 3.0E-32
sp|B7XHQ4|SYDC_ENTBH Probable aspartate--tRNA ligase, cytoplasmic OS=Enterocytozoon bieneusi (strain H348) GN=EBI_21705 PE=3 SV=1 129 587 4.0E-32
sp|Q75JQ1|SYDC1_DICDI Aspartate--tRNA ligase, cytoplasmic 1 OS=Dictyostelium discoideum GN=aspS1 PE=3 SV=1 259 587 7.0E-32
sp|Q8H104|SYDC1_ARATH Aspartate--tRNA ligase 1, cytoplasmic OS=Arabidopsis thaliana GN=At4g26870 PE=2 SV=1 157 587 2.0E-31
sp|P04802|SYDC_YEAST Aspartate--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPS1 PE=1 SV=3 82 587 8.0E-31
sp|O74407|SYDC_SCHPO Aspartate--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dps1 PE=1 SV=1 266 587 8.0E-29
sp|Q9M084|SYDC2_ARATH Aspartate--tRNA ligase 2, cytoplasmic OS=Arabidopsis thaliana GN=IBI1 PE=1 SV=1 158 587 2.0E-26
sp|Q5X4D5|SYK_LEGPA Lysine--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=lysS PE=3 SV=1 156 579 2.0E-19
sp|A0KNK7|SYK_AERHH Lysine--tRNA ligase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=lysS PE=3 SV=1 154 579 3.0E-19
sp|Q9SW95|SYNC2_ARATH Asparagine--tRNA ligase, cytoplasmic 2 OS=Arabidopsis thaliana GN=SYNC2 PE=1 SV=2 321 585 4.0E-19
sp|Q5ZUL6|SYK_LEGPH Lysine--tRNA ligase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=lysS PE=3 SV=1 156 579 4.0E-19
sp|A5ICT2|SYK_LEGPC Lysine--tRNA ligase OS=Legionella pneumophila (strain Corby) GN=lysS PE=3 SV=1 156 579 4.0E-19
sp|Q5WVS0|SYK_LEGPL Lysine--tRNA ligase OS=Legionella pneumophila (strain Lens) GN=lysS PE=3 SV=1 156 579 6.0E-19
sp|Q1LTU4|SYK_BAUCH Lysine--tRNA ligase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=lysS PE=3 SV=1 159 579 8.0E-19
sp|A4SJK0|SYK_AERS4 Lysine--tRNA ligase OS=Aeromonas salmonicida (strain A449) GN=lysS PE=3 SV=1 157 579 1.0E-18
sp|P95970|SYK_SULSO Lysine--tRNA ligase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=lysS PE=3 SV=1 151 579 4.0E-18
sp|Q7N1C8|SYK_PHOLL Lysine--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=lysS PE=3 SV=1 160 579 8.0E-18
sp|B2VF45|SYK_ERWT9 Lysine--tRNA ligase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=lysS PE=3 SV=1 157 579 2.0E-17
sp|A8GIP4|SYK_SERP5 Lysine--tRNA ligase OS=Serratia proteamaculans (strain 568) GN=lysS PE=3 SV=1 103 579 4.0E-17
sp|Q2NRG1|SYK_SODGM Lysine--tRNA ligase OS=Sodalis glossinidius (strain morsitans) GN=lysS PE=3 SV=1 160 579 2.0E-16
sp|Q8K9C5|SYK_BUCAP Lysine--tRNA ligase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=lysS PE=3 SV=1 157 579 3.0E-16
sp|Q6D945|SYK_PECAS Lysine--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=lysS PE=3 SV=1 157 579 5.0E-16
sp|B7ID87|SYK_THEAB Lysine--tRNA ligase OS=Thermosipho africanus (strain TCF52B) GN=lysS PE=3 SV=1 164 579 5.0E-16
sp|B4EDB2|SYK_BURCJ Lysine--tRNA ligase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=lysS PE=3 SV=1 80 579 5.0E-16
sp|A0K8P2|SYK_BURCH Lysine--tRNA ligase OS=Burkholderia cenocepacia (strain HI2424) GN=lysS PE=3 SV=1 80 579 8.0E-16
sp|B1JUZ7|SYK_BURCC Lysine--tRNA ligase OS=Burkholderia cenocepacia (strain MC0-3) GN=lysS PE=3 SV=1 80 579 8.0E-16
sp|Q1BHT1|SYK_BURCA Lysine--tRNA ligase OS=Burkholderia cenocepacia (strain AU 1054) GN=lysS PE=3 SV=1 80 579 8.0E-16
sp|C5BAR6|SYK_EDWI9 Lysine--tRNA ligase OS=Edwardsiella ictaluri (strain 93-146) GN=lysS PE=3 SV=1 144 579 1.0E-15
sp|C4LCP0|SYK_TOLAT Lysine--tRNA ligase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=lysS PE=3 SV=1 160 579 1.0E-15
sp|C6D8Z6|SYK_PECCP Lysine--tRNA ligase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=lysS PE=3 SV=1 162 579 2.0E-15
sp|A9IQY2|SYK_BORPD Lysine--tRNA ligase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=lysS PE=3 SV=1 154 579 3.0E-15
sp|Q03Z44|SYK_LEUMM Lysine--tRNA ligase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=lysS PE=3 SV=1 150 579 3.0E-15
sp|Q5QYV9|SYK_IDILO Lysine--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=lysS PE=3 SV=1 154 579 5.0E-15
sp|A1JPL4|SYK_YERE8 Lysine--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=lysS PE=3 SV=1 160 579 5.0E-15
sp|P57512|SYK_BUCAI Lysine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=lysS PE=3 SV=1 160 579 5.0E-15
sp|Q7VRF5|SYK_BLOFL Lysine--tRNA ligase OS=Blochmannia floridanus GN=lysS PE=3 SV=1 155 579 5.0E-15
sp|Q0BDR2|SYK_BURCM Lysine--tRNA ligase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=lysS PE=3 SV=1 160 579 5.0E-15
sp|B1YT20|SYK_BURA4 Lysine--tRNA ligase OS=Burkholderia ambifaria (strain MC40-6) GN=lysS PE=3 SV=1 160 579 5.0E-15
sp|B1JPH6|SYK_YERPY Lysine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=lysS PE=3 SV=1 160 579 5.0E-15
sp|Q666T3|SYK_YERPS Lysine--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=lysS PE=3 SV=1 160 579 5.0E-15
sp|A4TIC5|SYK_YERPP Lysine--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=lysS PE=3 SV=1 160 579 5.0E-15
sp|Q1CF16|SYK_YERPN Lysine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=lysS PE=3 SV=1 160 579 5.0E-15
sp|A9R4M4|SYK_YERPG Lysine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=lysS PE=3 SV=1 160 579 5.0E-15
sp|Q8ZHK5|SYK_YERPE Lysine--tRNA ligase OS=Yersinia pestis GN=lysS PE=3 SV=1 160 579 5.0E-15
sp|B2K0N6|SYK_YERPB Lysine--tRNA ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=lysS PE=3 SV=1 160 579 5.0E-15
sp|Q1CB23|SYK_YERPA Lysine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=lysS PE=3 SV=1 160 579 5.0E-15
sp|A7FF39|SYK_YERP3 Lysine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=lysS PE=3 SV=1 160 579 5.0E-15
sp|Q32BV3|SYK_SHIDS Lysine--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=lysS PE=3 SV=1 160 579 5.0E-15
sp|B4F0M6|SYK_PROMH Lysine--tRNA ligase OS=Proteus mirabilis (strain HI4320) GN=lysS PE=3 SV=1 160 579 8.0E-15
sp|P0A8N3|SYK1_ECOLI Lysine--tRNA ligase OS=Escherichia coli (strain K12) GN=lysS PE=1 SV=2 160 579 9.0E-15
sp|P0A8N4|SYK1_ECOL6 Lysine--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lysS PE=3 SV=2 160 579 9.0E-15
sp|C5BRM0|SYK_TERTT Lysine--tRNA ligase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=lysS PE=3 SV=1 160 579 9.0E-15
sp|Q31WF2|SYK_SHIBS Lysine--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=lysS PE=3 SV=1 160 579 1.0E-14
sp|A7HM68|SYK_FERNB Lysine--tRNA ligase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=lysS PE=3 SV=1 149 579 1.0E-14
sp|Q0T106|SYK_SHIF8 Lysine--tRNA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=lysS PE=3 SV=1 160 579 1.0E-14
sp|B2U0Q7|SYK_SHIB3 Lysine--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=lysS PE=3 SV=1 160 579 1.0E-14
sp|Q83JU6|SYK1_SHIFL Lysine--tRNA ligase OS=Shigella flexneri GN=lysS PE=3 SV=3 160 579 1.0E-14
sp|B2JIY1|SYK_BURP8 Lysine--tRNA ligase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=lysS PE=3 SV=1 156 579 1.0E-14
sp|Q8XD57|SYK1_ECO57 Lysine--tRNA ligase OS=Escherichia coli O157:H7 GN=lysS PE=3 SV=3 160 579 1.0E-14
sp|A4WE42|SYK_ENT38 Lysine--tRNA ligase OS=Enterobacter sp. (strain 638) GN=lysS PE=3 SV=1 160 579 1.0E-14
sp|A6LMS4|SYK_THEM4 Lysine--tRNA ligase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=lysS PE=3 SV=1 164 579 1.0E-14
sp|Q7WK46|SYK_BORBR Lysine--tRNA ligase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=lysS PE=3 SV=1 160 579 2.0E-14
sp|A8AP96|SYK_CITK8 Lysine--tRNA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=lysS PE=3 SV=1 160 579 2.0E-14
sp|A1T047|SYK_PSYIN Lysine--tRNA ligase OS=Psychromonas ingrahamii (strain 37) GN=lysS PE=3 SV=1 100 586 3.0E-14
sp|P43825|SYK_HAEIN Lysine--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lysS PE=3 SV=1 155 579 4.0E-14
sp|A7MR65|SYK_CROS8 Lysine--tRNA ligase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=lysS PE=3 SV=1 160 579 4.0E-14
sp|A3NB96|SYK_BURP6 Lysine--tRNA ligase OS=Burkholderia pseudomallei (strain 668) GN=lysS PE=3 SV=1 156 579 6.0E-14
sp|A9MRI4|SYK_SALAR Lysine--tRNA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=lysS PE=3 SV=1 160 579 6.0E-14
sp|Q3JQP3|SYK_BURP1 Lysine--tRNA ligase OS=Burkholderia pseudomallei (strain 1710b) GN=lysS PE=3 SV=1 156 579 6.0E-14
sp|Q7VZ37|SYK_BORPE Lysine--tRNA ligase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=lysS PE=3 SV=1 160 579 7.0E-14
sp|A3NX27|SYK_BURP0 Lysine--tRNA ligase OS=Burkholderia pseudomallei (strain 1106a) GN=lysS PE=3 SV=1 156 579 7.0E-14
sp|A1V5L6|SYK_BURMS Lysine--tRNA ligase OS=Burkholderia mallei (strain SAVP1) GN=lysS PE=3 SV=1 156 579 7.0E-14
sp|Q62IZ9|SYK_BURMA Lysine--tRNA ligase OS=Burkholderia mallei (strain ATCC 23344) GN=lysS PE=3 SV=1 156 579 7.0E-14
sp|A2SAT3|SYK_BURM9 Lysine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10229) GN=lysS PE=3 SV=1 156 579 7.0E-14
sp|A3ML91|SYK_BURM7 Lysine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10247) GN=lysS PE=3 SV=1 156 579 7.0E-14
sp|Q63SN9|SYK_BURPS Lysine--tRNA ligase OS=Burkholderia pseudomallei (strain K96243) GN=lysS PE=3 SV=1 156 579 9.0E-14
sp|Q559M9|SYDC2_DICDI Aspartate--tRNA ligase, cytoplasmic 2 OS=Dictyostelium discoideum GN=aspS2 PE=3 SV=1 152 587 9.0E-14
sp|A6VPH6|SYK_ACTSZ Lysine--tRNA ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=lysS PE=3 SV=1 156 579 9.0E-14
sp|A5UCQ0|SYK_HAEIE Lysine--tRNA ligase OS=Haemophilus influenzae (strain PittEE) GN=lysS PE=3 SV=1 156 579 1.0E-13
sp|A5N4L1|SYK_CLOK5 Lysine--tRNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=lysS PE=3 SV=1 157 579 1.0E-13
sp|A4JFZ6|SYK_BURVG Lysine--tRNA ligase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=lysS PE=3 SV=1 160 579 1.0E-13
sp|Q03E09|SYK_PEDPA Lysine--tRNA ligase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=lysS PE=3 SV=1 250 579 1.0E-13
sp|A5UIX4|SYK_HAEIG Lysine--tRNA ligase OS=Haemophilus influenzae (strain PittGG) GN=lysS PE=3 SV=1 156 579 2.0E-13
sp|Q17YS1|SYK_HELAH Lysine--tRNA ligase OS=Helicobacter acinonychis (strain Sheeba) GN=lysS PE=3 SV=1 162 579 2.0E-13
sp|Q0B0N3|SYK_SYNWW Lysine--tRNA ligase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=lysS PE=3 SV=1 156 585 2.0E-13
sp|Q8FAT5|SYK2_ECOL6 Lysine--tRNA ligase, heat inducible OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lysU PE=3 SV=3 160 579 3.0E-13
sp|B0URW9|SYK_HISS2 Lysine--tRNA ligase OS=Histophilus somni (strain 2336) GN=lysS PE=3 SV=1 156 579 3.0E-13
sp|P0A8N5|SYK2_ECOLI Lysine--tRNA ligase, heat inducible OS=Escherichia coli (strain K12) GN=lysU PE=1 SV=2 160 579 3.0E-13
sp|P0A8N6|SYK2_ECO57 Lysine--tRNA ligase, heat inducible OS=Escherichia coli O157:H7 GN=lysU PE=3 SV=2 160 579 3.0E-13
sp|Q83E97|SYK_COXBU Lysine--tRNA ligase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=lysS PE=3 SV=1 156 579 3.0E-13
sp|A9NBP7|SYK_COXBR Lysine--tRNA ligase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=lysS PE=3 SV=1 156 579 3.0E-13
sp|A9KEG1|SYK_COXBN Lysine--tRNA ligase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=lysS PE=3 SV=1 156 579 3.0E-13
sp|B6J1P6|SYK_COXB2 Lysine--tRNA ligase OS=Coxiella burnetii (strain CbuG_Q212) GN=lysS PE=3 SV=1 156 579 3.0E-13
sp|B6J8K2|SYK_COXB1 Lysine--tRNA ligase OS=Coxiella burnetii (strain CbuK_Q154) GN=lysS PE=3 SV=1 156 579 3.0E-13
sp|A0L6F7|SYK_MAGMM Lysine--tRNA ligase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=lysS PE=3 SV=1 123 580 3.0E-13
sp|Q13WZ5|SYK_BURXL Lysine--tRNA ligase OS=Burkholderia xenovorans (strain LB400) GN=lysS PE=3 SV=1 160 579 3.0E-13
sp|Q0SQ86|SYK_CLOPS Lysine--tRNA ligase OS=Clostridium perfringens (strain SM101 / Type A) GN=lysS PE=3 SV=1 156 579 4.0E-13
sp|B4TUQ8|SYK_SALSV Lysine--tRNA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=lysS PE=3 SV=1 160 579 4.0E-13
sp|B5BFK5|SYK_SALPK Lysine--tRNA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=lysS PE=3 SV=1 160 579 4.0E-13
sp|A9N3L6|SYK_SALPB Lysine--tRNA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=lysS PE=3 SV=1 160 579 4.0E-13
sp|Q5PL30|SYK_SALPA Lysine--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=lysS PE=3 SV=1 160 579 4.0E-13
sp|B4T535|SYK_SALNS Lysine--tRNA ligase OS=Salmonella newport (strain SL254) GN=lysS PE=3 SV=1 160 579 4.0E-13
sp|B4TGW0|SYK_SALHS Lysine--tRNA ligase OS=Salmonella heidelberg (strain SL476) GN=lysS PE=3 SV=1 160 579 4.0E-13
sp|B5RE01|SYK_SALG2 Lysine--tRNA ligase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=lysS PE=3 SV=1 160 579 4.0E-13
sp|B5QXG7|SYK_SALEP Lysine--tRNA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=lysS PE=3 SV=1 160 579 4.0E-13
sp|B5FUF3|SYK_SALDC Lysine--tRNA ligase OS=Salmonella dublin (strain CT_02021853) GN=lysS PE=3 SV=1 160 579 4.0E-13
sp|Q57K76|SYK_SALCH Lysine--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=lysS PE=3 SV=1 160 579 4.0E-13
sp|B5F5G4|SYK_SALA4 Lysine--tRNA ligase OS=Salmonella agona (strain SL483) GN=lysS PE=3 SV=1 160 579 4.0E-13
sp|P28354|SYK1_SALTY Lysine--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=lysS PE=3 SV=3 160 579 4.0E-13
sp|Q8Z3X8|SYK1_SALTI Lysine--tRNA ligase OS=Salmonella typhi GN=lysS PE=3 SV=3 160 579 4.0E-13
sp|B5Z9V6|SYK_HELPG Lysine--tRNA ligase OS=Helicobacter pylori (strain G27) GN=lysS PE=3 SV=1 162 579 5.0E-13
sp|B6JPT1|SYK_HELP2 Lysine--tRNA ligase OS=Helicobacter pylori (strain P12) GN=lysS PE=3 SV=1 162 579 5.0E-13
sp|B2US13|SYK_HELPS Lysine--tRNA ligase OS=Helicobacter pylori (strain Shi470) GN=lysS PE=3 SV=1 162 579 5.0E-13
sp|Q1CUX6|SYK_HELPH Lysine--tRNA ligase OS=Helicobacter pylori (strain HPAG1) GN=lysS PE=3 SV=1 162 579 6.0E-13
sp|Q8XHL8|SYK_CLOPE Lysine--tRNA ligase OS=Clostridium perfringens (strain 13 / Type A) GN=lysS PE=3 SV=1 156 579 6.0E-13
sp|Q0TMI7|SYK_CLOP1 Lysine--tRNA ligase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=lysS PE=3 SV=1 156 579 6.0E-13
sp|B8GRJ2|SYK_THISH Lysine--tRNA ligase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=lysS PE=3 SV=1 159 579 6.0E-13
sp|Q4JCI5|SYK_SULAC Lysine--tRNA ligase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=lysS PE=3 SV=1 164 585 7.0E-13
sp|P57822|SYK_PASMU Lysine--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=lysS PE=3 SV=1 160 579 8.0E-13
sp|C0PY12|SYK_SALPC Lysine--tRNA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=lysS PE=3 SV=1 160 579 8.0E-13
sp|B0BP90|SYK_ACTPJ Lysine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=lysS PE=3 SV=1 159 579 8.0E-13
sp|A3N0G9|SYK_ACTP2 Lysine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=lysS PE=3 SV=1 159 579 8.0E-13
sp|Q7W8T6|SYK_BORPA Lysine--tRNA ligase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=lysS PE=3 SV=1 160 579 9.0E-13
sp|P56126|SYK_HELPY Lysine--tRNA ligase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=lysS PE=3 SV=1 162 579 9.0E-13
sp|Q7VLU5|SYK_HAEDU Lysine--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=lysS PE=3 SV=1 158 579 1.0E-12
sp|Q9RHV9|SYK_GEOSE Lysine--tRNA ligase OS=Geobacillus stearothermophilus GN=lysS PE=1 SV=1 160 580 1.0E-12
sp|A1AWN8|SYK_RUTMC Lysine--tRNA ligase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=lysS PE=3 SV=1 124 579 1.0E-12
sp|Q3ARD7|SYK_CHLCH Lysine--tRNA ligase OS=Chlorobium chlorochromatii (strain CaD3) GN=lysS PE=3 SV=1 158 579 2.0E-12
sp|Q12JH2|SYK_SHEDO Lysine--tRNA ligase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=lysS PE=3 SV=1 157 579 2.0E-12
sp|B1KTC1|SYK_CLOBM Lysine--tRNA ligase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=lysS PE=3 SV=1 156 579 3.0E-12
sp|A5GQ58|SYK_SYNR3 Lysine--tRNA ligase OS=Synechococcus sp. (strain RCC307) GN=lysS PE=3 SV=1 150 579 3.0E-12
sp|Q899G7|SYK_CLOTE Lysine--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=lysS PE=3 SV=1 160 579 4.0E-12
sp|Q1H372|SYK_METFK Lysine--tRNA ligase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=lysS PE=3 SV=1 160 579 4.0E-12
sp|A7GJB3|SYK_CLOBL Lysine--tRNA ligase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=lysS PE=3 SV=1 156 579 4.0E-12
sp|B1IGJ2|SYK_CLOBK Lysine--tRNA ligase OS=Clostridium botulinum (strain Okra / Type B1) GN=lysS PE=3 SV=1 156 579 4.0E-12
sp|B2SXV7|SYK_BURPP Lysine--tRNA ligase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=lysS PE=3 SV=1 160 579 5.0E-12
sp|B3H1E8|SYK_ACTP7 Lysine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=lysS PE=3 SV=1 159 579 5.0E-12
sp|Q3ZWX9|SYK_DEHMC Lysine--tRNA ligase OS=Dehalococcoides mccartyi (strain CBDB1) GN=lysS PE=3 SV=1 155 584 7.0E-12
sp|Q8F4P5|SYK_LEPIN Lysine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=lysS PE=3 SV=1 158 579 8.0E-12
sp|Q72R38|SYK_LEPIC Lysine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=lysS PE=3 SV=1 158 579 8.0E-12
sp|Q88Z28|SYK_LACPL Lysine--tRNA ligase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=lysS PE=3 SV=1 298 579 8.0E-12
sp|A5FRN5|SYK_DEHMB Lysine--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=lysS PE=3 SV=1 155 584 9.0E-12
sp|A8F4K1|SYK_PSELT Lysine--tRNA ligase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=lysS PE=3 SV=1 164 579 9.0E-12
sp|B1KFR7|SYK_SHEWM Lysine--tRNA ligase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=lysS PE=3 SV=1 144 579 1.0E-11
sp|Q5N1D9|SYK_SYNP6 Lysine--tRNA ligase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=lysS PE=3 SV=1 150 579 1.0E-11
sp|Q31KH4|SYK_SYNE7 Lysine--tRNA ligase OS=Synechococcus elongatus (strain PCC 7942) GN=lysS PE=3 SV=1 150 579 1.0E-11
sp|Q89AC5|SYK_BUCBP Lysine--tRNA ligase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=lysS PE=3 SV=1 160 579 2.0E-11
sp|Q2SL47|SYK_HAHCH Lysine--tRNA ligase OS=Hahella chejuensis (strain KCTC 2396) GN=lysS PE=3 SV=1 158 579 2.0E-11
sp|Q9ZMP8|SYK_HELPJ Lysine--tRNA ligase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=lysS PE=3 SV=1 162 579 2.0E-11
sp|A3CY14|SYK_METMJ Lysine--tRNA ligase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=lysS PE=3 SV=1 160 580 2.0E-11
sp|A1K5J9|SYK_AZOSB Lysine--tRNA ligase OS=Azoarcus sp. (strain BH72) GN=lysS PE=3 SV=1 160 580 3.0E-11
sp|A5I7P4|SYK_CLOBH Lysine--tRNA ligase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=lysS PE=3 SV=1 156 579 3.0E-11
sp|A7FZA5|SYK_CLOB1 Lysine--tRNA ligase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=lysS PE=3 SV=1 156 579 3.0E-11
sp|Q8DMA9|SYK_THEEB Lysine--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=lysS PE=3 SV=1 142 579 3.0E-11
sp|Q0IDW9|SYK_SYNS3 Lysine--tRNA ligase OS=Synechococcus sp. (strain CC9311) GN=lysS PE=3 SV=1 129 579 3.0E-11
sp|B1MVJ0|SYK_LEUCK Lysine--tRNA ligase OS=Leuconostoc citreum (strain KM20) GN=lysS PE=3 SV=1 160 579 4.0E-11
sp|Q1QAW5|SYK_PSYCK Lysine--tRNA ligase OS=Psychrobacter cryohalolentis (strain K5) GN=lysS PE=3 SV=1 158 579 5.0E-11
sp|P73443|SYK_SYNY3 Lysine--tRNA ligase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=lysS PE=3 SV=1 94 579 5.0E-11
sp|Q7MAR1|SYK_WOLSU Lysine--tRNA ligase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=lysS PE=3 SV=1 164 579 6.0E-11
sp|Q7VFL0|SYK_HELHP Lysine--tRNA ligase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=lysS PE=3 SV=1 162 579 6.0E-11
sp|B6EMX2|SYK_ALISL Lysine--tRNA ligase OS=Aliivibrio salmonicida (strain LFI1238) GN=lysS PE=3 SV=1 262 579 6.0E-11
sp|B4SB22|SYK_PELPB Lysine--tRNA ligase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=lysS PE=3 SV=1 158 579 6.0E-11
sp|Q057G7|SYK_BUCCC Lysine--tRNA ligase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=lysS PE=3 SV=1 159 579 8.0E-11
sp|A8H0J7|SYK_SHEPA Lysine--tRNA ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=lysS PE=3 SV=1 254 579 9.0E-11
sp|B1GZY6|SYDND_UNCTG Aspartate--tRNA(Asp/Asn) ligase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=aspS PE=3 SV=1 157 442 1.0E-10
sp|Q47C53|SYK_DECAR Lysine--tRNA ligase OS=Dechloromonas aromatica (strain RCB) GN=lysS PE=3 SV=1 160 579 1.0E-10
sp|A1KUN1|SYK_NEIMF Lysine--tRNA ligase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=lysS PE=3 SV=1 156 581 2.0E-10
sp|Q9JTT7|SYK_NEIMA Lysine--tRNA ligase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=lysS PE=3 SV=1 156 581 2.0E-10
sp|Q43990|SYK_ACIAD Lysine--tRNA ligase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=lysS PE=3 SV=1 158 579 2.0E-10
sp|Q050Q1|SYK_LEPBL Lysine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=lysS PE=3 SV=1 158 579 2.0E-10
sp|Q04SM4|SYK_LEPBJ Lysine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=lysS PE=3 SV=1 158 579 2.0E-10
sp|Q9JYU6|SYK_NEIMB Lysine--tRNA ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=lysS PE=3 SV=1 156 581 2.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0000166 nucleotide binding Yes
GO:0005524 ATP binding Yes
GO:0003676 nucleic acid binding Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0006418 tRNA aminoacylation for protein translation Yes
GO:0044281 small molecule metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006399 tRNA metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0006520 cellular amino acid metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0043436 oxoacid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0043168 anion binding No
GO:0019752 carboxylic acid metabolic process No
GO:0043167 ion binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0097159 organic cyclic compound binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0016874 ligase activity No
GO:0043038 amino acid activation No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0036094 small molecule binding No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:0043039 tRNA aminoacylation No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4332
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6271 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6938
Ophiocordyceps camponoti-floridani Ophcf2|01880
Ophiocordyceps camponoti-rufipedis Ophun1|6567
Ophiocordyceps kimflemingae Ophio5|4050
Ophiocordyceps subramaniannii Hirsu2|89

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6271
MAAVQGLSERVKADDKLHVDSDTGTDDGSADGSQAKPYKSLAFACIQNMHRSDVHYLVRASVTGAISPGEDASAR
LIWRQPAKSAVKKAQGALDAHKKKMAKQQQAQAAEDARKQQRLGNLEAARKIVLEQDSSLPEAVKMVIADKAVHL
GNGAHKGTRVKVFGRIHRLRAQKQATFITLVDGGGQLQCVLPAGDLTRTYDSLTFAQGTSLALYGEMREVPQGQQ
APDNRELHVDFYQVIGTSPGDDEAITNKVSSAQNQWDQQMLDNRHLVLRGENASSLMKLRSHVEWAFIKTYHDMK
FVKVSPPALVQTQVEGGATLFKVPYYDEEAYLTQSSQLYLETVIPSLGNVYCIEKSFRAEKSLTRRHLSEYTHVE
GELDFIDFDGLLLHLEELMCRVIDMIVDDAKMATLLQELNPGFTRPTRPFMRIRYSDAIEWLNKQDPPILNEDGN
PHVFGDDIAEAAERKMTDIINRPIFLTHFPVEIKAFYMKKDSSDPRVTESVDCLMPGVGEIVGGSMRMEDYGELL
AAYKRQGIPAKDYYWYTDQRKYGTSPHGGYGLGLERFIAWLANQHTVRTTCLYPRFMGRCKP*
Coding >OphauG2|6271
ATGGCTGCCGTGCAGGGGCTCTCCGAGCGCGTCAAGGCCGACGATAAGCTCCATGTGGATAGCGACACGGGCACC
GACGATGGCTCGGCTGACGGCTCCCAGGCCAAGCCCTATAAATCGCTCGCCTTTGCCTGTATCCAAAACATGCAT
CGTTCCGACGTGCACTATCTGGTCCGCGCGTCTGTCACCGGAGCCATATCGCCAGGAGAAGACGCCTCGGCCCGC
TTAATCTGGCGACAGCCAGCAAAGAGTGCTGTCAAGAAGGCTCAAGGCGCTCTCGACGCCCACAAGAAAAAGATG
GCAAAGCAGCAGCAGGCCCAGGCTGCCGAGGATGCCAGGAAGCAGCAGCGTCTCGGCAACCTGGAAGCGGCGCGC
AAGATTGTCCTGGAACAAGACTCGTCGCTGCCAGAGGCAGTCAAGATGGTTATTGCCGACAAAGCGGTCCATCTG
GGTAACGGTGCTCACAAGGGCACCCGAGTCAAGGTCTTTGGCCGCATCCATCGCTTAAGAGCGCAAAAGCAGGCC
ACTTTTATCACTCTCGTCGACGGCGGCGGACAGCTGCAATGCGTTTTGCCTGCTGGCGACTTAACGCGCACCTAT
GATTCCCTGACTTTTGCCCAAGGCACTTCTCTGGCCCTCTACGGCGAAATGCGTGAGGTTCCCCAAGGCCAGCAA
GCTCCCGATAACCGCGAGCTCCACGTCGACTTTTACCAAGTCATTGGCACGTCGCCCGGCGACGACGAGGCCATA
ACCAACAAGGTTTCCTCGGCACAGAACCAATGGGACCAGCAAATGCTCGACAACAGGCATCTCGTCCTCCGCGGT
GAAAATGCTTCTTCTCTCATGAAGCTACGATCTCATGTTGAGTGGGCCTTTATCAAGACCTATCATGACATGAAG
TTTGTCAAGGTCTCGCCTCCTGCTTTGGTGCAGACGCAGGTGGAGGGTGGCGCTACCCTCTTCAAGGTGCCATAT
TACGATGAGGAGGCCTATCTTACCCAGTCTTCCCAGCTATACTTAGAGACGGTCATTCCTAGTCTTGGAAACGTC
TATTGCATCGAAAAGTCATTTCGCGCTGAGAAGAGCCTCACGCGGCGTCACTTGTCAGAGTACACGCACGTCGAG
GGCGAGCTGGACTTTATCGACTTTGATGGTCTGCTGCTTCATCTCGAAGAGCTCATGTGCCGCGTCATTGACATG
ATAGTCGACGACGCCAAAATGGCGACCCTGCTCCAGGAGCTCAATCCCGGCTTCACGCGGCCGACGCGCCCATTC
ATGCGAATCAGGTACTCGGACGCCATTGAATGGCTCAACAAGCAGGATCCACCCATTCTCAACGAAGATGGAAAC
CCACACGTTTTTGGCGACGACATTGCCGAGGCGGCTGAGCGAAAAATGACAGACATCATCAATCGCCCCATATTT
CTCACCCATTTCCCCGTCGAGATCAAAGCCTTTTACATGAAGAAGGATTCCAGCGACCCCAGAGTCACCGAGAGC
GTCGACTGCCTGATGCCAGGCGTTGGTGAGATAGTGGGCGGGTCAATGAGAATGGAAGACTATGGCGAGCTGCTA
GCGGCATACAAGAGACAAGGCATTCCGGCAAAGGACTACTACTGGTATACAGACCAACGCAAATATGGAACTTCG
CCACATGGCGGCTATGGGCTAGGCCTCGAGCGCTTCATTGCCTGGTTAGCCAACCAACATACCGTGCGAACCACG
TGTTTATACCCCCGCTTCATGGGCCGGTGCAAGCCTTGA
Transcript >OphauG2|6271
ATGGCTGCCGTGCAGGGGCTCTCCGAGCGCGTCAAGGCCGACGATAAGCTCCATGTGGATAGCGACACGGGCACC
GACGATGGCTCGGCTGACGGCTCCCAGGCCAAGCCCTATAAATCGCTCGCCTTTGCCTGTATCCAAAACATGCAT
CGTTCCGACGTGCACTATCTGGTCCGCGCGTCTGTCACCGGAGCCATATCGCCAGGAGAAGACGCCTCGGCCCGC
TTAATCTGGCGACAGCCAGCAAAGAGTGCTGTCAAGAAGGCTCAAGGCGCTCTCGACGCCCACAAGAAAAAGATG
GCAAAGCAGCAGCAGGCCCAGGCTGCCGAGGATGCCAGGAAGCAGCAGCGTCTCGGCAACCTGGAAGCGGCGCGC
AAGATTGTCCTGGAACAAGACTCGTCGCTGCCAGAGGCAGTCAAGATGGTTATTGCCGACAAAGCGGTCCATCTG
GGTAACGGTGCTCACAAGGGCACCCGAGTCAAGGTCTTTGGCCGCATCCATCGCTTAAGAGCGCAAAAGCAGGCC
ACTTTTATCACTCTCGTCGACGGCGGCGGACAGCTGCAATGCGTTTTGCCTGCTGGCGACTTAACGCGCACCTAT
GATTCCCTGACTTTTGCCCAAGGCACTTCTCTGGCCCTCTACGGCGAAATGCGTGAGGTTCCCCAAGGCCAGCAA
GCTCCCGATAACCGCGAGCTCCACGTCGACTTTTACCAAGTCATTGGCACGTCGCCCGGCGACGACGAGGCCATA
ACCAACAAGGTTTCCTCGGCACAGAACCAATGGGACCAGCAAATGCTCGACAACAGGCATCTCGTCCTCCGCGGT
GAAAATGCTTCTTCTCTCATGAAGCTACGATCTCATGTTGAGTGGGCCTTTATCAAGACCTATCATGACATGAAG
TTTGTCAAGGTCTCGCCTCCTGCTTTGGTGCAGACGCAGGTGGAGGGTGGCGCTACCCTCTTCAAGGTGCCATAT
TACGATGAGGAGGCCTATCTTACCCAGTCTTCCCAGCTATACTTAGAGACGGTCATTCCTAGTCTTGGAAACGTC
TATTGCATCGAAAAGTCATTTCGCGCTGAGAAGAGCCTCACGCGGCGTCACTTGTCAGAGTACACGCACGTCGAG
GGCGAGCTGGACTTTATCGACTTTGATGGTCTGCTGCTTCATCTCGAAGAGCTCATGTGCCGCGTCATTGACATG
ATAGTCGACGACGCCAAAATGGCGACCCTGCTCCAGGAGCTCAATCCCGGCTTCACGCGGCCGACGCGCCCATTC
ATGCGAATCAGGTACTCGGACGCCATTGAATGGCTCAACAAGCAGGATCCACCCATTCTCAACGAAGATGGAAAC
CCACACGTTTTTGGCGACGACATTGCCGAGGCGGCTGAGCGAAAAATGACAGACATCATCAATCGCCCCATATTT
CTCACCCATTTCCCCGTCGAGATCAAAGCCTTTTACATGAAGAAGGATTCCAGCGACCCCAGAGTCACCGAGAGC
GTCGACTGCCTGATGCCAGGCGTTGGTGAGATAGTGGGCGGGTCAATGAGAATGGAAGACTATGGCGAGCTGCTA
GCGGCATACAAGAGACAAGGCATTCCGGCAAAGGACTACTACTGGTATACAGACCAACGCAAATATGGAACTTCG
CCACATGGCGGCTATGGGCTAGGCCTCGAGCGCTTCATTGCCTGGTTAGCCAACCAACATACCGTGCGAACCACG
TGTTTATACCCCCGCTTCATGGGCCGGTGCAAGCCTTGA
Gene >OphauG2|6271
ATGGCTGCCGTGCAGGGGCTCTCCGAGCGCGTCAAGGCCGACGATAAGCTCCATGTGGATAGCGACACGGGCACC
GACGATGGCTCGGCTGACGGCTCCCAGGCCAAGCCCTATAAATCGCTCGCCTTTGCCTGTATCCAAAACATGCAT
CGTTCCGACGTGCACTATCTGGTCCGCGCGTCTGTCACCGGAGCCATATCGCCAGGAGAAGACGCCTCGGCCCGC
TTAATCTGGCGACAGCCAGCAAAGAGTGCTGTCAAGAAGGCTCAAGGCGCTCTCGACGCCCACAAGAAAAAGATG
GCAAAGCAGCAGCAGGCCCAGGCTGCCGAGGATGCCAGGAAGCAGCAGCGTCTCGGCAACCTGGAAGCGGCGCGC
AAGATTGTCCTGGAACAAGACTCGTCGCTGCCAGAGGCAGTCAAGATGGTTATTGCCGACAAAGCGGTCCATCTG
GGTAACGGTGCTCACAAGGGCACCCGAGTCAAGGTCTTTGGCCGCATCCATCGCTTAAGAGCGCAAAAGCAGGCC
ACTTTTATCACTCTCGTCGACGGCGGCGGACAGCTGCAATGCGTTTTGCCTGCTGGCGACTTAACGCGCACCTAT
GATTCCCTGACTTTTGCCCAAGGCACTTCTCTGGCCCTCTACGGCGAAATGCGTGAGGTTCCCCAAGGCCAGCAA
GCTCCCGATAACCGCGAGCTCCACGTCGACTTTTACCAAGTCATTGGCACGTCGCCCGGCGACGACGAGGCCATA
ACCAACAAGGTTTCCTCGGCACAGAACCAATGGGACCAGCAAATGCTCGACAACAGGCATCTCGTCCTCCGCGGT
GAAAATGCTTCTTCTCTCATGAAGCTACGATCTCATGTTGAGTGGGCCTTTATCAAGACCTATCATGACATGAAG
TTTGTCAAGGTCTCGCCTCCTGCTTTGGTGCAGACGCAGGTGGAGGGTGGCGCTACCCTCTTCAAGGTGCCATAT
TACGATGAGGAGGCCTATCTTACCCAGTCTTCCCAGCTATACTTAGAGACGGTCATTCCTAGTCTTGGAAACGTC
TATTGCATCGAAAAGTCATTTCGCGCTGAGAAGAGCCTCACGCGGCGTCACTTGTCAGAGTACACGCACGTCGAG
GGCGAGCTGGACTTTATCGACTTTGATGGTCTGCTGCTTCATCTCGAAGAGCTCATGTGCCGCGTCATTGACATG
ATAGTCGACGACGCCAAAATGGCGACCCTGCTCCAGGAGCTCAATCCCGGCTTCACGCGGCCGACGCGCCCATTC
ATGCGAATCAGGTACTCGGACGCCATTGAATGGCTCAACAAGCAGGATCCACCCATTCTCAACGAAGATGGAAAC
CCACACGTTTTTGGCGACGACATTGCCGAGGCGGCTGAGCGAAAAATGACAGACATCATCAATCGCCCCATATTT
CTCACCCATTTCCCCGTCGAGATCAAAGCCTTTTACATGAAGAAGGATTCCAGCGACCCCAGAGTCACCGAGAGC
GTCGACTGCCTGATGCCAGGCGTTGGTGAGATAGTGGGCGGGTCAATGAGAATGGAAGACTATGGCGAGCTGCTA
GCGGCATACAAGAGACAAGGCATTCCGGCAAAGGACTACTACTGGTATACAGACCAACGCAAGTCAGTTGGATGA
GTACCATGATCAAAAAGTGACAAAGAGGCTAATCTTGAGCATCAGATATGGAACTTCGCCACATGGCGGCTATGG
GCTAGGCCTCGAGCGCTTCATTGCCTGGTTAGCCAACCAACATACCGTGCGAACCACGTGTTTATACCCCCGCTT
CATGGGCCGGTGCAAGCCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail