Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|627
Gene name
LocationContig_1156:122..2825
Strand+
Gene length (bp)2703
Transcript length (bp)2316
Coding sequence length (bp)2316
Protein length (aa) 772

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04811 Sec23_trunk Sec23/Sec24 trunk domain 2.9E-76 124 391
PF08033 Sec23_BS Sec23/Sec24 beta-sandwich domain 2.3E-29 402 506
PF04815 Sec23_helical Sec23/Sec24 helical domain 2.1E-24 521 619
PF04810 zf-Sec23_Sec24 Sec23/Sec24 zinc finger 2.3E-15 57 96
PF00626 Gelsolin Gelsolin repeat 8.0E-13 637 722

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A5E7S3|SEC23_LODEL Protein transport protein SEC23 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=SEC23 PE=3 SV=1 1 771 0.0E+00
sp|Q15436|SC23A_HUMAN Protein transport protein Sec23A OS=Homo sapiens GN=SEC23A PE=1 SV=2 8 769 0.0E+00
sp|Q5R9P3|SC23A_PONAB Protein transport protein Sec23A OS=Pongo abelii GN=SEC23A PE=2 SV=1 8 769 0.0E+00
sp|Q05AS9|SC23A_XENTR Protein transport protein Sec23A OS=Xenopus tropicalis GN=sec23a PE=2 SV=1 2 769 0.0E+00
sp|Q01405|SC23A_MOUSE Protein transport protein Sec23A OS=Mus musculus GN=Sec23a PE=1 SV=2 8 769 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A5E7S3|SEC23_LODEL Protein transport protein SEC23 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=SEC23 PE=3 SV=1 1 771 0.0E+00
sp|Q15436|SC23A_HUMAN Protein transport protein Sec23A OS=Homo sapiens GN=SEC23A PE=1 SV=2 8 769 0.0E+00
sp|Q5R9P3|SC23A_PONAB Protein transport protein Sec23A OS=Pongo abelii GN=SEC23A PE=2 SV=1 8 769 0.0E+00
sp|Q05AS9|SC23A_XENTR Protein transport protein Sec23A OS=Xenopus tropicalis GN=sec23a PE=2 SV=1 2 769 0.0E+00
sp|Q01405|SC23A_MOUSE Protein transport protein Sec23A OS=Mus musculus GN=Sec23a PE=1 SV=2 8 769 0.0E+00
sp|Q9D662|SC23B_MOUSE Protein transport protein Sec23B OS=Mus musculus GN=Sec23b PE=1 SV=1 8 771 0.0E+00
sp|Q3SZN2|SC23B_BOVIN Protein transport protein Sec23B OS=Bos taurus GN=SEC23B PE=2 SV=1 8 769 0.0E+00
sp|A2VDL8|SC23A_BOVIN Protein transport protein Sec23A OS=Bos taurus GN=SEC23A PE=2 SV=1 8 764 0.0E+00
sp|Q5ZK03|SC23A_CHICK Protein transport protein Sec23A OS=Gallus gallus GN=SEC23A PE=2 SV=1 8 769 0.0E+00
sp|Q15437|SC23B_HUMAN Protein transport protein Sec23B OS=Homo sapiens GN=SEC23B PE=1 SV=2 8 769 0.0E+00
sp|Q9C284|SEC23_NEUCR Protein transport protein sec23 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sec23-1 PE=3 SV=1 1 771 0.0E+00
sp|Q5R5G2|SC23B_PONAB Protein transport protein Sec23B OS=Pongo abelii GN=SEC23B PE=2 SV=1 8 769 0.0E+00
sp|Q5A455|SEC23_CANAL Protein transport protein SEC23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC23 PE=3 SV=1 8 771 0.0E+00
sp|Q758M7|SEC23_ASHGO Protein transport protein SEC23 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC23 PE=3 SV=1 8 771 0.0E+00
sp|Q6CPH3|SEC23_KLULA Protein transport protein SEC23 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEC23 PE=3 SV=1 8 768 0.0E+00
sp|O94672|SC232_SCHPO Protein transport protein sec23-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec232 PE=1 SV=1 1 769 0.0E+00
sp|P15303|SEC23_YEAST Protein transport protein SEC23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC23 PE=1 SV=1 8 768 0.0E+00
sp|Q6FSI6|SC232_CANGA Protein transport protein SEC23-2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC232 PE=3 SV=1 1 768 0.0E+00
sp|Q6FSK3|SC231_CANGA Protein transport protein SEC23-1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC231 PE=3 SV=1 11 769 0.0E+00
sp|Q54T59|SEC23_DICDI Protein transport protein SEC23 OS=Dictyostelium discoideum GN=sec23 PE=3 SV=2 1 769 0.0E+00
sp|A3GFA2|SEC23_PICST Protein transport protein SEC23 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SEC23 PE=3 SV=2 1 771 0.0E+00
sp|Q2HB00|SEC23_CHAGB Protein transport protein SEC23 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SEC23 PE=3 SV=1 1 771 0.0E+00
sp|A4R1J7|SEC23_MAGO7 Protein transport protein SEC23 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SEC23 PE=3 SV=1 1 771 0.0E+00
sp|Q1DY01|SEC23_COCIM Protein transport protein SEC23 OS=Coccidioides immitis (strain RS) GN=SEC23 PE=3 SV=1 1 771 0.0E+00
sp|Q2URM9|SEC23_ASPOR Protein transport protein sec23 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sec23 PE=3 SV=1 1 771 0.0E+00
sp|A2Q8L1|SEC23_ASPNC Protein transport protein sec23 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sec23 PE=3 SV=1 1 771 0.0E+00
sp|Q0US25|SEC23_PHANO Protein transport protein SEC23 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SEC23 PE=3 SV=2 2 771 0.0E+00
sp|Q5BGR9|SEC23_EMENI Protein transport protein sec23 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sec23 PE=3 SV=1 1 771 0.0E+00
sp|A1CRW7|SEC23_ASPCL Protein transport protein sec23 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sec23 PE=3 SV=1 1 764 0.0E+00
sp|Q0CUU1|SEC23_ASPTN Protein transport protein sec23 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sec23 PE=3 SV=1 1 771 0.0E+00
sp|Q4WK80|SEC23_ASPFU Protein transport protein sec23 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sec23 PE=3 SV=2 1 767 0.0E+00
sp|Q7SZE5|SC23A_DANRE Protein transport protein Sec23A OS=Danio rerio GN=sec23a PE=2 SV=1 2 769 0.0E+00
sp|Q6BQT6|SEC23_DEBHA Protein transport protein SEC23 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SEC23 PE=3 SV=1 1 771 0.0E+00
sp|A5DA00|SEC23_PICGU Protein transport protein SEC23 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=SEC23 PE=3 SV=3 1 770 0.0E+00
sp|Q6C5L5|SEC23_YARLI Protein transport protein SEC23 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC23 PE=3 SV=2 8 771 0.0E+00
sp|O74873|SC231_SCHPO Protein transport protein sec23-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec231 PE=3 SV=1 1 768 0.0E+00
sp|P0CR39|SEC23_CRYNB Protein transport protein SEC23 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SEC23 PE=3 SV=1 1 771 0.0E+00
sp|P0CR38|SEC23_CRYNJ Protein transport protein SEC23 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SEC23 PE=3 SV=1 1 771 0.0E+00
sp|Q4PE39|SEC23_USTMA Protein transport protein SEC23 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SEC23 PE=3 SV=1 8 771 0.0E+00
sp|A1D4S4|SEC23_NEOFI Protein transport protein sec23 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sec23 PE=3 SV=1 1 769 0.0E+00
sp|Q8SQX2|SEC23_ENCCU Protein transport protein SEC23 OS=Encephalitozoon cuniculi (strain GB-M1) GN=SEC23 PE=1 SV=1 14 767 8.0E-127
sp|P38769|YHJ5_YEAST Uncharacterized protein YHR035W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHR035W PE=1 SV=1 259 768 1.0E-17
sp|O94855|SC24D_HUMAN Protein transport protein Sec24D OS=Homo sapiens GN=SEC24D PE=1 SV=2 16 665 1.0E-12
sp|P53992|SC24C_HUMAN Protein transport protein Sec24C OS=Homo sapiens GN=SEC24C PE=1 SV=3 19 626 1.0E-10
sp|Q54U61|SEC24_DICDI Protein transport protein SEC24 OS=Dictyostelium discoideum GN=sec24 PE=3 SV=1 16 546 2.0E-09
sp|O95486|SC24A_HUMAN Protein transport protein Sec24A OS=Homo sapiens GN=SEC24A PE=1 SV=2 17 626 6.0E-07
sp|Q9SFU0|SC24A_ARATH Protein transport protein Sec24-like At3g07100 OS=Arabidopsis thaliana GN=At3g07100 PE=2 SV=2 4 135 6.0E-06
sp|Q876F5|SC242_SACU7 Protein transport protein SEC24-2 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=SEC242 PE=3 SV=1 14 157 9.0E-06
sp|P40482|SEC24_YEAST Protein transport protein SEC24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC24 PE=1 SV=1 14 157 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0030127 COPII vesicle coat Yes
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Yes
GO:0006886 intracellular protein transport Yes
GO:0030120 vesicle coat No
GO:0098796 membrane protein complex No
GO:0051179 localization No
GO:0046872 metal ion binding No
GO:0043167 ion binding No
GO:0071702 organic substance transport No
GO:0070727 cellular macromolecule localization No
GO:0015031 protein transport No
GO:0051234 establishment of localization No
GO:0016192 vesicle-mediated transport No
GO:0048193 Golgi vesicle transport No
GO:0008150 biological_process No
GO:0008104 protein localization No
GO:0071705 nitrogen compound transport No
GO:0032991 protein-containing complex No
GO:0030117 membrane coat No
GO:0051641 cellular localization No
GO:0045184 establishment of protein localization No
GO:0051649 establishment of localization in cell No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0046907 intracellular transport No
GO:0005488 binding No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:0033036 macromolecule localization No
GO:0043169 cation binding No
GO:0006810 transport No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5283
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|627 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4365
Ophiocordyceps camponoti-floridani Ophcf2|01820
Ophiocordyceps camponoti-rufipedis Ophun1|5529
Ophiocordyceps kimflemingae Ophio5|620
Ophiocordyceps subramaniannii Hirsu2|4696

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|627
MNFEALKEECEERDGVRLSWNVFPSSRMEASRLVVPVGALYTPLKEKEGLVPHPFGPVTCKQPCRSVLNPFCQFD
PRARVWICPFCLSRNQFPDDYKEINQEAIPAEMHPYSTTFEYRLARPAPAPPIFLYVVDLCQEEDGLASLKESLV
MSLSLLPEGALVGLVTFGTMAQVHEIGYQGCAKSYVFRGSKDYSAKQVQEMLGLSASTAARLGGQHQAGRPMLAG
PASRFLLPVQQAEFQLTKALETLQKDPWPTANDRRSLRCTGVALSVAVGLMESSFQNAGGRIMLFSGGPATEGPG
IVVGPELREPIRSHHDIDRDNVKYYKKALKFYDNLAKRTAHNGHIIDIFAGCLDQVGLLEMKSLCNSTGGHMILT
DSFTSSMFKQSFIRVFERDNNNNLVMGFNAVLEVLTTKELKVTGLIGHAVSLNKKSVSVGETECGIGNTCSWKMC
GIDPRASYGIYFEVATQGPVAHQQAPQKQKGVVQFLTYYQHSSGNFHLRVTTIARDLSGPAGDPIIAHSFDQEAA
AVLMSRIAVFKSEVDDGPDVLRWVDRMLIRLCNRFADFRKDDPSSFRLERNFSLYPQFMFHLRRSQFLQVFNNSP
DETAFDRHVLNHEDVGNSLIMIQPTLDSYTLDQNGGIPVLLDSASIQPTHILLLDTFFHILIFHGETIAEWRKAG
YQDQEGYENFATLLEQPKEDARDLITDRFPLPRFIVCDAGGSQARFLLSKLNPSTTHTTGPYGGAGATSAQTIFT
DDVSLQTFMEHLKKLAVSSTN*
Coding >OphauG2|627
ATGAATTTTGAGGCTCTTAAAGAGGAATGCGAGGAACGTGATGGTGTTCGTTTAAGCTGGAACGTGTTTCCCAGC
TCGCGCATGGAAGCGTCGAGACTCGTTGTACCTGTTGGAGCACTCTATACGCCCCTGAAGGAAAAAGAAGGGCTG
GTTCCTCATCCATTTGGGCCTGTGACATGCAAGCAGCCGTGCCGGTCTGTTTTAAATCCCTTCTGCCAATTCGAC
CCCCGTGCCAGAGTATGGATCTGTCCGTTTTGTTTATCGAGAAACCAATTTCCCGACGATTACAAGGAAATCAAC
CAAGAGGCAATCCCGGCAGAGATGCACCCATACAGCACCACATTTGAATATCGGCTGGCTCGCCCCGCTCCGGCA
CCGCCAATTTTTCTTTATGTGGTTGACCTATGCCAAGAAGAAGATGGACTGGCCTCGCTCAAGGAATCGCTCGTG
ATGAGTCTCAGTTTGCTACCCGAGGGCGCACTTGTTGGCCTGGTTACCTTTGGCACCATGGCCCAGGTACATGAG
ATTGGATATCAGGGCTGTGCTAAGTCCTATGTCTTCCGTGGAAGCAAGGATTACTCGGCCAAGCAGGTTCAAGAG
ATGCTCGGCCTCTCAGCGTCAACTGCGGCAAGACTTGGTGGTCAGCATCAAGCAGGCCGTCCAATGCTTGCAGGA
CCGGCATCTCGATTTCTTCTCCCAGTTCAGCAGGCAGAGTTCCAGCTTACCAAGGCACTTGAAACACTGCAAAAG
GATCCGTGGCCGACAGCTAACGATAGACGGAGCCTTAGATGTACCGGAGTGGCTCTGAGCGTTGCTGTTGGCCTA
ATGGAATCATCATTTCAGAATGCTGGCGGACGAATTATGCTATTTTCTGGCGGACCAGCTACCGAGGGTCCTGGG
ATTGTAGTCGGGCCTGAGCTTCGGGAACCTATTCGATCACATCATGATATTGACCGTGACAACGTCAAGTACTAC
AAGAAAGCTCTCAAGTTCTATGACAACTTGGCCAAGCGCACGGCTCATAATGGCCACATCATTGACATTTTTGCT
GGCTGCCTAGACCAAGTCGGCCTCTTGGAGATGAAAAGTCTTTGCAACTCGACTGGTGGCCATATGATACTGACT
GACAGCTTCACGTCATCCATGTTTAAACAGTCTTTCATCCGCGTTTTCGAAAGGGACAACAATAACAATCTTGTC
ATGGGGTTCAATGCTGTCCTTGAAGTTTTGACCACTAAAGAACTCAAGGTCACTGGACTGATTGGGCACGCCGTA
TCTCTGAATAAAAAATCCGTCTCGGTTGGTGAAACAGAATGCGGAATTGGCAACACATGCTCTTGGAAGATGTGT
GGCATCGACCCAAGAGCCAGCTATGGTATCTATTTTGAGGTGGCAACCCAGGGTCCTGTTGCTCATCAGCAAGCT
CCGCAAAAGCAAAAAGGAGTTGTCCAATTTTTAACATATTATCAACATTCTTCGGGCAACTTCCATCTGCGAGTT
ACGACCATAGCCCGCGATTTGAGCGGGCCTGCTGGAGACCCAATCATTGCACATTCCTTCGACCAGGAAGCCGCC
GCTGTGCTCATGTCAAGAATAGCCGTCTTCAAGTCAGAAGTTGACGATGGCCCGGACGTACTGCGTTGGGTTGAC
AGAATGCTCATTCGCCTATGCAACCGATTCGCGGACTTCCGAAAAGATGACCCATCATCGTTTCGTCTCGAAAGG
AACTTCAGTTTGTATCCACAGTTTATGTTCCACTTGCGCAGAAGCCAGTTTTTGCAAGTCTTCAATAACTCTCCA
GATGAGACCGCGTTTGACCGTCACGTTTTAAATCATGAAGACGTCGGCAACTCCCTAATTATGATTCAACCAACG
TTGGACTCATACACTCTCGATCAGAATGGGGGGATACCTGTTCTTCTAGATTCCGCTTCTATTCAACCAACTCAT
ATTCTACTTCTGGACACGTTTTTTCACATTCTCATTTTCCACGGTGAAACCATCGCAGAATGGCGCAAAGCCGGC
TACCAGGATCAGGAAGGCTATGAGAATTTTGCTACTTTACTGGAACAACCAAAAGAGGATGCTAGAGACCTTATT
ACTGACCGATTTCCGCTGCCTCGTTTCATTGTCTGTGATGCCGGCGGCTCCCAAGCCCGTTTCCTTTTGTCTAAG
CTCAATCCCTCTACGACCCACACAACAGGTCCATATGGGGGGGCCGGCGCAACATCTGCCCAGACCATCTTCACG
GATGATGTCTCGCTGCAAACATTTATGGAACACTTAAAGAAACTCGCCGTCAGCAGTACCAATTAA
Transcript >OphauG2|627
ATGAATTTTGAGGCTCTTAAAGAGGAATGCGAGGAACGTGATGGTGTTCGTTTAAGCTGGAACGTGTTTCCCAGC
TCGCGCATGGAAGCGTCGAGACTCGTTGTACCTGTTGGAGCACTCTATACGCCCCTGAAGGAAAAAGAAGGGCTG
GTTCCTCATCCATTTGGGCCTGTGACATGCAAGCAGCCGTGCCGGTCTGTTTTAAATCCCTTCTGCCAATTCGAC
CCCCGTGCCAGAGTATGGATCTGTCCGTTTTGTTTATCGAGAAACCAATTTCCCGACGATTACAAGGAAATCAAC
CAAGAGGCAATCCCGGCAGAGATGCACCCATACAGCACCACATTTGAATATCGGCTGGCTCGCCCCGCTCCGGCA
CCGCCAATTTTTCTTTATGTGGTTGACCTATGCCAAGAAGAAGATGGACTGGCCTCGCTCAAGGAATCGCTCGTG
ATGAGTCTCAGTTTGCTACCCGAGGGCGCACTTGTTGGCCTGGTTACCTTTGGCACCATGGCCCAGGTACATGAG
ATTGGATATCAGGGCTGTGCTAAGTCCTATGTCTTCCGTGGAAGCAAGGATTACTCGGCCAAGCAGGTTCAAGAG
ATGCTCGGCCTCTCAGCGTCAACTGCGGCAAGACTTGGTGGTCAGCATCAAGCAGGCCGTCCAATGCTTGCAGGA
CCGGCATCTCGATTTCTTCTCCCAGTTCAGCAGGCAGAGTTCCAGCTTACCAAGGCACTTGAAACACTGCAAAAG
GATCCGTGGCCGACAGCTAACGATAGACGGAGCCTTAGATGTACCGGAGTGGCTCTGAGCGTTGCTGTTGGCCTA
ATGGAATCATCATTTCAGAATGCTGGCGGACGAATTATGCTATTTTCTGGCGGACCAGCTACCGAGGGTCCTGGG
ATTGTAGTCGGGCCTGAGCTTCGGGAACCTATTCGATCACATCATGATATTGACCGTGACAACGTCAAGTACTAC
AAGAAAGCTCTCAAGTTCTATGACAACTTGGCCAAGCGCACGGCTCATAATGGCCACATCATTGACATTTTTGCT
GGCTGCCTAGACCAAGTCGGCCTCTTGGAGATGAAAAGTCTTTGCAACTCGACTGGTGGCCATATGATACTGACT
GACAGCTTCACGTCATCCATGTTTAAACAGTCTTTCATCCGCGTTTTCGAAAGGGACAACAATAACAATCTTGTC
ATGGGGTTCAATGCTGTCCTTGAAGTTTTGACCACTAAAGAACTCAAGGTCACTGGACTGATTGGGCACGCCGTA
TCTCTGAATAAAAAATCCGTCTCGGTTGGTGAAACAGAATGCGGAATTGGCAACACATGCTCTTGGAAGATGTGT
GGCATCGACCCAAGAGCCAGCTATGGTATCTATTTTGAGGTGGCAACCCAGGGTCCTGTTGCTCATCAGCAAGCT
CCGCAAAAGCAAAAAGGAGTTGTCCAATTTTTAACATATTATCAACATTCTTCGGGCAACTTCCATCTGCGAGTT
ACGACCATAGCCCGCGATTTGAGCGGGCCTGCTGGAGACCCAATCATTGCACATTCCTTCGACCAGGAAGCCGCC
GCTGTGCTCATGTCAAGAATAGCCGTCTTCAAGTCAGAAGTTGACGATGGCCCGGACGTACTGCGTTGGGTTGAC
AGAATGCTCATTCGCCTATGCAACCGATTCGCGGACTTCCGAAAAGATGACCCATCATCGTTTCGTCTCGAAAGG
AACTTCAGTTTGTATCCACAGTTTATGTTCCACTTGCGCAGAAGCCAGTTTTTGCAAGTCTTCAATAACTCTCCA
GATGAGACCGCGTTTGACCGTCACGTTTTAAATCATGAAGACGTCGGCAACTCCCTAATTATGATTCAACCAACG
TTGGACTCATACACTCTCGATCAGAATGGGGGGATACCTGTTCTTCTAGATTCCGCTTCTATTCAACCAACTCAT
ATTCTACTTCTGGACACGTTTTTTCACATTCTCATTTTCCACGGTGAAACCATCGCAGAATGGCGCAAAGCCGGC
TACCAGGATCAGGAAGGCTATGAGAATTTTGCTACTTTACTGGAACAACCAAAAGAGGATGCTAGAGACCTTATT
ACTGACCGATTTCCGCTGCCTCGTTTCATTGTCTGTGATGCCGGCGGCTCCCAAGCCCGTTTCCTTTTGTCTAAG
CTCAATCCCTCTACGACCCACACAACAGGTCCATATGGGGGGGCCGGCGCAACATCTGCCCAGACCATCTTCACG
GATGATGTCTCGCTGCAAACATTTATGGAACACTTAAAGAAACTCGCCGTCAGCAGTACCAATTAA
Gene >OphauG2|627
ATGAATTTTGAGGCTCTTAAAGAGGAATGCGAGGAACGTGATGGTGTTCGTTTAAGCTGGAACGTGTTTCCCAGC
TCGCGCATGGTGAGTAAAGGTCGGGCTTTTTCCCACACCAGGGCCAGGTGTCATGCTCAACGTCCAGCGCAATTG
TTTGCTTCTAGGAAGCGTCGAGACTCGTTGTACCTGTTGGAGCACTCTATACGCCCCTGAAGGAAAAAGAAGGGC
TGGTTCCTCATCCATTTGGGCCTGTGACATGCAAGCAGCCGTGCCGGTCTGTTTTAAATCCCTTCTGGTAAGCCG
TTCACCGCATCTCCATAAATTTGACAGACACTTGCTAATAGATTGCCAGCCAATTCGACCCCCGTGCCAGAGTAT
GGATCTGTCCGTTTTGTTTATCGAGAAACCAATTTCCCGACGATTACAAGGAAATCAACCAAGAGGCAATCCCGG
CAGAGATGCACCCATACAGCACCACATTTGAATATCGGCTGGCTCGCCCCGCTCCGGCACCGCCAATTTTTCTTT
ATGTGGTTGACCTATGCCAAGAAGAAGATGGACTGGCCTCGCTCAAGGAATCGCTCGTGATGAGTCTCAGTTTGC
TACCCGAGGGCGCACTTGTTGGCCTGGTTACCTTTGGCACCATGGTGAGATTATCCCGGTCAAGATACCGCCATA
AATCGAGACAGAGAAACTGAGTGTACACCACGACTTAGGCCCAGGTACATGAGATTGGATATCAGGGCTGTGCTA
AGTCCTATGTCTTCCGTGGAAGCAAGGATTACTCGGCCAAGCAGGTTCAAGAGATGCTCGGCCTCTCAGCGTCAA
CTGCGGCAAGACTTGGTGGTCAGCATCAAGCAGGCCGTCCAATGCTTGCAGGACCGGCATCTCGATTTCTTCTCC
CAGTTCAGCAGGCAGAGTTCCAGCTTACCAAGGCACTTGAAACACTGCAAAAGGATCCGTGGCCGACAGCTAACG
ATAGACGGAGCCTTAGATGTACCGGAGTGGCTCTGAGCGTTGCTGTTGGCCTAATGGAATCATCATTTCAGAATG
CTGGCGGACGAATTATGCTATTTTCTGGCGGACCAGCTACCGAGGGTCCTGGGATTGTAGTCGGGCCTGAGCTTC
GGGAACCTATTCGATCACATCATGATATTGACCGTGACAACGTCAAGTACTACAAGAAAGCTCTCAAGGTAAGTG
TGGCTGCCCGAGCCGCCCGGTTTCAATCCTATTGTGCTAAGACGGACGTGACAATAGTTCTATGACAACTTGGCC
AAGCGCACGGCTCATAATGGCCACATCATTGACATTTTTGCTGGCTGCCTAGACCAAGTCGGCCTCTTGGAGATG
AAAAGTCTTTGCAACTCGACTGGTGGCCATATGATACTGACTGACAGCTTCACGTCATCCATGTTTAAACAGTCT
TTCATCCGCGTTTTCGAAAGGGACAACAATAACAATCTTGTCATGGGGTTCAATGCTGTCCTTGAAGTTTTGACC
ACTAAAGAACTCAAGGTCACTGGACTGATTGGGCACGCCGTATCTCTGAATAAAAAATCCGTCTCGGTTGGTGAA
ACAGAATGCGGAATTGGCAACACATGCTCTTGGAAGATGTGTGGCATCGACCCAAGAGCCAGCTATGGTATCTAT
TTTGAGGTGGCAACCCAGGGTCCTGTTGCTCATCAGCAAGCTCCGCAAAAGCAAAAAGGAGTTGTCCAATTTTTA
ACATATTATCAACATTCTTCGGGCAACTTCCATCTGCGAGTTACGACCATAGCCCGCGATTTGAGCGGGCCTGCT
GGAGACCCAATCATTGCACATTCCTTCGACCAGGAAGCCGCCGCTGTGCTCATGTCAAGAATAGCCGTCTTCAAG
TCAGAAGTTGACGATGGCCCGGACGTACTGCGTTGGGTTGACAGAATGCTCATTCGCCTATGCAACCGATTCGCG
GACTTCCGAAAAGATGACCCATCATCGTTTCGTCTCGAAAGGAACTTCAGTTTGTATCCACAGTTTATGTTCCAC
TTGCGCAGAAGCCAGTTTTTGCAAGTCTTCAATAACTCTCCAGATGAGACCGCGTTTGACCGTCACGTTTTAAAT
CATGAAGACGTCGGCAACTCCCTAATTATGATTCAACCAACGTTGGACTCATACACTCTCGATCAGAATGGGGGG
ATACCTGTTCTTCTAGATTCCGCTTCTATTCAACCAACTCATATTCTACTTCTGGACACGTTTTTTCACATTCTC
ATTTTCCACGGTGAAACCATCGCAGAATGGCGCAAAGCCGGCTACCAGGATCAGGAAGGCTATGAGAATTTTGCT
ACTTTACTGGAACAACCAAAAGAGGATGCTAGAGTCAGTACTATTCACTGGTTTTGCCCTTTATTCTGCATGCTG
ATCTGCTATAGGACCTTATTACTGACCGATTTCCGCTGCCTCGTTTCATTGTCTGTGATGCCGGCGGCTCCCAAG
CCCGTTTCCTTTTGTCTAAGCTCAATCCCTCTACGACCCACACAACAGGTCCATATGGGGGGGCCGGCGCAACAT
CTGCCCAGACCATCTTCACGGATGATGTCTCGCTGCAAACATTTATGGAACACTTAAAGAAGTAGGTCACCTGTT
TAAAATACTAGAAGTATCTGACTGCACCGTTGATACTAACCTTTCGCCCACAGACTCGCCGTCAGCAGTACCAAT
TAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail