Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6254
Gene name
LocationContig_629:5544..8097
Strand-
Gene length (bp)2553
Transcript length (bp)2553
Coding sequence length (bp)2553
Protein length (aa) 851

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00888 Cullin Cullin family 2.7E-22 520 730
PF08672 ANAPC2 Anaphase promoting complex (APC) subunit 2 5.3E-21 789 847

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UJX6|ANC2_HUMAN Anaphase-promoting complex subunit 2 OS=Homo sapiens GN=ANAPC2 PE=1 SV=1 302 850 6.0E-61
sp|Q8BZQ7|ANC2_MOUSE Anaphase-promoting complex subunit 2 OS=Mus musculus GN=Anapc2 PE=1 SV=2 302 850 2.0E-58
sp|Q874R3|APC2_SCHPO Anaphase-promoting complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apc2 PE=1 SV=1 308 847 6.0E-58
sp|Q8H1U5|APC2_ARATH Anaphase-promoting complex subunit 2 OS=Arabidopsis thaliana GN=APC2 PE=1 SV=1 340 849 2.0E-53
sp|Q551S9|APC2_DICDI Anaphase-promoting complex subunit 2 OS=Dictyostelium discoideum GN=anapc2 PE=3 SV=1 348 849 9.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UJX6|ANC2_HUMAN Anaphase-promoting complex subunit 2 OS=Homo sapiens GN=ANAPC2 PE=1 SV=1 302 850 6.0E-61
sp|Q8BZQ7|ANC2_MOUSE Anaphase-promoting complex subunit 2 OS=Mus musculus GN=Anapc2 PE=1 SV=2 302 850 2.0E-58
sp|Q874R3|APC2_SCHPO Anaphase-promoting complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apc2 PE=1 SV=1 308 847 6.0E-58
sp|Q8H1U5|APC2_ARATH Anaphase-promoting complex subunit 2 OS=Arabidopsis thaliana GN=APC2 PE=1 SV=1 340 849 2.0E-53
sp|Q551S9|APC2_DICDI Anaphase-promoting complex subunit 2 OS=Dictyostelium discoideum GN=anapc2 PE=3 SV=1 348 849 9.0E-46
sp|P34514|ANC2_CAEEL Anaphase-promoting complex subunit 2 OS=Caenorhabditis elegans GN=apc-2 PE=1 SV=3 385 671 2.0E-25
sp|Q12440|APC2_YEAST Anaphase-promoting complex subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APC2 PE=1 SV=1 249 849 2.0E-17
sp|Q9SRZ0|CUL2_ARATH Cullin-2 OS=Arabidopsis thaliana GN=CUL2 PE=1 SV=1 506 703 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0031625 ubiquitin protein ligase binding Yes
GO:0006511 ubiquitin-dependent protein catabolic process Yes
GO:0043170 macromolecule metabolic process No
GO:0044389 ubiquitin-like protein ligase binding No
GO:0019538 protein metabolic process No
GO:0009057 macromolecule catabolic process No
GO:0044265 cellular macromolecule catabolic process No
GO:0044238 primary metabolic process No
GO:0009056 catabolic process No
GO:0008150 biological_process No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0019899 enzyme binding No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0005515 protein binding No
GO:0051603 proteolysis involved in protein catabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:0071704 organic substance metabolic process No
GO:0003674 molecular_function No
GO:0019941 modification-dependent protein catabolic process No
GO:0006508 proteolysis No
GO:0044260 cellular macromolecule metabolic process No
GO:0044248 cellular catabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:1901575 organic substance catabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1676
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6254 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3162
Ophiocordyceps camponoti-floridani Ophcf2|07279
Ophiocordyceps camponoti-rufipedis Ophun1|6002
Ophiocordyceps kimflemingae Ophio5|2050
Ophiocordyceps subramaniannii Hirsu2|1430

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6254
MATASALRSRRNKIFRSVFSHDDLSQPTPRLAPTALDESFGAHLVGPSSPLPPAVSDQVRWDRAWHTVTSRLQLP
SSVTVEDSFGTLPSESQDAVSDTLFHDALGVVVAPSIAVPAAAHTQDILAWHIRQVRQHFFHHVMPLLSACTMGS
EEVQIIRASVQTLEAAHRQYLHGLTLIARGIHEPSQRASIISRFKRHLLAIVGNAWTWDLKTTLRTTLQCLVDDI
LGTSPSSPRRDAQAANYELLGLLGSLASVGLAGHQFQVLFAEIMDRCMRKYISQTYSRVWTTLDGPNPGSQQWAG
CMDHLNNWIENQYGRLVGQVYDRIGGQLGSNDLESWRDVAIGRLATLRINELFDIILEWPHSKGGLEDLRASVTT
PQRRLQLTQDFSVILKDRLLQPSKSTLDILQTYMSMIRTFHALDSSKVLLDRVVHALQLYLCRRDDAIRIVVEGL
LANPDPSCTSEEQKSKLGELAAMLNDISQQQQSGRAVDEDDLDWDDMAWVPDPADAGVNYKRPKNEDVTGTLIKA
LGSQEIFIREFQVIMAERLLSSQTDFKQEGKVLLLLKKMFGDNALQNCDVMIKDMMDSRSVDDLIVKSLHASSDK
RDAAVTFHSKILSRLFWPALPRETFQVPRSVSEVRHQYQAGFEQLKSMRKLDWLEHLGSAMVRLDLQDRTIELEC
RTYEAAVIYAFTDNDSEPPGLQRSFDQLWRDLKMDEDLLEAALDFWVSKQVLRNTGNQTYTVLEKLADRGNQSGD
RINEIATAGTGQERSQSSPRKPKSINAAEAQRRMVYWQYIVGMLTNSSPTMPLGQILMMMKMLIADGCSWSNEEL
QTFLGEKVLEGELELVGGKYKLAKK*
Coding >OphauG2|6254
ATGGCGACAGCTTCAGCCCTCCGAAGCCGCAGAAACAAAATCTTTCGCTCCGTCTTCTCACACGACGACTTGTCC
CAGCCCACGCCGCGTCTTGCACCGACAGCCTTGGACGAATCCTTTGGCGCCCACCTTGTCGGCCCGTCGTCGCCA
TTGCCACCCGCCGTCAGCGACCAGGTACGATGGGATCGCGCTTGGCATACCGTTACCTCTCGCCTTCAGCTGCCA
TCGTCAGTCACGGTCGAGGACTCTTTCGGCACCCTGCCGTCCGAGTCCCAGGACGCTGTCAGCGACACTCTATTC
CACGATGCCCTTGGCGTCGTTGTCGCTCCCTCGATAGCCGTGCCCGCCGCTGCCCACACTCAAGACATCCTCGCA
TGGCATATCCGTCAGGTCCGTCAGCACTTCTTCCACCACGTCATGCCGCTCCTGTCTGCATGCACCATGGGCTCT
GAAGAGGTTCAAATCATACGCGCCAGCGTCCAGACCCTTGAGGCTGCGCATCGGCAGTACCTACATGGCCTGACG
CTCATTGCCCGCGGCATCCACGAGCCCAGCCAACGCGCCTCCATCATTTCCCGCTTCAAACGCCATCTTTTGGCC
ATTGTTGGCAACGCATGGACCTGGGACCTCAAGACTACACTGCGCACCACGTTGCAGTGCCTCGTGGATGACATT
TTGGGCACGAGTCCGTCGAGCCCACGCCGCGACGCCCAAGCTGCCAACTACGAACTCTTGGGCTTGCTTGGCTCC
TTGGCTAGCGTTGGCCTGGCCGGCCACCAATTCCAGGTTCTTTTTGCTGAAATCATGGACCGGTGCATGCGCAAA
TACATTTCCCAGACATACTCGCGCGTCTGGACCACGCTTGACGGGCCGAATCCAGGCAGCCAACAGTGGGCCGGG
TGCATGGACCATCTCAACAACTGGATCGAGAACCAGTATGGGCGGCTGGTCGGCCAAGTTTATGACCGCATTGGT
GGCCAGCTTGGCAGCAACGACTTGGAGAGCTGGCGGGATGTTGCCATTGGGCGCCTTGCCACACTGCGCATCAAT
GAGCTGTTTGACATTATACTCGAGTGGCCACACAGCAAAGGCGGTCTCGAGGATCTTCGCGCCTCGGTCACGACA
CCTCAGAGGCGTTTGCAGCTCACTCAGGATTTTTCCGTCATCCTCAAGGACAGACTGCTGCAGCCCAGCAAATCT
ACTCTGGACATCTTGCAGACGTACATGTCCATGATTCGAACCTTTCATGCCTTGGACTCGTCAAAGGTCTTGTTG
GACAGAGTAGTGCACGCGCTGCAGCTTTACCTATGTCGGAGAGACGATGCTATCCGTATTGTGGTTGAGGGGCTT
CTCGCTAATCCAGACCCGTCTTGTACTAGCGAGGAGCAAAAGAGCAAGCTTGGTGAGCTCGCTGCCATGCTCAAC
GACATTTCTCAGCAGCAGCAAAGTGGCCGCGCCGTTGACGAAGACGATCTCGACTGGGACGATATGGCCTGGGTC
CCTGACCCTGCTGATGCTGGCGTCAACTATAAACGACCCAAGAACGAAGACGTGACGGGTACTCTCATCAAAGCC
CTCGGGTCGCAGGAGATCTTTATCAGAGAATTCCAAGTAATCATGGCGGAGCGGCTACTGTCAAGCCAGACCGAC
TTTAAGCAGGAGGGCAAGGTGCTCTTGCTACTAAAGAAGATGTTTGGGGACAATGCACTTCAAAACTGCGATGTC
ATGATCAAGGACATGATGGACTCGAGAAGCGTTGATGACCTGATTGTCAAGAGTCTGCATGCTTCCAGTGACAAG
AGGGATGCGGCTGTGACTTTTCACTCCAAGATACTATCTCGCCTATTTTGGCCTGCCCTCCCAAGAGAGACGTTT
CAAGTACCACGGTCAGTGTCTGAGGTGCGGCACCAATATCAAGCTGGTTTCGAGCAACTCAAGTCGATGCGCAAA
CTCGACTGGCTAGAGCACCTCGGGTCAGCAATGGTGCGTCTCGATCTGCAAGATCGCACCATTGAGCTGGAGTGC
AGGACATACGAGGCAGCAGTCATTTATGCCTTTACAGACAATGACTCGGAGCCACCGGGGTTACAGCGGTCTTTT
GATCAGCTATGGCGAGACTTGAAGATGGATGAAGACTTGCTCGAGGCTGCCCTCGATTTTTGGGTGTCAAAGCAG
GTATTGCGCAACACGGGCAATCAGACATACACGGTGCTGGAGAAACTTGCCGACAGGGGTAACCAGTCAGGGGAC
AGGATCAACGAGATAGCCACAGCGGGAACGGGCCAAGAGCGTAGCCAAAGCTCACCGCGTAAGCCAAAGAGCATC
AACGCGGCAGAAGCACAAAGACGGATGGTCTATTGGCAGTATATTGTGGGCATGCTGACAAATTCGAGCCCGACG
ATGCCGTTGGGCCAGATTTTGATGATGATGAAGATGCTCATTGCCGACGGCTGCTCTTGGAGCAACGAGGAGCTG
CAGACTTTTCTTGGGGAAAAGGTGTTGGAGGGCGAGTTGGAGTTGGTTGGCGGCAAGTACAAGCTTGCCAAGAAA
TGA
Transcript >OphauG2|6254
ATGGCGACAGCTTCAGCCCTCCGAAGCCGCAGAAACAAAATCTTTCGCTCCGTCTTCTCACACGACGACTTGTCC
CAGCCCACGCCGCGTCTTGCACCGACAGCCTTGGACGAATCCTTTGGCGCCCACCTTGTCGGCCCGTCGTCGCCA
TTGCCACCCGCCGTCAGCGACCAGGTACGATGGGATCGCGCTTGGCATACCGTTACCTCTCGCCTTCAGCTGCCA
TCGTCAGTCACGGTCGAGGACTCTTTCGGCACCCTGCCGTCCGAGTCCCAGGACGCTGTCAGCGACACTCTATTC
CACGATGCCCTTGGCGTCGTTGTCGCTCCCTCGATAGCCGTGCCCGCCGCTGCCCACACTCAAGACATCCTCGCA
TGGCATATCCGTCAGGTCCGTCAGCACTTCTTCCACCACGTCATGCCGCTCCTGTCTGCATGCACCATGGGCTCT
GAAGAGGTTCAAATCATACGCGCCAGCGTCCAGACCCTTGAGGCTGCGCATCGGCAGTACCTACATGGCCTGACG
CTCATTGCCCGCGGCATCCACGAGCCCAGCCAACGCGCCTCCATCATTTCCCGCTTCAAACGCCATCTTTTGGCC
ATTGTTGGCAACGCATGGACCTGGGACCTCAAGACTACACTGCGCACCACGTTGCAGTGCCTCGTGGATGACATT
TTGGGCACGAGTCCGTCGAGCCCACGCCGCGACGCCCAAGCTGCCAACTACGAACTCTTGGGCTTGCTTGGCTCC
TTGGCTAGCGTTGGCCTGGCCGGCCACCAATTCCAGGTTCTTTTTGCTGAAATCATGGACCGGTGCATGCGCAAA
TACATTTCCCAGACATACTCGCGCGTCTGGACCACGCTTGACGGGCCGAATCCAGGCAGCCAACAGTGGGCCGGG
TGCATGGACCATCTCAACAACTGGATCGAGAACCAGTATGGGCGGCTGGTCGGCCAAGTTTATGACCGCATTGGT
GGCCAGCTTGGCAGCAACGACTTGGAGAGCTGGCGGGATGTTGCCATTGGGCGCCTTGCCACACTGCGCATCAAT
GAGCTGTTTGACATTATACTCGAGTGGCCACACAGCAAAGGCGGTCTCGAGGATCTTCGCGCCTCGGTCACGACA
CCTCAGAGGCGTTTGCAGCTCACTCAGGATTTTTCCGTCATCCTCAAGGACAGACTGCTGCAGCCCAGCAAATCT
ACTCTGGACATCTTGCAGACGTACATGTCCATGATTCGAACCTTTCATGCCTTGGACTCGTCAAAGGTCTTGTTG
GACAGAGTAGTGCACGCGCTGCAGCTTTACCTATGTCGGAGAGACGATGCTATCCGTATTGTGGTTGAGGGGCTT
CTCGCTAATCCAGACCCGTCTTGTACTAGCGAGGAGCAAAAGAGCAAGCTTGGTGAGCTCGCTGCCATGCTCAAC
GACATTTCTCAGCAGCAGCAAAGTGGCCGCGCCGTTGACGAAGACGATCTCGACTGGGACGATATGGCCTGGGTC
CCTGACCCTGCTGATGCTGGCGTCAACTATAAACGACCCAAGAACGAAGACGTGACGGGTACTCTCATCAAAGCC
CTCGGGTCGCAGGAGATCTTTATCAGAGAATTCCAAGTAATCATGGCGGAGCGGCTACTGTCAAGCCAGACCGAC
TTTAAGCAGGAGGGCAAGGTGCTCTTGCTACTAAAGAAGATGTTTGGGGACAATGCACTTCAAAACTGCGATGTC
ATGATCAAGGACATGATGGACTCGAGAAGCGTTGATGACCTGATTGTCAAGAGTCTGCATGCTTCCAGTGACAAG
AGGGATGCGGCTGTGACTTTTCACTCCAAGATACTATCTCGCCTATTTTGGCCTGCCCTCCCAAGAGAGACGTTT
CAAGTACCACGGTCAGTGTCTGAGGTGCGGCACCAATATCAAGCTGGTTTCGAGCAACTCAAGTCGATGCGCAAA
CTCGACTGGCTAGAGCACCTCGGGTCAGCAATGGTGCGTCTCGATCTGCAAGATCGCACCATTGAGCTGGAGTGC
AGGACATACGAGGCAGCAGTCATTTATGCCTTTACAGACAATGACTCGGAGCCACCGGGGTTACAGCGGTCTTTT
GATCAGCTATGGCGAGACTTGAAGATGGATGAAGACTTGCTCGAGGCTGCCCTCGATTTTTGGGTGTCAAAGCAG
GTATTGCGCAACACGGGCAATCAGACATACACGGTGCTGGAGAAACTTGCCGACAGGGGTAACCAGTCAGGGGAC
AGGATCAACGAGATAGCCACAGCGGGAACGGGCCAAGAGCGTAGCCAAAGCTCACCGCGTAAGCCAAAGAGCATC
AACGCGGCAGAAGCACAAAGACGGATGGTCTATTGGCAGTATATTGTGGGCATGCTGACAAATTCGAGCCCGACG
ATGCCGTTGGGCCAGATTTTGATGATGATGAAGATGCTCATTGCCGACGGCTGCTCTTGGAGCAACGAGGAGCTG
CAGACTTTTCTTGGGGAAAAGGTGTTGGAGGGCGAGTTGGAGTTGGTTGGCGGCAAGTACAAGCTTGCCAAGAAA
TGA
Gene >OphauG2|6254
ATGGCGACAGCTTCAGCCCTCCGAAGCCGCAGAAACAAAATCTTTCGCTCCGTCTTCTCACACGACGACTTGTCC
CAGCCCACGCCGCGTCTTGCACCGACAGCCTTGGACGAATCCTTTGGCGCCCACCTTGTCGGCCCGTCGTCGCCA
TTGCCACCCGCCGTCAGCGACCAGGTACGATGGGATCGCGCTTGGCATACCGTTACCTCTCGCCTTCAGCTGCCA
TCGTCAGTCACGGTCGAGGACTCTTTCGGCACCCTGCCGTCCGAGTCCCAGGACGCTGTCAGCGACACTCTATTC
CACGATGCCCTTGGCGTCGTTGTCGCTCCCTCGATAGCCGTGCCCGCCGCTGCCCACACTCAAGACATCCTCGCA
TGGCATATCCGTCAGGTCCGTCAGCACTTCTTCCACCACGTCATGCCGCTCCTGTCTGCATGCACCATGGGCTCT
GAAGAGGTTCAAATCATACGCGCCAGCGTCCAGACCCTTGAGGCTGCGCATCGGCAGTACCTACATGGCCTGACG
CTCATTGCCCGCGGCATCCACGAGCCCAGCCAACGCGCCTCCATCATTTCCCGCTTCAAACGCCATCTTTTGGCC
ATTGTTGGCAACGCATGGACCTGGGACCTCAAGACTACACTGCGCACCACGTTGCAGTGCCTCGTGGATGACATT
TTGGGCACGAGTCCGTCGAGCCCACGCCGCGACGCCCAAGCTGCCAACTACGAACTCTTGGGCTTGCTTGGCTCC
TTGGCTAGCGTTGGCCTGGCCGGCCACCAATTCCAGGTTCTTTTTGCTGAAATCATGGACCGGTGCATGCGCAAA
TACATTTCCCAGACATACTCGCGCGTCTGGACCACGCTTGACGGGCCGAATCCAGGCAGCCAACAGTGGGCCGGG
TGCATGGACCATCTCAACAACTGGATCGAGAACCAGTATGGGCGGCTGGTCGGCCAAGTTTATGACCGCATTGGT
GGCCAGCTTGGCAGCAACGACTTGGAGAGCTGGCGGGATGTTGCCATTGGGCGCCTTGCCACACTGCGCATCAAT
GAGCTGTTTGACATTATACTCGAGTGGCCACACAGCAAAGGCGGTCTCGAGGATCTTCGCGCCTCGGTCACGACA
CCTCAGAGGCGTTTGCAGCTCACTCAGGATTTTTCCGTCATCCTCAAGGACAGACTGCTGCAGCCCAGCAAATCT
ACTCTGGACATCTTGCAGACGTACATGTCCATGATTCGAACCTTTCATGCCTTGGACTCGTCAAAGGTCTTGTTG
GACAGAGTAGTGCACGCGCTGCAGCTTTACCTATGTCGGAGAGACGATGCTATCCGTATTGTGGTTGAGGGGCTT
CTCGCTAATCCAGACCCGTCTTGTACTAGCGAGGAGCAAAAGAGCAAGCTTGGTGAGCTCGCTGCCATGCTCAAC
GACATTTCTCAGCAGCAGCAAAGTGGCCGCGCCGTTGACGAAGACGATCTCGACTGGGACGATATGGCCTGGGTC
CCTGACCCTGCTGATGCTGGCGTCAACTATAAACGACCCAAGAACGAAGACGTGACGGGTACTCTCATCAAAGCC
CTCGGGTCGCAGGAGATCTTTATCAGAGAATTCCAAGTAATCATGGCGGAGCGGCTACTGTCAAGCCAGACCGAC
TTTAAGCAGGAGGGCAAGGTGCTCTTGCTACTAAAGAAGATGTTTGGGGACAATGCACTTCAAAACTGCGATGTC
ATGATCAAGGACATGATGGACTCGAGAAGCGTTGATGACCTGATTGTCAAGAGTCTGCATGCTTCCAGTGACAAG
AGGGATGCGGCTGTGACTTTTCACTCCAAGATACTATCTCGCCTATTTTGGCCTGCCCTCCCAAGAGAGACGTTT
CAAGTACCACGGTCAGTGTCTGAGGTGCGGCACCAATATCAAGCTGGTTTCGAGCAACTCAAGTCGATGCGCAAA
CTCGACTGGCTAGAGCACCTCGGGTCAGCAATGGTGCGTCTCGATCTGCAAGATCGCACCATTGAGCTGGAGTGC
AGGACATACGAGGCAGCAGTCATTTATGCCTTTACAGACAATGACTCGGAGCCACCGGGGTTACAGCGGTCTTTT
GATCAGCTATGGCGAGACTTGAAGATGGATGAAGACTTGCTCGAGGCTGCCCTCGATTTTTGGGTGTCAAAGCAG
GTATTGCGCAACACGGGCAATCAGACATACACGGTGCTGGAGAAACTTGCCGACAGGGGTAACCAGTCAGGGGAC
AGGATCAACGAGATAGCCACAGCGGGAACGGGCCAAGAGCGTAGCCAAAGCTCACCGCGTAAGCCAAAGAGCATC
AACGCGGCAGAAGCACAAAGACGGATGGTCTATTGGCAGTATATTGTGGGCATGCTGACAAATTCGAGCCCGACG
ATGCCGTTGGGCCAGATTTTGATGATGATGAAGATGCTCATTGCCGACGGCTGCTCTTGGAGCAACGAGGAGCTG
CAGACTTTTCTTGGGGAAAAGGTGTTGGAGGGCGAGTTGGAGTTGGTTGGCGGCAAGTACAAGCTTGCCAAGAAA
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail