Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6227
Gene name
LocationContig_622:6526..9103
Strand-
Gene length (bp)2577
Transcript length (bp)2508
Coding sequence length (bp)2508
Protein length (aa) 836

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13855 LRR_8 Leucine rich repeat 1.0E-06 444 502

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUG2|YFT6_SCHPO Uncharacterized leucine-rich repeat-containing protein C926.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC926.06c PE=1 SV=1 5 795 2.0E-67
sp|Q9Y2I1|NISCH_HUMAN Nischarin OS=Homo sapiens GN=NISCH PE=1 SV=3 417 588 6.0E-11
sp|Q4G017|NISCH_RAT Nischarin OS=Rattus norvegicus GN=Nisch PE=2 SV=2 458 588 1.0E-10
sp|Q80TM9|NISCH_MOUSE Nischarin OS=Mus musculus GN=Nisch PE=1 SV=2 432 588 5.0E-10
sp|Q5F479|S11IP_CHICK Serine/threonine-protein kinase 11-interacting protein OS=Gallus gallus GN=STK11IP PE=2 SV=1 441 602 6.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUG2|YFT6_SCHPO Uncharacterized leucine-rich repeat-containing protein C926.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC926.06c PE=1 SV=1 5 795 2.0E-67
sp|Q9Y2I1|NISCH_HUMAN Nischarin OS=Homo sapiens GN=NISCH PE=1 SV=3 417 588 6.0E-11
sp|Q4G017|NISCH_RAT Nischarin OS=Rattus norvegicus GN=Nisch PE=2 SV=2 458 588 1.0E-10
sp|Q80TM9|NISCH_MOUSE Nischarin OS=Mus musculus GN=Nisch PE=1 SV=2 432 588 5.0E-10
sp|Q5F479|S11IP_CHICK Serine/threonine-protein kinase 11-interacting protein OS=Gallus gallus GN=STK11IP PE=2 SV=1 441 602 6.0E-10
sp|Q6IRN0|S11IP_XENLA Serine/threonine-protein kinase 11-interacting protein OS=Xenopus laevis GN=stk11ip PE=2 SV=1 431 581 7.0E-10
sp|Q8CDN9|LRRC9_MOUSE Leucine-rich repeat-containing protein 9 OS=Mus musculus GN=Lrrc9 PE=1 SV=2 444 587 3.0E-09
sp|Q6P4K6|S11IP_XENTR Serine/threonine-protein kinase 11-interacting protein OS=Xenopus tropicalis GN=stk11ip PE=2 SV=1 431 581 1.0E-08
sp|Q9D2H9|DAAF1_MOUSE Dynein assembly factor 1, axonemal OS=Mus musculus GN=Dnaaf1 PE=1 SV=1 360 584 2.0E-08
sp|Q6ZRR7|LRRC9_HUMAN Leucine-rich repeat-containing protein 9 OS=Homo sapiens GN=LRRC9 PE=2 SV=2 444 587 4.0E-08
sp|Q8NEP3|DAAF1_HUMAN Dynein assembly factor 1, axonemal OS=Homo sapiens GN=DNAAF1 PE=1 SV=5 414 584 8.0E-08
sp|B6D5P6|DAAF1_PERCA Dynein assembly factor 1, axonemal OS=Peromyscus californicus GN=Dnaaf1 PE=2 SV=1 414 584 1.0E-07
sp|B6D5P1|DAAF1_PERPL Dynein assembly factor 1, axonemal OS=Peromyscus polionotus GN=Dnaaf1 PE=2 SV=1 414 584 2.0E-07
sp|B6D5P3|DAAF1_PERLE Dynein assembly factor 1, axonemal OS=Peromyscus leucopus GN=Dnaaf1 PE=2 SV=1 414 584 2.0E-07
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 444 571 5.0E-07
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 444 571 5.0E-07
sp|Q8N1F8|S11IP_HUMAN Serine/threonine-protein kinase 11-interacting protein OS=Homo sapiens GN=STK11IP PE=1 SV=3 459 581 6.0E-07
sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 444 574 1.0E-06
sp|Q9GZY0|NXF2_HUMAN Nuclear RNA export factor 2 OS=Homo sapiens GN=NXF2 PE=1 SV=1 495 579 1.0E-06
sp|Q9ERV7|PIDD1_MOUSE p53-induced death domain-containing protein 1 OS=Mus musculus GN=Pidd1 PE=1 SV=1 432 573 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2487
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6227 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4091
Ophiocordyceps camponoti-floridani Ophcf2|04489
Ophiocordyceps camponoti-rufipedis Ophun1|972
Ophiocordyceps kimflemingae Ophio5|1598
Ophiocordyceps subramaniannii Hirsu2|3595

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6227
MDSENGELFVKQLAVFVRTHEKALANALQFQRREVRHRPSQSTSAATLTQSTPLPERPSTASSTTSSLATAFSFG
PLNFTSHNVKSAKLALTPHHLFYLLSRFEELAINVGPMKVRLENLHDSSSTSNYVSFLGNTGRSRSRGSDVGSIH
SVSSMRSVMSGMSALWTSLGIGASISAARTERHKAAVQADLKYLYSAFTKVPCLRLAPDWRARLIRGYEEFPFDS
AVPLYVFKNLQALEICNIDFRQFFGWDRLADQLRSLTLKSAGIEDLADVLIDIVLDDMDKRRRRTSKSQTSPTAP
VGASNSPRRSMATSPPDAIRALSAPGSPETRNVLAELRTGSATPSERAIEDDASDTPRPRASLDESDEMLRSPGK
GTRPRSNSPSRPPSSRNNSSHMRSSQRIKRSGSGSSHSSLSDSWHYHSRGSAANLLATGTLPSTKWRFLRHLSLA
DNSMTSIPCTSLAPLANTLFSLDLSSNLFSQIPDSLATLTALRALNLAHCMIDSLNSLTRNPLPAITALNLRANR
LESLAGIEKLFPLERLDLRDNRLTDVLELARLTGIPEIREIWIEGNPFTRTHKDYRVTIFNMFRATPGYTTDIVI
DGYGPSYSEKRMLVERAPIPDSVPVVKPKAPEAPPVVEVSKPTILYGIPKEGGVLRKERPVSKTATSEVSCNPAR
RHKSTKRRIVDLATGETEACNDVRIMESKIDEMAHPGNYRISRPSEAMLPPVIMAGMHKNKPTVEARAMEDVPQS
PTNKPQIVGCDSQNWDVSGEAYRRKIEALRDRVGNGYLSVLSEEAWDGNGCYNANSVTAVPALRAGHLSPHVPAA
QAVHSGRTLG*
Coding >OphauG2|6227
ATGGATTCCGAAAACGGAGAGCTTTTCGTAAAGCAACTGGCTGTCTTTGTGCGTACGCACGAAAAGGCACTTGCC
AATGCGCTCCAGTTTCAGCGTCGCGAGGTCCGGCACCGACCTTCGCAGAGCACGAGCGCTGCAACACTCACTCAG
TCAACCCCGCTGCCAGAGCGTCCATCCACGGCCTCGTCCACCACCAGCTCGCTGGCCACGGCCTTTTCATTCGGC
CCTCTCAACTTTACCTCGCACAATGTCAAGTCTGCAAAGCTTGCCCTGACTCCTCATCACCTATTTTACCTTCTA
TCGCGCTTCGAGGAACTCGCCATCAATGTCGGGCCCATGAAGGTTCGTCTTGAGAATCTTCACGACAGCTCGTCT
ACATCAAACTATGTGTCCTTTCTCGGAAATACCGGTCGATCTCGGAGTCGAGGCTCCGATGTTGGCTCCATACAC
TCAGTGTCCAGCATGCGCAGCGTCATGTCTGGCATGTCGGCCCTGTGGACCAGCCTTGGCATTGGAGCCAGCATT
TCTGCTGCTCGTACCGAACGCCACAAGGCTGCTGTCCAAGCCGATCTCAAGTACCTGTATTCAGCCTTTACCAAG
GTGCCCTGCCTCCGATTGGCGCCTGATTGGCGCGCCCGACTTATTCGTGGCTACGAGGAATTCCCCTTTGACTCG
GCCGTTCCCCTTTACGTCTTCAAAAACTTGCAGGCCCTCGAAATCTGCAACATTGACTTCAGACAGTTCTTTGGC
TGGGACCGTTTGGCGGACCAGCTTCGCTCTCTCACACTCAAGAGCGCTGGAATAGAGGATCTAGCTGATGTATTA
ATCGACATTGTGCTCGATGACATGGACAAGAGACGCCGAAGAACCTCAAAGTCACAGACGTCCCCCACGGCGCCA
GTTGGTGCTAGCAATAGCCCCCGCCGAAGCATGGCCACGTCGCCCCCTGACGCCATTAGAGCATTGTCGGCTCCG
GGCTCGCCAGAGACTAGAAATGTCCTGGCCGAGTTGCGCACTGGCTCTGCCACGCCAAGTGAACGTGCCATTGAA
GACGACGCGTCTGATACTCCCAGGCCGCGCGCCAGCCTCGACGAGTCGGACGAGATGCTCCGGTCCCCAGGAAAA
GGGACCCGGCCACGGAGTAATTCTCCATCGCGGCCTCCCAGTTCGAGAAATAACTCGTCGCACATGCGCTCCTCT
CAGCGTATTAAGCGATCTGGCTCGGGGAGCTCACACTCGAGCCTGTCCGACTCGTGGCACTATCATTCTCGAGGC
AGCGCTGCCAATCTATTGGCTACGGGCACTTTGCCATCAACAAAGTGGCGATTTCTGCGGCATCTTAGTCTTGCC
GACAACTCAATGACGTCTATACCGTGTACGAGTCTGGCTCCTCTTGCCAACACGCTCTTCTCGCTCGATTTGTCC
TCGAATCTTTTTAGCCAGATTCCAGACAGCCTGGCTACTCTGACTGCTCTGCGCGCTCTCAACCTTGCCCATTGC
ATGATTGATTCACTCAATTCTCTCACTCGAAACCCCCTACCGGCAATTACGGCCTTGAATTTGCGAGCCAATAGA
CTCGAGTCTCTGGCGGGCATTGAAAAACTGTTTCCACTGGAAAGACTTGACTTGCGGGACAACCGTCTTACTGAT
GTGCTGGAACTCGCAAGACTGACTGGGATCCCCGAGATTCGAGAGATTTGGATCGAGGGCAACCCCTTTACCAGG
ACACACAAGGACTACCGTGTGACAATATTCAACATGTTTCGAGCCACCCCCGGATACACTACAGACATTGTGATT
GACGGCTACGGCCCCAGCTACTCAGAGAAGCGCATGCTCGTGGAGCGAGCTCCGATTCCCGACTCGGTGCCCGTG
GTGAAGCCCAAGGCACCAGAAGCGCCCCCAGTTGTCGAGGTTAGCAAACCGACAATTCTCTATGGCATACCCAAG
GAAGGTGGAGTCTTGCGCAAAGAAAGGCCTGTATCCAAGACGGCGACGAGCGAGGTTAGCTGCAATCCAGCGCGG
CGACACAAGTCGACTAAGAGACGCATCGTCGACCTTGCTACGGGTGAGACGGAGGCTTGCAACGATGTACGAATT
ATGGAGTCCAAGATTGATGAAATGGCACATCCGGGCAACTATCGCATTTCACGTCCGTCTGAAGCCATGCTGCCT
CCTGTGATTATGGCTGGCATGCACAAGAACAAGCCCACAGTCGAGGCCCGGGCCATGGAGGACGTGCCACAGAGC
CCTACCAACAAGCCACAGATTGTTGGCTGCGACTCACAGAACTGGGATGTCAGTGGCGAGGCATATCGCCGCAAA
ATCGAGGCCCTCCGTGACCGGGTTGGCAACGGATACCTGAGCGTCTTGAGCGAAGAAGCTTGGGACGGAAACGGC
TGCTACAATGCCAACAGTGTCACGGCGGTGCCTGCTTTGCGCGCTGGTCACTTGTCGCCCCATGTGCCGGCTGCT
CAAGCCGTTCACAGCGGTCGTACCTTGGGCTAG
Transcript >OphauG2|6227
ATGGATTCCGAAAACGGAGAGCTTTTCGTAAAGCAACTGGCTGTCTTTGTGCGTACGCACGAAAAGGCACTTGCC
AATGCGCTCCAGTTTCAGCGTCGCGAGGTCCGGCACCGACCTTCGCAGAGCACGAGCGCTGCAACACTCACTCAG
TCAACCCCGCTGCCAGAGCGTCCATCCACGGCCTCGTCCACCACCAGCTCGCTGGCCACGGCCTTTTCATTCGGC
CCTCTCAACTTTACCTCGCACAATGTCAAGTCTGCAAAGCTTGCCCTGACTCCTCATCACCTATTTTACCTTCTA
TCGCGCTTCGAGGAACTCGCCATCAATGTCGGGCCCATGAAGGTTCGTCTTGAGAATCTTCACGACAGCTCGTCT
ACATCAAACTATGTGTCCTTTCTCGGAAATACCGGTCGATCTCGGAGTCGAGGCTCCGATGTTGGCTCCATACAC
TCAGTGTCCAGCATGCGCAGCGTCATGTCTGGCATGTCGGCCCTGTGGACCAGCCTTGGCATTGGAGCCAGCATT
TCTGCTGCTCGTACCGAACGCCACAAGGCTGCTGTCCAAGCCGATCTCAAGTACCTGTATTCAGCCTTTACCAAG
GTGCCCTGCCTCCGATTGGCGCCTGATTGGCGCGCCCGACTTATTCGTGGCTACGAGGAATTCCCCTTTGACTCG
GCCGTTCCCCTTTACGTCTTCAAAAACTTGCAGGCCCTCGAAATCTGCAACATTGACTTCAGACAGTTCTTTGGC
TGGGACCGTTTGGCGGACCAGCTTCGCTCTCTCACACTCAAGAGCGCTGGAATAGAGGATCTAGCTGATGTATTA
ATCGACATTGTGCTCGATGACATGGACAAGAGACGCCGAAGAACCTCAAAGTCACAGACGTCCCCCACGGCGCCA
GTTGGTGCTAGCAATAGCCCCCGCCGAAGCATGGCCACGTCGCCCCCTGACGCCATTAGAGCATTGTCGGCTCCG
GGCTCGCCAGAGACTAGAAATGTCCTGGCCGAGTTGCGCACTGGCTCTGCCACGCCAAGTGAACGTGCCATTGAA
GACGACGCGTCTGATACTCCCAGGCCGCGCGCCAGCCTCGACGAGTCGGACGAGATGCTCCGGTCCCCAGGAAAA
GGGACCCGGCCACGGAGTAATTCTCCATCGCGGCCTCCCAGTTCGAGAAATAACTCGTCGCACATGCGCTCCTCT
CAGCGTATTAAGCGATCTGGCTCGGGGAGCTCACACTCGAGCCTGTCCGACTCGTGGCACTATCATTCTCGAGGC
AGCGCTGCCAATCTATTGGCTACGGGCACTTTGCCATCAACAAAGTGGCGATTTCTGCGGCATCTTAGTCTTGCC
GACAACTCAATGACGTCTATACCGTGTACGAGTCTGGCTCCTCTTGCCAACACGCTCTTCTCGCTCGATTTGTCC
TCGAATCTTTTTAGCCAGATTCCAGACAGCCTGGCTACTCTGACTGCTCTGCGCGCTCTCAACCTTGCCCATTGC
ATGATTGATTCACTCAATTCTCTCACTCGAAACCCCCTACCGGCAATTACGGCCTTGAATTTGCGAGCCAATAGA
CTCGAGTCTCTGGCGGGCATTGAAAAACTGTTTCCACTGGAAAGACTTGACTTGCGGGACAACCGTCTTACTGAT
GTGCTGGAACTCGCAAGACTGACTGGGATCCCCGAGATTCGAGAGATTTGGATCGAGGGCAACCCCTTTACCAGG
ACACACAAGGACTACCGTGTGACAATATTCAACATGTTTCGAGCCACCCCCGGATACACTACAGACATTGTGATT
GACGGCTACGGCCCCAGCTACTCAGAGAAGCGCATGCTCGTGGAGCGAGCTCCGATTCCCGACTCGGTGCCCGTG
GTGAAGCCCAAGGCACCAGAAGCGCCCCCAGTTGTCGAGGTTAGCAAACCGACAATTCTCTATGGCATACCCAAG
GAAGGTGGAGTCTTGCGCAAAGAAAGGCCTGTATCCAAGACGGCGACGAGCGAGGTTAGCTGCAATCCAGCGCGG
CGACACAAGTCGACTAAGAGACGCATCGTCGACCTTGCTACGGGTGAGACGGAGGCTTGCAACGATGTACGAATT
ATGGAGTCCAAGATTGATGAAATGGCACATCCGGGCAACTATCGCATTTCACGTCCGTCTGAAGCCATGCTGCCT
CCTGTGATTATGGCTGGCATGCACAAGAACAAGCCCACAGTCGAGGCCCGGGCCATGGAGGACGTGCCACAGAGC
CCTACCAACAAGCCACAGATTGTTGGCTGCGACTCACAGAACTGGGATGTCAGTGGCGAGGCATATCGCCGCAAA
ATCGAGGCCCTCCGTGACCGGGTTGGCAACGGATACCTGAGCGTCTTGAGCGAAGAAGCTTGGGACGGAAACGGC
TGCTACAATGCCAACAGTGTCACGGCGGTGCCTGCTTTGCGCGCTGGTCACTTGTCGCCCCATGTGCCGGCTGCT
CAAGCCGTTCACAGCGGTCGTACCTTGGGCTAG
Gene >OphauG2|6227
ATGGATTCCGAAAACGGAGAGCTTTTCGTAAAGGTAGCCATTGCCCGCCCCTTTTCTGCGCCTTGTGAGCCCCTG
GAACGCCAGCGCTGACCTTGTCCCTAGCAACTGGCTGTCTTTGTGCGTACGCACGAAAAGGCACTTGCCAATGCG
CTCCAGTTTCAGCGTCGCGAGGTCCGGCACCGACCTTCGCAGAGCACGAGCGCTGCAACACTCACTCAGTCAACC
CCGCTGCCAGAGCGTCCATCCACGGCCTCGTCCACCACCAGCTCGCTGGCCACGGCCTTTTCATTCGGCCCTCTC
AACTTTACCTCGCACAATGTCAAGTCTGCAAAGCTTGCCCTGACTCCTCATCACCTATTTTACCTTCTATCGCGC
TTCGAGGAACTCGCCATCAATGTCGGGCCCATGAAGGTTCGTCTTGAGAATCTTCACGACAGCTCGTCTACATCA
AACTATGTGTCCTTTCTCGGAAATACCGGTCGATCTCGGAGTCGAGGCTCCGATGTTGGCTCCATACACTCAGTG
TCCAGCATGCGCAGCGTCATGTCTGGCATGTCGGCCCTGTGGACCAGCCTTGGCATTGGAGCCAGCATTTCTGCT
GCTCGTACCGAACGCCACAAGGCTGCTGTCCAAGCCGATCTCAAGTACCTGTATTCAGCCTTTACCAAGGTGCCC
TGCCTCCGATTGGCGCCTGATTGGCGCGCCCGACTTATTCGTGGCTACGAGGAATTCCCCTTTGACTCGGCCGTT
CCCCTTTACGTCTTCAAAAACTTGCAGGCCCTCGAAATCTGCAACATTGACTTCAGACAGTTCTTTGGCTGGGAC
CGTTTGGCGGACCAGCTTCGCTCTCTCACACTCAAGAGCGCTGGAATAGAGGATCTAGCTGATGTATTAATCGAC
ATTGTGCTCGATGACATGGACAAGAGACGCCGAAGAACCTCAAAGTCACAGACGTCCCCCACGGCGCCAGTTGGT
GCTAGCAATAGCCCCCGCCGAAGCATGGCCACGTCGCCCCCTGACGCCATTAGAGCATTGTCGGCTCCGGGCTCG
CCAGAGACTAGAAATGTCCTGGCCGAGTTGCGCACTGGCTCTGCCACGCCAAGTGAACGTGCCATTGAAGACGAC
GCGTCTGATACTCCCAGGCCGCGCGCCAGCCTCGACGAGTCGGACGAGATGCTCCGGTCCCCAGGAAAAGGGACC
CGGCCACGGAGTAATTCTCCATCGCGGCCTCCCAGTTCGAGAAATAACTCGTCGCACATGCGCTCCTCTCAGCGT
ATTAAGCGATCTGGCTCGGGGAGCTCACACTCGAGCCTGTCCGACTCGTGGCACTATCATTCTCGAGGCAGCGCT
GCCAATCTATTGGCTACGGGCACTTTGCCATCAACAAAGTGGCGATTTCTGCGGCATCTTAGTCTTGCCGACAAC
TCAATGACGTCTATACCGTGTACGAGTCTGGCTCCTCTTGCCAACACGCTCTTCTCGCTCGATTTGTCCTCGAAT
CTTTTTAGCCAGATTCCAGACAGCCTGGCTACTCTGACTGCTCTGCGCGCTCTCAACCTTGCCCATTGCATGATT
GATTCACTCAATTCTCTCACTCGAAACCCCCTACCGGCAATTACGGCCTTGAATTTGCGAGCCAATAGACTCGAG
TCTCTGGCGGGCATTGAAAAACTGTTTCCACTGGAAAGACTTGACTTGCGGGACAACCGTCTTACTGATGTGCTG
GAACTCGCAAGACTGACTGGGATCCCCGAGATTCGAGAGATTTGGATCGAGGGCAACCCCTTTACCAGGACACAC
AAGGACTACCGTGTGACAATATTCAACATGTTTCGAGCCACCCCCGGATACACTACAGACATTGTGATTGACGGC
TACGGCCCCAGCTACTCAGAGAAGCGCATGCTCGTGGAGCGAGCTCCGATTCCCGACTCGGTGCCCGTGGTGAAG
CCCAAGGCACCAGAAGCGCCCCCAGTTGTCGAGGTTAGCAAACCGACAATTCTCTATGGCATACCCAAGGAAGGT
GGAGTCTTGCGCAAAGAAAGGCCTGTATCCAAGACGGCGACGAGCGAGGTTAGCTGCAATCCAGCGCGGCGACAC
AAGTCGACTAAGAGACGCATCGTCGACCTTGCTACGGGTGAGACGGAGGCTTGCAACGATGTACGAATTATGGAG
TCCAAGATTGATGAAATGGCACATCCGGGCAACTATCGCATTTCACGTCCGTCTGAAGCCATGCTGCCTCCTGTG
ATTATGGCTGGCATGCACAAGAACAAGCCCACAGTCGAGGCCCGGGCCATGGAGGACGTGCCACAGAGCCCTACC
AACAAGCCACAGATTGTTGGCTGCGACTCACAGAACTGGGATGTCAGTGGCGAGGCATATCGCCGCAAAATCGAG
GCCCTCCGTGACCGGGTTGGCAACGGATACCTGAGCGTCTTGAGCGAAGAAGCTTGGGACGGAAACGGCTGCTAC
AATGCCAACAGTGTCACGGCGGTGCCTGCTTTGCGCGCTGGTCACTTGTCGCCCCATGTGCCGGCTGCTCAAGCC
GTTCACAGCGGTCGTACCTTGGGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail