Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6249
Gene name
LocationContig_628:2684..3188
Strand-
Gene length (bp)504
Transcript length (bp)321
Coding sequence length (bp)321
Protein length (aa) 107

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07876 Dabb Stress responsive A/B Barrel Domain 6.4E-13 5 99

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4650
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6249 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7553
Ophiocordyceps camponoti-floridani Ophcf2|06917
Ophiocordyceps camponoti-rufipedis Ophun1|1927
Ophiocordyceps kimflemingae Ophio5|5965
Ophiocordyceps subramaniannii Hirsu2|9799

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6249
MARPIHRITLFKIPSQEDQQRLIEVYKKMPSKAVKDGKPYILSVTAGFAKPDQRAQGYTVAVISVFSSVDDMTYY
DNECAAHADLKTLAKSIHQGAMMVFFENEIV*
Coding >OphauG2|6249
ATGGCCCGTCCAATTCACCGTATTACCCTCTTCAAAATTCCCAGCCAAGAGGATCAACAGCGACTCATAGAGGTG
TACAAAAAGATGCCCTCCAAGGCCGTCAAGGACGGAAAACCATACATCCTCTCCGTCACTGCAGGCTTTGCAAAG
CCCGACCAACGCGCCCAGGGATATACCGTGGCTGTCATTTCAGTCTTCAGCTCCGTCGACGACATGACCTACTAC
GACAATGAGTGTGCTGCCCATGCTGACCTCAAGACACTGGCAAAGTCGATTCACCAGGGCGCCATGATGGTATTT
TTCGAAAATGAAATCGTCTGA
Transcript >OphauG2|6249
ATGGCCCGTCCAATTCACCGTATTACCCTCTTCAAAATTCCCAGCCAAGAGGATCAACAGCGACTCATAGAGGTG
TACAAAAAGATGCCCTCCAAGGCCGTCAAGGACGGAAAACCATACATCCTCTCCGTCACTGCAGGCTTTGCAAAG
CCCGACCAACGCGCCCAGGGATATACCGTGGCTGTCATTTCAGTCTTCAGCTCCGTCGACGACATGACCTACTAC
GACAATGAGTGTGCTGCCCATGCTGACCTCAAGACACTGGCAAAGTCGATTCACCAGGGCGCCATGATGGTATTT
TTCGAAAATGAAATCGTCTGA
Gene >OphauG2|6249
ATGGCCCGTCCAATTCACCGTATTACCCTCTTCAAAATTCCCAGCCAAGAGGATCAACAGCGACTCATAGAGGTG
TACAAAAAGATGCCCTCCAAGGCCGTCAAGGTACGCCACCTTTTGCCCAGACACGCCCTCTCCACCACCGCATCC
TGTCCATCTACAATCTCCGCAATTCCTCTCATCTCCTCCCCATTTTCCTTCCAAAAAAAAAAAATCAAGTTTAAG
AAAATAAAAAAAAAAACACCTCTTCCACATCTTCCACCTCCACAAACTCACTTATTATTCCAGGACGGAAAACCA
TACATCCTCTCCGTCACTGCAGGCTTTGCAAAGCCCGACCAACGCGCCCAGGGATATACCGTGGCTGTCATTTCA
GTCTTCAGCTCCGTCGACGACATGACCTACTACGACAATGAGTGTGCTGCCCATGCTGACCTCAAGACACTGGCA
AAGTCGATTCACCAGGGCGCCATGATGGTATTTTTCGAAAATGAAATCGTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail