Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6261
Gene name
LocationContig_63:17834..21047
Strand-
Gene length (bp)3213
Transcript length (bp)2952
Coding sequence length (bp)2952
Protein length (aa) 984

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00454 PI3_PI4_kinase Phosphatidylinositol 3- and 4-kinase 2.1E-32 709 921
PF11522 Pik1 Yeast phosphatidylinositol-4-OH kinase Pik1 1.1E-19 107 155

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10366|PIK1_SCHPO Phosphatidylinositol 4-kinase pik1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pik1 PE=1 SV=1 4 983 0.0E+00
sp|Q9UW20|PIK1_CANAL Phosphatidylinositol 4-kinase PIK1alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIKALPHA PE=3 SV=1 20 983 0.0E+00
sp|P39104|PIK1_YEAST Phosphatidylinositol 4-kinase PIK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIK1 PE=1 SV=1 266 983 2.0E-166
sp|Q9UW24|PIK1A_CANAL Phosphatidylinositol 4-kinase PIK1a OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIKA PE=3 SV=1 314 983 1.0E-149
sp|P54677|PI4K_DICDI Phosphatidylinositol 4-kinase OS=Dictyostelium discoideum GN=pikD PE=3 SV=3 683 983 2.0E-76
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10366|PIK1_SCHPO Phosphatidylinositol 4-kinase pik1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pik1 PE=1 SV=1 4 983 0.0E+00
sp|Q9UW20|PIK1_CANAL Phosphatidylinositol 4-kinase PIK1alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIKALPHA PE=3 SV=1 20 983 0.0E+00
sp|P39104|PIK1_YEAST Phosphatidylinositol 4-kinase PIK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIK1 PE=1 SV=1 266 983 2.0E-166
sp|Q9UW24|PIK1A_CANAL Phosphatidylinositol 4-kinase PIK1a OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIKA PE=3 SV=1 314 983 1.0E-149
sp|P54677|PI4K_DICDI Phosphatidylinositol 4-kinase OS=Dictyostelium discoideum GN=pikD PE=3 SV=3 683 983 2.0E-76
sp|B3EX61|PI4KB_SORAR Phosphatidylinositol 4-kinase beta OS=Sorex araneus GN=PI4KB PE=3 SV=1 608 982 1.0E-75
sp|Q49GP3|PI4KB_DANRE Phosphatidylinositol 4-kinase beta OS=Danio rerio GN=pi4kb PE=2 SV=2 657 982 4.0E-75
sp|Q8BKC8|PI4KB_MOUSE Phosphatidylinositol 4-kinase beta OS=Mus musculus GN=Pi4kb PE=1 SV=2 674 982 7.0E-75
sp|O08561|PI4KB_RAT Phosphatidylinositol 4-kinase beta OS=Rattus norvegicus GN=Pi4kb PE=1 SV=1 608 982 7.0E-75
sp|A9X1A0|PI4KB_PAPAN Phosphatidylinositol 4-kinase beta OS=Papio anubis GN=PI4KB PE=3 SV=2 674 982 7.0E-75
sp|Q9UBF8|PI4KB_HUMAN Phosphatidylinositol 4-kinase beta OS=Homo sapiens GN=PI4KB PE=1 SV=1 657 982 7.0E-75
sp|B4UT09|PI4KB_OTOGA Phosphatidylinositol 4-kinase beta OS=Otolemur garnettii GN=PI4KB PE=3 SV=1 674 982 8.0E-75
sp|B0KWC1|PI4KB_CALJA Phosphatidylinositol 4-kinase beta OS=Callithrix jacchus GN=PI4KB PE=3 SV=1 657 982 8.0E-75
sp|B2KI64|PI4KB_RHIFE Phosphatidylinositol 4-kinase beta OS=Rhinolophus ferrumequinum GN=PI4KB PE=3 SV=1 608 982 8.0E-75
sp|B1MTG7|PI4KB_CALMO Phosphatidylinositol 4-kinase beta OS=Callicebus moloch GN=PI4KB PE=3 SV=1 657 982 8.0E-75
sp|Q6GN16|PI4KB_XENLA Phosphatidylinositol 4-kinase beta OS=Xenopus laevis GN=pi4kb PE=2 SV=1 657 982 1.0E-74
sp|A4IID4|PI4KB_XENTR Phosphatidylinositol 4-kinase beta OS=Xenopus tropicalis GN=pi4kb PE=2 SV=1 657 982 2.0E-74
sp|O02810|PI4KB_BOVIN Phosphatidylinositol 4-kinase beta OS=Bos taurus GN=PI4KB PE=1 SV=2 657 982 6.0E-74
sp|Q9FMJ0|P4KB1_ARATH Phosphatidylinositol 4-kinase beta 1 OS=Arabidopsis thaliana GN=PI4KB1 PE=1 SV=1 666 982 3.0E-66
sp|Q0WPX9|P4KB2_ARATH Phosphatidylinositol 4-kinase beta 2 OS=Arabidopsis thaliana GN=PI4KB2 PE=2 SV=1 664 982 8.0E-65
sp|P37297|STT4_YEAST Phosphatidylinositol 4-kinase STT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STT4 PE=1 SV=1 712 982 1.0E-46
sp|Q9USR3|STT4_SCHPO Phosphatidylinositol 4-kinase stt4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=stt4 PE=3 SV=1 710 982 2.0E-45
sp|Q8SQY7|STT4_ENCCU Probable phosphatidylinositol 4-kinase STT4 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=STT4 PE=3 SV=2 711 982 8.0E-42
sp|O08662|PI4KA_RAT Phosphatidylinositol 4-kinase alpha OS=Rattus norvegicus GN=Pi4ka PE=1 SV=1 662 982 2.0E-36
sp|P42356|PI4KA_HUMAN Phosphatidylinositol 4-kinase alpha OS=Homo sapiens GN=PI4KA PE=1 SV=3 710 982 4.0E-36
sp|Q9SXA1|P4KA1_ARATH Phosphatidylinositol 4-kinase alpha 1 OS=Arabidopsis thaliana GN=PI4KA1 PE=1 SV=2 710 982 9.0E-36
sp|O02811|PI4KA_BOVIN Phosphatidylinositol 4-kinase alpha OS=Bos taurus GN=PI4KA PE=2 SV=1 710 982 9.0E-36
sp|P39104|PIK1_YEAST Phosphatidylinositol 4-kinase PIK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIK1 PE=1 SV=1 13 226 1.0E-33
sp|P54675|PI3K3_DICDI Phosphatidylinositol 3-kinase 3 OS=Dictyostelium discoideum GN=pikC PE=2 SV=2 709 971 6.0E-32
sp|A4QPH2|PI4P2_HUMAN Putative phosphatidylinositol 4-kinase alpha-like protein P2 OS=Homo sapiens GN=PI4KAP2 PE=5 SV=3 721 982 1.0E-30
sp|Q9C680|P4KA2_ARATH Phosphatidylinositol 4-kinase alpha 2 OS=Arabidopsis thaliana GN=PI4KA2 PE=1 SV=1 710 982 7.0E-29
sp|P54674|PI3K2_DICDI Phosphatidylinositol 3-kinase 2 OS=Dictyostelium discoideum GN=pikB PE=2 SV=2 709 976 3.0E-28
sp|P54673|PI3K1_DICDI Phosphatidylinositol 3-kinase 1 OS=Dictyostelium discoideum GN=pikA PE=2 SV=2 705 977 4.0E-28
sp|P42347|PI3K1_SOYBN Phosphatidylinositol 3-kinase, root isoform OS=Glycine max PE=2 SV=1 705 980 8.0E-28
sp|P42348|PI3K2_SOYBN Phosphatidylinositol 3-kinase, nodule isoform OS=Glycine max PE=2 SV=1 705 980 2.0E-27
sp|P54676|PI3K4_DICDI Phosphatidylinositol 3-kinase VPS34-like OS=Dictyostelium discoideum GN=pikE PE=3 SV=2 693 951 1.0E-25
sp|Q9UW24|PIK1A_CANAL Phosphatidylinositol 4-kinase PIK1a OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIKA PE=3 SV=1 20 177 2.0E-25
sp|P42339|PI3K_ARATH Phosphatidylinositol 3-kinase VPS34 OS=Arabidopsis thaliana GN=At1g60490 PE=2 SV=2 709 980 2.0E-25
sp|P22543|VPS34_YEAST Phosphatidylinositol 3-kinase VPS34 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS34 PE=1 SV=1 711 966 3.0E-25
sp|Q61194|P3C2A_MOUSE Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Mus musculus GN=Pik3c2a PE=1 SV=2 709 982 7.0E-25
sp|P48736|PK3CG_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform OS=Homo sapiens GN=PIK3CG PE=1 SV=3 709 918 1.0E-24
sp|O00443|P3C2A_HUMAN Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Homo sapiens GN=PIK3C2A PE=1 SV=2 709 982 2.0E-24
sp|P42337|PK3CA_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Mus musculus GN=Pik3ca PE=1 SV=2 711 918 2.0E-24
sp|Q9JHG7|PK3CG_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform OS=Mus musculus GN=Pik3cg PE=1 SV=2 709 918 2.0E-24
sp|P42336|PK3CA_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Homo sapiens GN=PIK3CA PE=1 SV=2 711 918 3.0E-24
sp|P32871|PK3CA_BOVIN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Bos taurus GN=PIK3CA PE=1 SV=1 710 918 3.0E-24
sp|Q5RAY1|P3C2A_PONAB Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Pongo abelii GN=PIK3C2A PE=2 SV=1 709 982 4.0E-24
sp|P50520|VPS34_SCHPO Phosphatidylinositol 3-kinase vps34 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps34 PE=2 SV=2 711 973 6.0E-24
sp|O00750|P3C2B_HUMAN Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta OS=Homo sapiens GN=PIK3C2B PE=1 SV=2 709 906 9.0E-24
sp|O02697|PK3CG_PIG Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform OS=Sus scrofa GN=PIK3CG PE=1 SV=2 709 918 4.0E-23
sp|O70167|P3C2G_MOUSE Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit gamma OS=Mus musculus GN=Pik3c2g PE=2 SV=1 709 918 9.0E-23
sp|O75747|P3C2G_HUMAN Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit gamma OS=Homo sapiens GN=PIK3C2G PE=1 SV=3 709 908 1.0E-22
sp|O70173|P3C2G_RAT Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit gamma OS=Rattus norvegicus GN=Pik3c2g PE=2 SV=1 644 908 8.0E-22
sp|Q6PF93|PK3C3_MOUSE Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Mus musculus GN=Pik3c3 PE=1 SV=1 711 968 1.0E-21
sp|Q6AZN6|PK3C3_XENLA Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Xenopus laevis GN=pik3c3 PE=2 SV=1 711 968 1.0E-21
sp|Q8BTI9|PK3CB_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Mus musculus GN=Pik3cb PE=1 SV=2 707 918 5.0E-21
sp|Q9Z1L0|PK3CB_RAT Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Rattus norvegicus GN=Pik3cb PE=2 SV=1 707 918 5.0E-21
sp|O88763|PK3C3_RAT Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Rattus norvegicus GN=Pik3c3 PE=1 SV=1 711 968 2.0E-20
sp|Q8NEB9|PK3C3_HUMAN Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Homo sapiens GN=PIK3C3 PE=1 SV=1 711 968 2.0E-20
sp|Q5D891|PK3C3_PIG Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Sus scrofa GN=PIK3C3 PE=2 SV=1 711 968 2.0E-20
sp|P42338|PK3CB_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Homo sapiens GN=PIK3CB PE=1 SV=1 707 918 6.0E-20
sp|O35904|PK3CD_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform OS=Mus musculus GN=Pik3cd PE=1 SV=2 709 925 3.0E-19
sp|O00329|PK3CD_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform OS=Homo sapiens GN=PIK3CD PE=1 SV=2 709 954 5.0E-19
sp|Q94125|AGE1_CAEEL Phosphatidylinositol 3-kinase age-1 OS=Caenorhabditis elegans GN=age-1 PE=1 SV=6 708 918 4.0E-18
sp|P0C5E7|AGE1_CAEBR Phosphatidylinositol 3-kinase age-1 OS=Caenorhabditis briggsae GN=age-1 PE=3 SV=1 639 904 1.0E-17
sp|Q92213|VPS34_CANAX Phosphatidylinositol 3-kinase VPS34 OS=Candida albicans GN=VPS34 PE=3 SV=1 814 967 2.0E-14
sp|Q7RZT9|ATM_NEUCR Serine/threonine-protein kinase tel1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-21 PE=3 SV=2 712 921 2.0E-12
sp|Q6FRZ9|ATM_CANGA Serine/threonine-protein kinase TEL1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TEL1 PE=3 SV=1 711 921 3.0E-12
sp|Q54ER4|ATR1_DICDI Probable serine/threonine-protein kinase atr1 OS=Dictyostelium discoideum GN=atr1 PE=3 SV=1 710 912 5.0E-12
sp|P38110|ATM_YEAST Serine/threonine-protein kinase TEL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TEL1 PE=1 SV=3 718 921 7.0E-12
sp|Q22258|ATR_CAEEL Serine/threonine-protein kinase ATR OS=Caenorhabditis elegans GN=atl-1 PE=2 SV=2 805 916 4.0E-11
sp|Q4IB89|ATM_GIBZE Serine/threonine-protein kinase TEL1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TEL1 PE=3 SV=1 712 921 6.0E-11
sp|Q2U639|ATM_ASPOR Serine/threonine-protein kinase tel1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tel1 PE=3 SV=1 718 921 1.0E-10
sp|Q5UR69|YL615_MIMIV Putative phosphatidylinositol kinase L615 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L615 PE=3 SV=1 758 906 2.0E-10
sp|Q6CP76|ATM_KLULA Serine/threonine-protein kinase TEL1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TEL1 PE=3 SV=1 718 952 5.0E-10
sp|Q6CAD2|ATM_YARLI Serine/threonine-protein kinase TEL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TEL1 PE=3 SV=1 712 921 5.0E-10
sp|Q5BHE2|ATM_EMENI Serine/threonine-protein kinase tel1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tel1 PE=3 SV=1 718 921 9.0E-10
sp|Q4WVM7|ATM_ASPFU Serine/threonine-protein kinase tel1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tel1 PE=3 SV=2 718 921 1.0E-09
sp|Q9FR53|TOR_ARATH Serine/threonine-protein kinase TOR OS=Arabidopsis thaliana GN=TOR PE=1 SV=1 691 918 2.0E-09
sp|Q9FMJ0|P4KB1_ARATH Phosphatidylinositol 4-kinase beta 1 OS=Arabidopsis thaliana GN=PI4KB1 PE=1 SV=1 6 104 1.0E-08
sp|Q0DJS1|TOR_ORYSJ Serine/threonine-protein kinase TOR OS=Oryza sativa subsp. japonica GN=TOR PE=2 SV=3 691 918 1.0E-08
sp|Q13315|ATM_HUMAN Serine-protein kinase ATM OS=Homo sapiens GN=ATM PE=1 SV=4 816 982 1.0E-08
sp|Q0WPX9|P4KB2_ARATH Phosphatidylinositol 4-kinase beta 2 OS=Arabidopsis thaliana GN=PI4KB2 PE=2 SV=1 6 121 2.0E-08
sp|Q70PP2|SMG1_DROME Serine/threonine-protein kinase Smg1 OS=Drosophila melanogaster GN=nonC PE=1 SV=2 806 915 2.0E-08
sp|Q9JLN9|MTOR_MOUSE Serine/threonine-protein kinase mTOR OS=Mus musculus GN=Mtor PE=1 SV=2 691 912 2.0E-08
sp|P0CP61|ATM_CRYNB Serine/threonine-protein kinase TEL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TEL1 PE=3 SV=1 817 921 2.0E-08
sp|P0CP60|ATM_CRYNJ Serine/threonine-protein kinase TEL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TEL1 PE=3 SV=1 817 921 2.0E-08
sp|P42346|MTOR_RAT Serine/threonine-protein kinase mTOR OS=Rattus norvegicus GN=Mtor PE=1 SV=1 691 912 3.0E-08
sp|P54677|PI4K_DICDI Phosphatidylinositol 4-kinase OS=Dictyostelium discoideum GN=pikD PE=3 SV=3 324 424 6.0E-08
sp|Q9DE14|ATR_XENLA Serine/threonine-protein kinase atr OS=Xenopus laevis GN=atr PE=1 SV=2 796 915 6.0E-08
sp|Q9M3G7|ATM_ARATH Serine/threonine-protein kinase ATM OS=Arabidopsis thaliana GN=ATM PE=2 SV=1 798 921 6.0E-08
sp|Q9JKK8|ATR_MOUSE Serine/threonine-protein kinase ATR OS=Mus musculus GN=Atr PE=1 SV=2 798 921 8.0E-08
sp|Q13535|ATR_HUMAN Serine/threonine-protein kinase ATR OS=Homo sapiens GN=ATR PE=1 SV=3 798 921 8.0E-08
sp|P42345|MTOR_HUMAN Serine/threonine-protein kinase mTOR OS=Homo sapiens GN=MTOR PE=1 SV=1 691 912 8.0E-08
sp|Q86C65|TOR_DICDI Target of rapamycin OS=Dictyostelium discoideum GN=tor PE=1 SV=1 710 921 9.0E-08
sp|Q6CT34|ATR_KLULA Serine/threonine-protein kinase MEC1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MEC1 PE=3 SV=1 750 924 9.0E-08
sp|P54677|PI4K_DICDI Phosphatidylinositol 4-kinase OS=Dictyostelium discoideum GN=pikD PE=3 SV=3 20 104 1.0E-07
sp|Q6PQD5|ATM_PIG Serine-protein kinase ATM OS=Sus scrofa GN=ATM PE=3 SV=2 816 952 1.0E-07
sp|Q62388|ATM_MOUSE Serine-protein kinase ATM OS=Mus musculus GN=Atm PE=1 SV=2 816 921 1.0E-07
sp|Q5EAK6|ATM_DROME Serine/threonine-protein kinase ATM OS=Drosophila melanogaster GN=tefu PE=2 SV=1 712 931 2.0E-07
sp|Q59LR2|ATR_CANAL Serine/threonine-protein kinase MEC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MEC1 PE=3 SV=1 798 921 2.0E-07
sp|Q6FX42|ATR_CANGA Serine/threonine-protein kinase MEC1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MEC1 PE=3 SV=1 793 924 2.0E-07
sp|Q8BKX6|SMG1_MOUSE Serine/threonine-protein kinase SMG1 OS=Mus musculus GN=Smg1 PE=1 SV=3 816 915 2.0E-07
sp|Q96Q15|SMG1_HUMAN Serine/threonine-protein kinase SMG1 OS=Homo sapiens GN=SMG1 PE=1 SV=3 816 915 2.0E-07
sp|Q9FKS4|ATR_ARATH Serine/threonine-protein kinase ATR OS=Arabidopsis thaliana GN=ATR PE=2 SV=2 798 921 2.0E-07
sp|O74630|ATM_SCHPO Serine/threonine-protein kinase tel1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tel1 PE=1 SV=1 793 944 4.0E-07
sp|Q02099|RAD3_SCHPO Protein kinase rad3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad3 PE=1 SV=2 707 883 5.0E-07
sp|Q9Y7K2|TOR2_SCHPO Phosphatidylinositol 3-kinase tor2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tor2 PE=1 SV=2 712 912 5.0E-07
sp|Q6BV76|ATM_DEBHA Serine/threonine-protein kinase TEL1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TEL1 PE=3 SV=3 793 921 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016773 phosphotransferase activity, alcohol group as acceptor Yes
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup874
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6261 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6560
Ophiocordyceps camponoti-floridani Ophcf2|01927
Ophiocordyceps camponoti-rufipedis Ophun1|1010
Ophiocordyceps kimflemingae Ophio5|685
Ophiocordyceps kimflemingae Ophio5|8439
Ophiocordyceps subramaniannii Hirsu2|5023

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6261
MSWDLLQRFLESEVFNSNPFLSVSYLSRYADHVGIHYVLCNKLRQFPYEDIEFFLPQLCHLIISVDNESMALEEF
LLDLCEESATAALLTFWLFQTHLHDVSANPQSDAFQTCRRVYNKVQHIVFGQADTARHGKIKENVLPVAVLSSFV
LASVALPVISQWAGPLAVAQARKPQPLGDATFAVSDIPKPARAQTVSGATTRSRRVKEARKSSAPGDDSPAELPP
PAPRSTPQISPSPSLRSKTPLVEPKRPSALEMRSLQGRLSSSSLPLPSPRPTTRPATPVSAGISQRPSDKTNRRH
THYPKQAFPGMADLGSVQKTRLLRTHYFRSQTQFLTALEAISNRLVIVPKPARMSALRAELALIARDLPAEIDIP
VLCPPTLVDGSPAKSRHHRIVRLNPAEATVLNSAEKVPYLLMIEVLRDDFSFDPDTPDNQRLLPILLDASASSRR
LFDLSSEKPRSTSASAIRSTELTPDSVFEPTSGDLGSSPLLQSEDDGASKNTAKHSQLPNTQRASSGATTSSTTL
DAATPRTSGASGSRSSSPGPRRKTTVTLARSALPDQPDFSALATHMRTASQMLAQLDATSGKRPKHEVAAIRAKI
IASMQSLEEQSFEADDQGPTFDAIIAKHNAAASHDRADEEADQDAQLDSTLNASAGRERMENDIKTGGVQRRGDR
DDPSAAVFGEAWEAKRERIRKSSPYGWMKNWDLVSVIVKTGADLRQEAFACQLIAVCHKIWVDAEVNVWVKLMRI
LVTGESSGLIETITNGVSLHSLKRSLTLAMAESGQHARQRIATLKDHFLKAFGQPDSKPYRAGVDAFKRSLAAYS
IISYVLQLKDRHNGNVLIDSEGHIIHIDFGFMLSNSPGSVGFEAAPFKLTQEYVDVLGGLASPDYEDYKTLCKQA
FQALRRSADKIIDLVAMMGRDSKMPCFSVGAAYATNTLRQRFQLHLSADEAEHFVESDLIAKSLGSYYTRLYDTF
QYRTQGIY*
Coding >OphauG2|6261
ATGTCGTGGGACTTGCTGCAGAGGTTCCTCGAGTCCGAAGTCTTCAACTCCAATCCCTTCCTGTCCGTCTCGTAC
CTGTCCCGCTACGCCGACCATGTGGGAATCCATTACGTCCTGTGTAACAAGCTTCGGCAGTTCCCCTACGAGGAC
ATTGAGTTCTTCCTGCCCCAGCTATGCCACCTCATAATCAGCGTCGACAACGAGTCCATGGCGCTCGAGGAGTTT
TTGCTCGATCTGTGCGAAGAGTCGGCCACGGCTGCCCTCTTGACCTTTTGGCTCTTTCAAACCCATCTCCACGAT
GTCTCTGCAAACCCCCAGTCGGACGCCTTCCAGACCTGCCGCCGAGTCTACAACAAGGTGCAGCACATCGTCTTT
GGCCAGGCCGACACGGCGCGCCACGGGAAAATCAAGGAAAATGTCTTGCCTGTCGCTGTGCTGTCTAGCTTCGTG
TTGGCGAGCGTTGCGCTGCCCGTGATTTCGCAATGGGCTGGTCCCCTGGCTGTTGCACAGGCTCGCAAGCCCCAG
CCACTTGGCGATGCCACTTTTGCCGTCAGCGACATTCCCAAGCCCGCCCGTGCCCAGACTGTGTCTGGTGCTACC
ACGAGGTCTAGGCGTGTCAAGGAGGCAAGGAAATCAAGCGCGCCCGGTGACGATAGTCCTGCAGAATTGCCGCCT
CCCGCGCCTCGAAGCACCCCCCAAATATCTCCTAGCCCGTCCTTGAGGTCAAAGACGCCGCTTGTCGAACCGAAA
CGCCCCTCTGCGCTTGAAATGAGGTCTCTGCAAGGCAGGCTCAGCTCGTCCTCGTTGCCTTTACCGTCTCCAAGA
CCGACAACAAGGCCAGCCACCCCAGTGTCTGCAGGCATATCACAAAGACCATCAGACAAGACAAACAGGCGACAC
ACTCATTATCCAAAGCAGGCTTTTCCCGGCATGGCCGACCTTGGCAGCGTCCAGAAGACGAGGTTGCTCCGAACC
CACTACTTTAGATCACAGACTCAGTTCTTGACGGCTCTTGAAGCCATCTCGAACCGACTCGTCATTGTGCCCAAG
CCAGCGAGAATGAGTGCTCTGCGGGCCGAGTTGGCGCTCATTGCGCGAGATTTACCCGCTGAGATTGACATTCCG
GTGCTTTGCCCCCCGACGCTGGTGGACGGCTCTCCTGCCAAAAGTCGCCATCACAGGATTGTTCGCTTGAACCCT
GCCGAGGCTACGGTTCTCAACAGCGCCGAGAAAGTGCCCTATCTCCTCATGATTGAGGTGCTCAGAGACGACTTT
TCCTTTGACCCCGACACGCCTGACAACCAACGTCTACTTCCCATTCTGCTAGATGCCAGTGCGAGCTCTCGACGG
CTGTTTGACCTGTCGTCAGAAAAGCCCAGATCAACTTCGGCCTCTGCTATACGAAGCACAGAGCTCACGCCTGAT
AGCGTCTTTGAGCCTACCTCGGGAGATTTGGGTAGCTCGCCACTGCTTCAGTCTGAAGACGATGGGGCGAGCAAA
AACACTGCAAAGCACTCTCAGCTTCCAAACACGCAGCGCGCCTCTAGCGGAGCAACAACATCCTCCACCACGTTG
GATGCTGCTACTCCACGCACCTCTGGAGCTTCTGGATCACGCTCAAGCAGTCCGGGCCCAAGGCGCAAGACGACA
GTGACCCTGGCCCGCAGTGCTTTGCCCGACCAGCCCGATTTCTCGGCCCTCGCCACTCACATGAGGACAGCGTCG
CAGATGCTGGCTCAGCTGGATGCAACTAGCGGCAAGCGGCCAAAGCACGAAGTGGCTGCCATTAGAGCCAAGATT
ATTGCAAGCATGCAGAGCCTGGAGGAGCAGAGTTTCGAGGCAGACGATCAAGGCCCGACGTTTGATGCCATTATT
GCGAAGCACAATGCAGCCGCAAGCCACGACAGAGCTGATGAAGAGGCGGACCAAGACGCACAGCTCGACTCGACA
CTCAATGCCAGCGCTGGGCGGGAGAGGATGGAAAACGACATCAAGACAGGTGGAGTGCAGCGCCGGGGTGATCGC
GACGACCCTAGTGCGGCTGTCTTTGGAGAAGCCTGGGAAGCCAAGCGGGAGCGCATTCGCAAGTCATCGCCGTAC
GGCTGGATGAAGAATTGGGACCTTGTCAGCGTCATTGTCAAGACGGGGGCCGACTTGCGCCAAGAGGCCTTTGCC
TGTCAGCTCATTGCCGTCTGCCACAAGATTTGGGTTGATGCCGAGGTCAATGTCTGGGTCAAGCTCATGCGCATT
CTGGTGACGGGCGAGTCGTCGGGCCTGATTGAGACGATTACAAATGGCGTGTCGCTACACTCGCTCAAGCGCAGC
CTAACGCTGGCCATGGCTGAGTCGGGTCAACACGCTCGCCAGCGTATTGCGACTCTCAAGGACCACTTTCTCAAG
GCCTTTGGACAGCCGGACAGCAAACCATATCGGGCCGGAGTCGATGCCTTTAAGCGGTCTCTGGCGGCGTATAGC
ATTATATCCTACGTCTTGCAGCTCAAAGACAGGCACAACGGCAACGTTCTCATTGACAGCGAAGGCCACATTATT
CACATTGATTTTGGATTTATGCTCTCTAATTCTCCTGGCTCCGTTGGCTTCGAAGCCGCTCCCTTCAAGTTGACG
CAGGAATACGTAGATGTTTTGGGCGGGCTGGCATCGCCCGACTATGAGGATTACAAGACACTCTGCAAGCAGGCT
TTTCAGGCTTTGCGGCGGTCGGCTGACAAGATTATTGATCTGGTGGCCATGATGGGGCGCGACTCCAAGATGCCG
TGCTTCTCTGTTGGAGCAGCGTATGCAACGAATACGCTGCGGCAGCGCTTCCAGCTGCATCTCAGCGCAGACGAG
GCGGAGCATTTTGTTGAGAGCGATTTGATTGCCAAGTCACTGGGAAGCTACTATACACGACTTTATGATACCTTT
CAATATCGTACTCAGGGCATCTATTAG
Transcript >OphauG2|6261
ATGTCGTGGGACTTGCTGCAGAGGTTCCTCGAGTCCGAAGTCTTCAACTCCAATCCCTTCCTGTCCGTCTCGTAC
CTGTCCCGCTACGCCGACCATGTGGGAATCCATTACGTCCTGTGTAACAAGCTTCGGCAGTTCCCCTACGAGGAC
ATTGAGTTCTTCCTGCCCCAGCTATGCCACCTCATAATCAGCGTCGACAACGAGTCCATGGCGCTCGAGGAGTTT
TTGCTCGATCTGTGCGAAGAGTCGGCCACGGCTGCCCTCTTGACCTTTTGGCTCTTTCAAACCCATCTCCACGAT
GTCTCTGCAAACCCCCAGTCGGACGCCTTCCAGACCTGCCGCCGAGTCTACAACAAGGTGCAGCACATCGTCTTT
GGCCAGGCCGACACGGCGCGCCACGGGAAAATCAAGGAAAATGTCTTGCCTGTCGCTGTGCTGTCTAGCTTCGTG
TTGGCGAGCGTTGCGCTGCCCGTGATTTCGCAATGGGCTGGTCCCCTGGCTGTTGCACAGGCTCGCAAGCCCCAG
CCACTTGGCGATGCCACTTTTGCCGTCAGCGACATTCCCAAGCCCGCCCGTGCCCAGACTGTGTCTGGTGCTACC
ACGAGGTCTAGGCGTGTCAAGGAGGCAAGGAAATCAAGCGCGCCCGGTGACGATAGTCCTGCAGAATTGCCGCCT
CCCGCGCCTCGAAGCACCCCCCAAATATCTCCTAGCCCGTCCTTGAGGTCAAAGACGCCGCTTGTCGAACCGAAA
CGCCCCTCTGCGCTTGAAATGAGGTCTCTGCAAGGCAGGCTCAGCTCGTCCTCGTTGCCTTTACCGTCTCCAAGA
CCGACAACAAGGCCAGCCACCCCAGTGTCTGCAGGCATATCACAAAGACCATCAGACAAGACAAACAGGCGACAC
ACTCATTATCCAAAGCAGGCTTTTCCCGGCATGGCCGACCTTGGCAGCGTCCAGAAGACGAGGTTGCTCCGAACC
CACTACTTTAGATCACAGACTCAGTTCTTGACGGCTCTTGAAGCCATCTCGAACCGACTCGTCATTGTGCCCAAG
CCAGCGAGAATGAGTGCTCTGCGGGCCGAGTTGGCGCTCATTGCGCGAGATTTACCCGCTGAGATTGACATTCCG
GTGCTTTGCCCCCCGACGCTGGTGGACGGCTCTCCTGCCAAAAGTCGCCATCACAGGATTGTTCGCTTGAACCCT
GCCGAGGCTACGGTTCTCAACAGCGCCGAGAAAGTGCCCTATCTCCTCATGATTGAGGTGCTCAGAGACGACTTT
TCCTTTGACCCCGACACGCCTGACAACCAACGTCTACTTCCCATTCTGCTAGATGCCAGTGCGAGCTCTCGACGG
CTGTTTGACCTGTCGTCAGAAAAGCCCAGATCAACTTCGGCCTCTGCTATACGAAGCACAGAGCTCACGCCTGAT
AGCGTCTTTGAGCCTACCTCGGGAGATTTGGGTAGCTCGCCACTGCTTCAGTCTGAAGACGATGGGGCGAGCAAA
AACACTGCAAAGCACTCTCAGCTTCCAAACACGCAGCGCGCCTCTAGCGGAGCAACAACATCCTCCACCACGTTG
GATGCTGCTACTCCACGCACCTCTGGAGCTTCTGGATCACGCTCAAGCAGTCCGGGCCCAAGGCGCAAGACGACA
GTGACCCTGGCCCGCAGTGCTTTGCCCGACCAGCCCGATTTCTCGGCCCTCGCCACTCACATGAGGACAGCGTCG
CAGATGCTGGCTCAGCTGGATGCAACTAGCGGCAAGCGGCCAAAGCACGAAGTGGCTGCCATTAGAGCCAAGATT
ATTGCAAGCATGCAGAGCCTGGAGGAGCAGAGTTTCGAGGCAGACGATCAAGGCCCGACGTTTGATGCCATTATT
GCGAAGCACAATGCAGCCGCAAGCCACGACAGAGCTGATGAAGAGGCGGACCAAGACGCACAGCTCGACTCGACA
CTCAATGCCAGCGCTGGGCGGGAGAGGATGGAAAACGACATCAAGACAGGTGGAGTGCAGCGCCGGGGTGATCGC
GACGACCCTAGTGCGGCTGTCTTTGGAGAAGCCTGGGAAGCCAAGCGGGAGCGCATTCGCAAGTCATCGCCGTAC
GGCTGGATGAAGAATTGGGACCTTGTCAGCGTCATTGTCAAGACGGGGGCCGACTTGCGCCAAGAGGCCTTTGCC
TGTCAGCTCATTGCCGTCTGCCACAAGATTTGGGTTGATGCCGAGGTCAATGTCTGGGTCAAGCTCATGCGCATT
CTGGTGACGGGCGAGTCGTCGGGCCTGATTGAGACGATTACAAATGGCGTGTCGCTACACTCGCTCAAGCGCAGC
CTAACGCTGGCCATGGCTGAGTCGGGTCAACACGCTCGCCAGCGTATTGCGACTCTCAAGGACCACTTTCTCAAG
GCCTTTGGACAGCCGGACAGCAAACCATATCGGGCCGGAGTCGATGCCTTTAAGCGGTCTCTGGCGGCGTATAGC
ATTATATCCTACGTCTTGCAGCTCAAAGACAGGCACAACGGCAACGTTCTCATTGACAGCGAAGGCCACATTATT
CACATTGATTTTGGATTTATGCTCTCTAATTCTCCTGGCTCCGTTGGCTTCGAAGCCGCTCCCTTCAAGTTGACG
CAGGAATACGTAGATGTTTTGGGCGGGCTGGCATCGCCCGACTATGAGGATTACAAGACACTCTGCAAGCAGGCT
TTTCAGGCTTTGCGGCGGTCGGCTGACAAGATTATTGATCTGGTGGCCATGATGGGGCGCGACTCCAAGATGCCG
TGCTTCTCTGTTGGAGCAGCGTATGCAACGAATACGCTGCGGCAGCGCTTCCAGCTGCATCTCAGCGCAGACGAG
GCGGAGCATTTTGTTGAGAGCGATTTGATTGCCAAGTCACTGGGAAGCTACTATACACGACTTTATGATACCTTT
CAATATCGTACTCAGGGCATCTATTAG
Gene >OphauG2|6261
ATGTCGTGGGACTTGCTGCAGAGGTTCCTCGAGTCCGAAGTCTTCAACTCCAATCCCTTCCTGTCCGTCTCGTAC
CTGTCGTGAGTTGCGCCAAAAGCCATGCCGTCGCCCCAACAACATGGTCACCAACAACAGCAGCAACGGGGGATT
GAGGGCTAATCTAATGTGCGCCCTTGCAGCCGCTACGCCGACCATGTGGGAATCCATTACGTCCTGTGTAACAAG
CTTCGGCAGTTCCCCTACGAGGACATTGAGTTCTTCCTGCCCCAGCTATGCCACCTCATAATCAGCGTCGACAAC
GAGTCCATGGCGCTCGAGGAGTTTTTGCTCGATCTGTGCGAAGAGTCGGCCACGGCTGCCCTCTTGGTATGTCTT
GCCCACTCCGTGTCGACACCGCCGCTGACTTGATCAGACCTTTTGGCTCTTTCAAACCCATCTCCACGATGTCTC
TGCAAACCCCCAGTCGGACGCCTTCCAGACCTGCCGCCGAGTCTACAACAAGGTGCAGCACATCGTCTTTGGCCA
GGCCGACACGGCGCGCCACGGGAAAATCAAGGAAAATGTCTTGCCTGTCGCTGTGCTGTCTAGCTTCGTGTTGGC
GAGCGTTGCGCTGCCCGTGATTTCGCAATGGGCTGGTCCCCTGGCTGTTGCACAGGCTCGCAAGCCCCAGCCACT
TGGCGATGCCACTTTTGCCGTCAGCGACATTCCCAAGCCCGCCCGTGCCCAGACTGTGTCTGGTGCTACCACGAG
GTCTAGGCGTGTCAAGGAGGCAAGGAAATCAAGCGCGCCCGGTGACGATAGTCCTGCAGAATTGCCGCCTCCCGC
GCCTCGAAGCACCCCCCAAATATCTCCTAGCCCGTCCTTGAGGTCAAAGACGCCGCTTGTCGAACCGAAACGCCC
CTCTGCGCTTGAAATGAGGTCTCTGCAAGGCAGGCTCAGCTCGTCCTCGTTGCCTTTACCGTCTCCAAGACCGAC
AACAAGGCCAGCCACCCCAGTGTCTGCAGGCATATCACAAAGACCATCAGACAAGACAAACAGGCGACACACTCA
TTATCCAAAGCAGGCTTTTCCCGGCATGGCCGACCTTGGCAGCGTCCAGAAGACGAGGTTGCTCCGAACCCACTA
CTTTAGATCACAGACTCAGTTCTTGACGGCTCTTGAAGCCATCTCGAACCGACTCGTCATTGTGCCCAAGCCAGC
GAGAATGAGTGCTCTGCGGGCCGAGTTGGCGCTCATTGCGCGAGATTTACCCGCTGAGATTGACATTCCGGTGCT
TTGCCCCCCGACGCTGGTGGACGGCTCTCCTGCCAAAAGTCGCCATCACAGGATTGTTCGCTTGAACCCTGCCGA
GGCTACGGTTCTCAACAGCGCCGAGAAAGTGCCCTATCTCCTCATGATTGAGGTGCTCAGAGACGACTTTTCCTT
TGACCCCGACACGCCTGACAACCAACGTCTACTTCCCATTCTGCTAGATGCCAGTGCGAGCTCTCGACGGCTGTT
TGACCTGTCGTCAGAAAAGCCCAGATCAACTTCGGCCTCTGCTATACGAAGCACAGAGCTCACGCCTGATAGCGT
CTTTGAGCCTACCTCGGGAGATTTGGGTAGCTCGCCACTGCTTCAGTCTGAAGACGATGGGGCGAGCAAAAACAC
TGCAAAGCACTCTCAGCTTCCAAACACGCAGCGCGCCTCTAGCGGAGCAACAACATCCTCCACCACGTTGGATGC
TGCTACTCCACGCACCTCTGGAGCTTCTGGATCACGCTCAAGCAGTCCGGGCCCAAGGCGCAAGACGACAGTGAC
CCTGGCCCGCAGTGCTTTGCCCGACCAGCCCGATTTCTCGGCCCTCGCCACTCACATGAGGACAGCGTCGCAGAT
GCTGGCTCAGCTGGATGCAACTAGCGGCAAGCGGCCAAAGCACGAAGTGGCTGCCATTAGAGCCAAGATTATTGC
AAGCATGCAGAGCCTGGAGGAGCAGAGTTTCGAGGCAGACGATCAAGGCCCGACGTTTGATGCCATTATTGCGAA
GCACAATGCAGCCGCAAGCCACGACAGAGCTGATGAAGAGGCGGACCAAGACGCACAGCTCGACTCGACACTCAA
TGCCAGCGCTGGGCGGGAGAGGATGGAAAACGACATCAAGACAGGTGGAGTGCAGCGCCGGGGTGATCGCGACGA
CCCTAGTGCGGCTGTCTTTGGAGAAGCCTGGGAAGCCAAGCGGGAGCGCATTCGCAAGTCATCGCCGTACGGCTG
GATGAAGAATTGGGACCTTGTCAGCGTCATTGTCAAGACGGGGGCCGACTTGCGCCAAGAGGCCTTTGCCTGTCA
GCTCATTGCCGTCTGCCACAAGATTTGGGTTGATGCCGAGGTCAATGTCTGGGTCAAGCTCATGCGCATTCTGGT
GACGGGCGAGTCGTCGGGCCTGATTGAGACGATTACAAATGGCGTGTCGCTACACTCGCTCAAGCGCAGCCTAAC
GCTGGCCATGGCTGAGTCGGGTCAACACGCTCGCCAGCGTATTGCGACTCTCAAGGACCACTTTCTCAAGGCCTT
TGGACAGCCGGACAGCAAACCATATCGGGCCGGAGTCGATGCCTTTAAGCGGTCTCTGGCGGCGTATAGCATTAT
ATCCTACGTCTTGCAGCTCAAAGACAGGCACAACGGCAACGTTCTCATTGACAGCGAAGGCCACATTATTCACAT
TGATTTTGGATTTATGCTCTCTAATTCTCCTGGCTCCGTTGGCTTCGAAGCCGCTCCCTTCAAGTTGACGCAGGA
ATACGTAGATGTTTTGGGCGGGCTGGCATCGCCCGACTATGAGGATTACAAGACACTCTGCAAGCAGGCTTTTCA
GGGTGCGCACGACGCTGTCTTGAGCATACTTTGAGTCCTTTTGAGCTAACTTTGCAGCCAGCTTTGCGGCGGTCG
GCTGACAAGATTATTGATCTGGTGGCCATGATGGGGCGCGACTCCAAGATGCCGTGCTTCTCTGTTGGAGCAGCG
TATGCAACGAATACGCTGCGGCAGCGCTTCCAGCTGCATCTCAGCGCAGACGAGGCGGAGCATTTTGTTGAGAGC
GATTTGATTGCCAAGTCACTGGGAAGCTACTATACACGACTGTGAGTCTGCCCCTGGTCGCCGCCTCTCATGTTG
CTGTGCTAACACGAATCCCCTAGTTATGATACCTTTCAATATCGTACTCAGGGCATCTATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail