Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6257
Gene name
LocationContig_63:10134..11268
Strand-
Gene length (bp)1134
Transcript length (bp)1134
Coding sequence length (bp)1134
Protein length (aa) 378

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02146 SIR2 Sir2 family 3.9E-28 55 309

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|F4P804|SIR4_BATDJ NAD-dependent protein deacylase SIR4 OS=Batrachochytrium dendrobatidis (strain JAM81 / FGSC 10211) GN=BATDEDRAFT_20316 PE=3 SV=1 50 371 1.0E-60
sp|Q94AQ6|SIR4_ARATH NAD-dependent protein deacylase SRT2 OS=Arabidopsis thaliana GN=SRT2 PE=2 SV=1 48 366 8.0E-53
sp|Q89EA6|NPD2_BRADU NAD-dependent protein deacetylase 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=cobB2 PE=3 SV=2 52 353 3.0E-48
sp|Q1JQC6|SIR4_BOVIN NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Bos taurus GN=SIRT4 PE=2 SV=1 28 351 1.0E-42
sp|Q8R216|SIR4_MOUSE NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Mus musculus GN=Sirt4 PE=1 SV=3 14 351 5.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|F4P804|SIR4_BATDJ NAD-dependent protein deacylase SIR4 OS=Batrachochytrium dendrobatidis (strain JAM81 / FGSC 10211) GN=BATDEDRAFT_20316 PE=3 SV=1 50 371 1.0E-60
sp|Q94AQ6|SIR4_ARATH NAD-dependent protein deacylase SRT2 OS=Arabidopsis thaliana GN=SRT2 PE=2 SV=1 48 366 8.0E-53
sp|Q89EA6|NPD2_BRADU NAD-dependent protein deacetylase 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=cobB2 PE=3 SV=2 52 353 3.0E-48
sp|Q1JQC6|SIR4_BOVIN NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Bos taurus GN=SIRT4 PE=2 SV=1 28 351 1.0E-42
sp|Q8R216|SIR4_MOUSE NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Mus musculus GN=Sirt4 PE=1 SV=3 14 351 5.0E-42
sp|Q8PDM9|NPD_XANCP NAD-dependent protein deacetylase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=cobB PE=3 SV=1 52 358 3.0E-41
sp|Q4UZX0|NPD_XANC8 NAD-dependent protein deacetylase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=cobB PE=3 SV=1 52 358 3.0E-41
sp|Q8PQK3|NPD_XANAC NAD-dependent protein deacetylase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=cobB PE=3 SV=2 52 344 3.0E-41
sp|Q9Y6E7|SIR4_HUMAN NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Homo sapiens GN=SIRT4 PE=1 SV=1 28 337 5.0E-41
sp|A9UVV1|SIR4_MONBE NAD-dependent protein deacylase SIR4 OS=Monosiga brevicollis GN=15984 PE=3 SV=1 52 370 9.0E-41
sp|Q7WLE5|NPD_BORBR NAD-dependent protein deacetylase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=cobB PE=3 SV=1 52 368 2.0E-40
sp|B0RM75|NPD_XANCB NAD-dependent protein deacetylase OS=Xanthomonas campestris pv. campestris (strain B100) GN=cobB PE=3 SV=1 52 358 8.0E-40
sp|Q7VX46|NPD_BORPE NAD-dependent protein deacetylase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cobB PE=3 SV=1 52 367 2.0E-39
sp|Q8FUC8|NPD1_COREF NAD-dependent protein deacetylase 1 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=cobB1 PE=3 SV=2 46 331 7.0E-38
sp|Q882K4|NPD3_PSESM NAD-dependent protein deacetylase 3 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cobB3 PE=3 SV=1 49 373 3.0E-37
sp|Q8IRR5|SIR4_DROME NAD-dependent protein deacylase Sirt4 OS=Drosophila melanogaster GN=Sirt4 PE=2 SV=2 4 335 8.0E-37
sp|Q20480|SIR41_CAEEL NAD-dependent protein deacylase sir-2.2 OS=Caenorhabditis elegans GN=sir-2.2 PE=3 SV=1 45 334 9.0E-37
sp|Q4QB33|SIR4_LEIMA NAD-dependent protein deacylase SIR2rp2 OS=Leishmania major GN=SIR2rp2 PE=3 SV=1 34 335 1.0E-36
sp|Q9RL35|NPD1_STRCO NAD-dependent protein deacetylase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=cobB1 PE=3 SV=1 1 377 1.0E-36
sp|Q57YZ9|SIR4_TRYB2 NAD-dependent protein deacylase SIR2rp2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=SIR2rp2 PE=3 SV=1 50 334 1.0E-35
sp|Q20481|SIR42_CAEEL NAD-dependent protein deacylase sir-2.3 OS=Caenorhabditis elegans GN=sir-2.3 PE=3 SV=1 45 339 3.0E-34
sp|A0QDH4|NPD1_MYCA1 NAD-dependent protein deacetylase 1 OS=Mycobacterium avium (strain 104) GN=cobB1 PE=3 SV=1 52 335 5.0E-34
sp|B5YJW3|NPD_THEYD NAD-dependent protein deacetylase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=cobB PE=3 SV=1 48 174 2.0E-19
sp|Q4JBN2|NPD_SULAC NAD-dependent protein deacetylase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=cobB PE=3 SV=2 49 222 5.0E-19
sp|Q97VX5|NPD_SULSO NAD-dependent protein deacetylase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=cobB PE=1 SV=1 48 170 2.0E-18
sp|Q974M6|NPD_SULTO NAD-dependent protein deacetylase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=cobB PE=3 SV=2 48 173 2.0E-17
sp|O58669|NPD_PYRHO NAD-dependent protein deacylase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=cobB PE=3 SV=1 38 374 2.0E-17
sp|Q9WYW0|NPD_THEMA NAD-dependent protein deacetylase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=cobB PE=1 SV=1 50 166 2.0E-16
sp|O30124|NPD2_ARCFU NAD-dependent protein deacylase 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=cobB2 PE=1 SV=1 50 175 2.0E-16
sp|Q9UZE7|NPD_PYRAB NAD-dependent protein deacylase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=cobB PE=3 SV=1 48 166 3.0E-15
sp|Q8CJM9|NPD2_STRCO NAD-dependent protein deacetylase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=cobB2 PE=3 SV=1 52 183 4.0E-15
sp|Q8U1Q1|NPD_PYRFU NAD-dependent protein deacylase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=cobB PE=3 SV=2 48 166 4.0E-15
sp|A8MBU4|NPD_CALMQ NAD-dependent protein deacetylase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=cobB PE=3 SV=1 50 171 1.0E-14
sp|O28597|NPD1_ARCFU NAD-dependent protein deacylase 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=cobB1 PE=1 SV=1 51 170 1.0E-14
sp|Q6N6U0|NPD_RHOPA NAD-dependent protein deacetylase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=cobB PE=3 SV=1 48 166 2.0E-14
sp|Q8XNS6|NPD_CLOPE NAD-dependent protein deacetylase OS=Clostridium perfringens (strain 13 / Type A) GN=cobB PE=3 SV=1 48 166 2.0E-14
sp|Q8REC3|NPD_FUSNN NAD-dependent protein deacetylase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=cobB PE=3 SV=1 51 166 6.0E-14
sp|Q89LY4|NPD1_BRADU NAD-dependent protein deacetylase 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=cobB1 PE=3 SV=1 51 173 6.0E-14
sp|E1BRE2|SIR5_CHICK NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Gallus gallus GN=SIRT5 PE=3 SV=1 52 339 1.0E-13
sp|Q5JG47|NPD_THEKO NAD-dependent protein deacylase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=cobB PE=3 SV=1 50 166 1.0E-13
sp|Q97MB4|NPD_CLOAB NAD-dependent protein deacetylase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=cobB PE=3 SV=1 48 170 2.0E-13
sp|Q8ZU41|NPD1_PYRAE NAD-dependent protein deacetylase 1 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=cobB1 PE=3 SV=1 48 166 2.0E-13
sp|Q899G3|NPD_CLOTE NAD-dependent protein deacetylase OS=Clostridium tetani (strain Massachusetts / E88) GN=cobB PE=3 SV=1 48 170 3.0E-13
sp|Q8ZT00|NPD2_PYRAE NAD-dependent protein deacylase 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=cobB2 PE=3 SV=1 50 174 4.0E-13
sp|Q72IV5|NPD_THET2 NAD-dependent protein deacylase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=cobB PE=3 SV=1 52 174 5.0E-13
sp|Q88ZA0|NPD_LACPL NAD-dependent protein deacetylase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=cobB PE=3 SV=1 51 277 8.0E-13
sp|Q8R984|NPD2_CALS4 NAD-dependent protein deacetylase 2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=cobB2 PE=3 SV=1 50 181 2.0E-12
sp|Q5AI90|SIR5_CANAL NAD-dependent protein deacylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.10480 PE=3 SV=1 51 329 4.0E-12
sp|Q5SIH7|NPD_THET8 NAD-dependent protein deacylase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=cobB PE=3 SV=1 52 174 5.0E-12
sp|Q67KQ0|NPD_SYMTH NAD-dependent protein deacetylase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=cobB PE=3 SV=1 50 171 7.0E-12
sp|F7DKV7|SIR5_XENTR NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Xenopus tropicalis GN=sirt5 PE=3 SV=1 52 326 1.0E-11
sp|C6A243|NPD_THESM NAD-dependent protein deacylase OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=cobB PE=3 SV=1 43 166 1.0E-11
sp|Q5HZN8|SIR5A_XENLA NAD-dependent protein deacylase sirtuin-5A, mitochondrial OS=Xenopus laevis GN=sirt5-a PE=2 SV=1 52 326 2.0E-11
sp|Q8TWG0|NPD_METKA NAD-dependent protein deacylase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=cobB PE=3 SV=1 48 166 4.0E-11
sp|Q8R9N6|NPD1_CALS4 NAD-dependent protein deacylase 1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=cobB1 PE=3 SV=1 46 329 6.0E-11
sp|Q9YB13|NPD_AERPE NAD-dependent protein deacylase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=cobB PE=3 SV=2 50 166 2.0E-10
sp|Q6A5T5|NPD_PROAC NAD-dependent protein deacetylase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=cobB PE=3 SV=1 48 166 3.0E-10
sp|Q8N6T7|SIR6_HUMAN NAD-dependent protein deacetylase sirtuin-6 OS=Homo sapiens GN=SIRT6 PE=1 SV=2 48 173 3.0E-10
sp|Q5KZE8|NPD2_GEOKA NAD-dependent protein deacetylase 2 OS=Geobacillus kaustophilus (strain HTA426) GN=cobB2 PE=3 SV=1 52 166 4.0E-10
sp|E9GD30|SIR5_DAPPU NAD-dependent protein deacylase OS=Daphnia pulex GN=DAPPUDRAFT_195469 PE=3 SV=1 48 166 4.0E-10
sp|Q68F47|SIR5B_XENLA NAD-dependent protein deacylase sirtuin-5B, mitochondrial OS=Xenopus laevis GN=sirt5-b PE=2 SV=1 52 326 4.0E-10
sp|Q5L014|NPD1_GEOKA NAD-dependent protein deacetylase 1 OS=Geobacillus kaustophilus (strain HTA426) GN=cobB1 PE=3 SV=1 50 166 4.0E-10
sp|Q8ELR0|NPD_OCEIH NAD-dependent protein deacetylase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=cobB PE=3 SV=1 50 175 8.0E-10
sp|Q71W25|NPD_LISMF NAD-dependent protein deacetylase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=cobB PE=3 SV=1 51 175 9.0E-10
sp|O67919|NPD_AQUAE NAD-dependent protein deacylase OS=Aquifex aeolicus (strain VF5) GN=cobB PE=3 SV=1 51 166 1.0E-09
sp|Q5WKC8|NPD_BACSK NAD-dependent protein deacetylase OS=Bacillus clausii (strain KSM-K16) GN=cobB PE=3 SV=1 51 178 1.0E-09
sp|Q7P1B9|NPD_CHRVO NAD-dependent protein deacetylase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cobB PE=3 SV=1 52 178 2.0E-09
sp|Q839C6|NPD_ENTFA NAD-dependent protein deacetylase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=cobB PE=3 SV=1 52 175 2.0E-09
sp|Q8Y3U2|NPD_LISMO NAD-dependent protein deacetylase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cobB PE=3 SV=1 51 234 2.0E-09
sp|O07595|NPD_BACSU NAD-dependent protein deacetylase OS=Bacillus subtilis (strain 168) GN=cobB PE=3 SV=1 51 170 3.0E-09
sp|Q927A7|NPD_LISIN NAD-dependent protein deacetylase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=cobB PE=3 SV=1 51 166 5.0E-09
sp|B8ARK7|SIR1_ORYSI NAD-dependent protein deacetylase SRT1 OS=Oryza sativa subsp. indica GN=SRT1 PE=2 SV=1 51 173 6.0E-09
sp|P59941|SIR6_MOUSE NAD-dependent protein deacetylase sirtuin-6 OS=Mus musculus GN=Sirt6 PE=1 SV=1 48 173 9.0E-09
sp|Q73KE1|NPD_TREDE NAD-dependent protein deacetylase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=cobB PE=3 SV=1 51 166 9.0E-09
sp|Q5R6G3|SIR5_PONAB NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Pongo abelii GN=SIRT5 PE=2 SV=1 51 166 2.0E-08
sp|Q9NXA8|SIR5_HUMAN NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Homo sapiens GN=SIRT5 PE=1 SV=2 51 166 2.0E-08
sp|Q885X7|NPD2_PSESM NAD-dependent protein deacylase 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cobB2 PE=3 SV=1 51 181 2.0E-08
sp|F7EZ75|SIR5_MACMU NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Macaca mulatta GN=SIRT5 PE=3 SV=1 51 166 2.0E-08
sp|Q6DHI5|SIR5_DANRE NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Danio rerio GN=sirt5 PE=1 SV=1 52 166 2.0E-08
sp|Q8BKJ9|SIR7_MOUSE NAD-dependent protein deacetylase sirtuin-7 OS=Mus musculus GN=Sirt7 PE=1 SV=2 51 167 3.0E-08
sp|Q3ZBQ0|SIR5_BOVIN NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Bos taurus GN=SIRT5 PE=2 SV=1 51 166 3.0E-08
sp|B2RZ55|SIR7_RAT NAD-dependent protein deacetylase sirtuin-7 OS=Rattus norvegicus GN=Sirt7 PE=2 SV=1 51 167 3.0E-08
sp|Q9VH08|SIR6_DROME NAD-dependent protein deacetylase Sirt6 OS=Drosophila melanogaster GN=Sirt6 PE=2 SV=1 51 170 3.0E-08
sp|Q8IE47|SIR5_PLAF7 NAD-dependent protein deacylase Sir2A OS=Plasmodium falciparum (isolate 3D7) GN=Sir2A PE=1 SV=1 51 166 4.0E-08
sp|Q8CNF4|NPD_STAES NAD-dependent protein deacetylase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cobB PE=3 SV=1 51 191 7.0E-08
sp|Q8R104|SIR3_MOUSE NAD-dependent protein deacetylase sirtuin-3 OS=Mus musculus GN=Sirt3 PE=1 SV=2 48 308 7.0E-08
sp|Q9FE17|SIR1_ARATH NAD-dependent protein deacetylase SRT1 OS=Arabidopsis thaliana GN=SRT1 PE=2 SV=1 51 173 1.0E-07
sp|Q95Q89|SIR24_CAEEL NAD-dependent protein deacetylase sir-2.4 OS=Caenorhabditis elegans GN=sir-2.4 PE=3 SV=2 52 175 1.0E-07
sp|E2RDZ6|SIR5_CANLF NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Canis lupus familiaris GN=SIRT5 PE=3 SV=1 51 166 2.0E-07
sp|Q8K2C6|SIR5_MOUSE NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Mus musculus GN=Sirt5 PE=1 SV=1 52 166 2.0E-07
sp|Q68FX9|SIR5_RAT NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Rattus norvegicus GN=Sirt5 PE=2 SV=1 51 166 2.0E-07
sp|Q9NRC8|SIR7_HUMAN NAD-dependent protein deacetylase sirtuin-7 OS=Homo sapiens GN=SIRT7 PE=1 SV=1 51 167 2.0E-07
sp|Q88A13|NPD1_PSESM NAD-dependent protein deacylase 1 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cobB1 PE=3 SV=1 73 166 3.0E-07
sp|Q88BY5|NPD_PSEPK NAD-dependent protein deacylase OS=Pseudomonas putida (strain KT2440) GN=cobB PE=3 SV=1 49 166 3.0E-07
sp|Q9NTG7|SIR3_HUMAN NAD-dependent protein deacetylase sirtuin-3, mitochondrial OS=Homo sapiens GN=SIRT3 PE=1 SV=2 51 176 4.0E-07
sp|Q735N7|NPD_BACC1 NAD-dependent protein deacetylase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cobB PE=3 SV=1 52 170 5.0E-07
sp|Q6HH09|NPD_BACHK NAD-dependent protein deacetylase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=cobB PE=3 SV=1 52 166 5.0E-07
sp|F7D4X9|SIR5_MONDO NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Monodelphis domestica GN=SIRT5 PE=3 SV=1 52 166 6.0E-07
sp|Q81BT4|NPD_BACCR NAD-dependent protein deacetylase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cobB PE=3 SV=1 52 166 7.0E-07
sp|Q0P595|SIR7_BOVIN NAD-dependent protein deacetylase sirtuin-7 OS=Bos taurus GN=SIRT7 PE=2 SV=1 51 166 8.0E-07
sp|Q81NT6|NPD_BACAN NAD-dependent protein deacetylase OS=Bacillus anthracis GN=cobB PE=3 SV=1 52 166 8.0E-07
sp|Q9KEE5|NPD_BACHD NAD-dependent protein deacetylase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cobB PE=3 SV=1 51 166 9.0E-07
sp|Q639M6|NPD_BACCZ NAD-dependent protein deacetylase OS=Bacillus cereus (strain ZK / E33L) GN=cobB PE=3 SV=1 52 166 1.0E-06
sp|Q9I4L0|NPD1_PSEAE NAD-dependent protein deacylase 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cobB1 PE=3 SV=1 51 170 1.0E-06
sp|Q9A2S6|NPD_CAUCR NAD-dependent protein deacylase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=cobB PE=3 SV=1 52 171 2.0E-06
sp|A9SDL4|SIR5_PHYPA NAD-dependent protein deacylase OS=Physcomitrella patens subsp. patens GN=SRT1505 PE=3 SV=1 51 168 2.0E-06
sp|Q8Y015|NPD_RALSO NAD-dependent protein deacylase OS=Ralstonia solanacearum (strain GMI1000) GN=cobB PE=3 SV=1 51 158 2.0E-06
sp|Q87W79|NPD4_PSESM NAD-dependent protein deacylase 4 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cobB4 PE=3 SV=1 51 166 4.0E-06
sp|Q669P6|NPD_YERPS NAD-dependent protein deacylase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cobB PE=3 SV=2 51 164 5.0E-06
sp|Q8ZFR1|NPD_YERPE NAD-dependent protein deacylase OS=Yersinia pestis GN=cobB PE=3 SV=2 51 164 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0070403 NAD+ binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0051287 NAD binding No
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6257
MRPQFMRIPYTDIAPSSASIPGFATTLPRAVTALCAFVAAPPPRGLPSSSVLLTGAGLSVPSGLADYRGARGTYR
VNKSYRPIYYPEFLASHEARKRYWARSFLGWPSLRKAQPNEAHYAIRDLGQLGLVRSVITQNVDSLHPRAHPDIP
SLELHGYLRSTICTTCLAHFPRDEFQHHLARLNPHWANLLKEALASGALDTDDPAERRFKGLRANPDGDVDLPQA
PYTTFRYPPCPQCLANPPKAPDGSKHTLHIDEQGAWIPPSTTGVLKPAVVMFGESIAHDVKTAADEAIDGAGRLL
ILATSLATYSAWRLAKRAKDRGMPIAIVSIGGVRGGDQLMAGIDPHQSGELGLRVQIPTEQLLPALVSELRKRLN
NA*
Coding >OphauG2|6257
ATGCGCCCCCAGTTTATGCGCATTCCATACACCGACATTGCTCCGTCATCGGCTTCCATCCCCGGCTTTGCCACC
ACGCTTCCCCGCGCCGTCACCGCCCTCTGTGCCTTTGTCGCCGCACCACCGCCTCGCGGCCTGCCCTCGTCTTCC
GTCCTCCTCACCGGCGCCGGCCTCTCGGTACCTTCCGGCCTCGCAGACTATCGCGGTGCCCGCGGCACCTATCGC
GTCAACAAGTCATATCGCCCCATCTACTATCCCGAGTTCCTCGCCAGCCACGAGGCTCGCAAGCGTTATTGGGCT
CGTAGCTTCCTCGGCTGGCCCAGCCTGCGCAAGGCCCAGCCAAACGAGGCCCATTATGCCATCCGAGACCTTGGC
CAGCTAGGCCTTGTGCGCAGTGTCATTACCCAAAACGTCGATTCCCTGCATCCTCGAGCCCACCCTGACATTCCT
AGTCTTGAGCTCCATGGCTACCTTAGAAGCACTATCTGCACTACCTGTCTCGCCCACTTTCCCCGTGACGAGTTC
CAACACCACTTGGCCCGCCTGAATCCTCATTGGGCCAATCTGCTCAAAGAGGCTCTCGCGTCGGGAGCTCTCGAC
ACTGACGATCCTGCTGAGCGTCGCTTCAAAGGACTTCGCGCCAATCCTGACGGCGACGTCGACCTGCCCCAAGCC
CCATATACCACCTTTCGCTATCCGCCCTGCCCTCAATGCCTGGCCAATCCACCAAAGGCTCCTGACGGAAGCAAG
CACACTCTTCACATAGATGAACAAGGCGCATGGATACCACCGAGCACCACTGGTGTTCTCAAGCCTGCTGTCGTC
ATGTTTGGCGAGAGCATAGCCCATGACGTCAAGACAGCTGCCGACGAAGCTATTGACGGTGCTGGCAGGCTGCTC
ATCCTCGCCACATCGCTCGCCACGTATTCCGCATGGCGACTGGCCAAGCGTGCCAAAGACAGGGGAATGCCAATA
GCTATTGTTAGCATTGGCGGTGTCAGAGGCGGCGACCAGCTCATGGCCGGCATCGATCCGCATCAGTCTGGCGAG
CTTGGACTTCGAGTTCAGATACCGACCGAGCAGCTGTTGCCTGCGCTCGTCTCCGAGTTGCGAAAACGATTGAAT
AATGCGTGA
Transcript >OphauG2|6257
ATGCGCCCCCAGTTTATGCGCATTCCATACACCGACATTGCTCCGTCATCGGCTTCCATCCCCGGCTTTGCCACC
ACGCTTCCCCGCGCCGTCACCGCCCTCTGTGCCTTTGTCGCCGCACCACCGCCTCGCGGCCTGCCCTCGTCTTCC
GTCCTCCTCACCGGCGCCGGCCTCTCGGTACCTTCCGGCCTCGCAGACTATCGCGGTGCCCGCGGCACCTATCGC
GTCAACAAGTCATATCGCCCCATCTACTATCCCGAGTTCCTCGCCAGCCACGAGGCTCGCAAGCGTTATTGGGCT
CGTAGCTTCCTCGGCTGGCCCAGCCTGCGCAAGGCCCAGCCAAACGAGGCCCATTATGCCATCCGAGACCTTGGC
CAGCTAGGCCTTGTGCGCAGTGTCATTACCCAAAACGTCGATTCCCTGCATCCTCGAGCCCACCCTGACATTCCT
AGTCTTGAGCTCCATGGCTACCTTAGAAGCACTATCTGCACTACCTGTCTCGCCCACTTTCCCCGTGACGAGTTC
CAACACCACTTGGCCCGCCTGAATCCTCATTGGGCCAATCTGCTCAAAGAGGCTCTCGCGTCGGGAGCTCTCGAC
ACTGACGATCCTGCTGAGCGTCGCTTCAAAGGACTTCGCGCCAATCCTGACGGCGACGTCGACCTGCCCCAAGCC
CCATATACCACCTTTCGCTATCCGCCCTGCCCTCAATGCCTGGCCAATCCACCAAAGGCTCCTGACGGAAGCAAG
CACACTCTTCACATAGATGAACAAGGCGCATGGATACCACCGAGCACCACTGGTGTTCTCAAGCCTGCTGTCGTC
ATGTTTGGCGAGAGCATAGCCCATGACGTCAAGACAGCTGCCGACGAAGCTATTGACGGTGCTGGCAGGCTGCTC
ATCCTCGCCACATCGCTCGCCACGTATTCCGCATGGCGACTGGCCAAGCGTGCCAAAGACAGGGGAATGCCAATA
GCTATTGTTAGCATTGGCGGTGTCAGAGGCGGCGACCAGCTCATGGCCGGCATCGATCCGCATCAGTCTGGCGAG
CTTGGACTTCGAGTTCAGATACCGACCGAGCAGCTGTTGCCTGCGCTCGTCTCCGAGTTGCGAAAACGATTGAAT
AATGCGTGA
Gene >OphauG2|6257
ATGCGCCCCCAGTTTATGCGCATTCCATACACCGACATTGCTCCGTCATCGGCTTCCATCCCCGGCTTTGCCACC
ACGCTTCCCCGCGCCGTCACCGCCCTCTGTGCCTTTGTCGCCGCACCACCGCCTCGCGGCCTGCCCTCGTCTTCC
GTCCTCCTCACCGGCGCCGGCCTCTCGGTACCTTCCGGCCTCGCAGACTATCGCGGTGCCCGCGGCACCTATCGC
GTCAACAAGTCATATCGCCCCATCTACTATCCCGAGTTCCTCGCCAGCCACGAGGCTCGCAAGCGTTATTGGGCT
CGTAGCTTCCTCGGCTGGCCCAGCCTGCGCAAGGCCCAGCCAAACGAGGCCCATTATGCCATCCGAGACCTTGGC
CAGCTAGGCCTTGTGCGCAGTGTCATTACCCAAAACGTCGATTCCCTGCATCCTCGAGCCCACCCTGACATTCCT
AGTCTTGAGCTCCATGGCTACCTTAGAAGCACTATCTGCACTACCTGTCTCGCCCACTTTCCCCGTGACGAGTTC
CAACACCACTTGGCCCGCCTGAATCCTCATTGGGCCAATCTGCTCAAAGAGGCTCTCGCGTCGGGAGCTCTCGAC
ACTGACGATCCTGCTGAGCGTCGCTTCAAAGGACTTCGCGCCAATCCTGACGGCGACGTCGACCTGCCCCAAGCC
CCATATACCACCTTTCGCTATCCGCCCTGCCCTCAATGCCTGGCCAATCCACCAAAGGCTCCTGACGGAAGCAAG
CACACTCTTCACATAGATGAACAAGGCGCATGGATACCACCGAGCACCACTGGTGTTCTCAAGCCTGCTGTCGTC
ATGTTTGGCGAGAGCATAGCCCATGACGTCAAGACAGCTGCCGACGAAGCTATTGACGGTGCTGGCAGGCTGCTC
ATCCTCGCCACATCGCTCGCCACGTATTCCGCATGGCGACTGGCCAAGCGTGCCAAAGACAGGGGAATGCCAATA
GCTATTGTTAGCATTGGCGGTGTCAGAGGCGGCGACCAGCTCATGGCCGGCATCGATCCGCATCAGTCTGGCGAG
CTTGGACTTCGAGTTCAGATACCGACCGAGCAGCTGTTGCCTGCGCTCGTCTCCGAGTTGCGAAAACGATTGAAT
AATGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail