Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6222
Gene name
LocationContig_621:436..6272
Strand+
Gene length (bp)5836
Transcript length (bp)5574
Coding sequence length (bp)5574
Protein length (aa) 1858

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04118 Dopey_N Dopey, N-terminal 2.7E-116 36 365

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7B3|DOP1_EMENI Protein dopey OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dop1 PE=1 SV=1 34 1853 0.0E+00
sp|Q03921|DOP1_YEAST Protein dopey OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DOP1 PE=1 SV=1 35 926 2.0E-76
sp|Q9C0Z4|DOP1_SCHPO Protein dopey OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB21F2.02 PE=1 SV=1 34 460 2.0E-57
sp|Q5JWR5|DOP1_HUMAN Protein dopey-1 OS=Homo sapiens GN=DOPEY1 PE=2 SV=1 33 454 4.0E-50
sp|Q8BL99|DOP1_MOUSE Protein dopey-1 OS=Mus musculus GN=Dopey1 PE=1 SV=2 33 454 4.0E-50
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7B3|DOP1_EMENI Protein dopey OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dop1 PE=1 SV=1 34 1853 0.0E+00
sp|Q03921|DOP1_YEAST Protein dopey OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DOP1 PE=1 SV=1 35 926 2.0E-76
sp|Q9C0Z4|DOP1_SCHPO Protein dopey OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB21F2.02 PE=1 SV=1 34 460 2.0E-57
sp|Q5JWR5|DOP1_HUMAN Protein dopey-1 OS=Homo sapiens GN=DOPEY1 PE=2 SV=1 33 454 4.0E-50
sp|Q8BL99|DOP1_MOUSE Protein dopey-1 OS=Mus musculus GN=Dopey1 PE=1 SV=2 33 454 4.0E-50
sp|Q642P2|DOP2_XENLA Protein dopey-2 OS=Xenopus laevis GN=dopey2 PE=2 SV=1 26 453 9.0E-50
sp|Q3UHQ6|DOP2_MOUSE Protein dopey-2 OS=Mus musculus GN=Dopey2 PE=1 SV=3 26 464 3.0E-49
sp|Q9Y3R5|DOP2_HUMAN Protein dopey-2 OS=Homo sapiens GN=DOPEY2 PE=1 SV=5 26 457 4.0E-47
sp|Q292H2|DOP1_DROPS Protein dopey-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA13490 PE=3 SV=1 29 512 1.0E-44
sp|A1ZBE8|DOP1_DROME Protein dopey-1 homolog OS=Drosophila melanogaster GN=CG15099 PE=1 SV=1 29 497 3.0E-43
sp|Q9C0Z4|DOP1_SCHPO Protein dopey OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB21F2.02 PE=1 SV=1 1192 1835 2.0E-41
sp|Q03921|DOP1_YEAST Protein dopey OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DOP1 PE=1 SV=1 1088 1847 3.0E-40
sp|Q9XW10|PAD1_CAEEL Protein pad-1 OS=Caenorhabditis elegans GN=pad-1 PE=2 SV=2 34 458 1.0E-35
sp|Q5WNI9|PAD1_CAEBR Protein pad-1 OS=Caenorhabditis briggsae GN=pad-1 PE=3 SV=1 34 459 9.0E-35
sp|Q5JWR5|DOP1_HUMAN Protein dopey-1 OS=Homo sapiens GN=DOPEY1 PE=2 SV=1 898 1742 4.0E-11
sp|O97239|DOP1_PLAF7 Protein dopey homolog PFC0245c OS=Plasmodium falciparum (isolate 3D7) GN=PFC0245c PE=2 SV=1 39 321 1.0E-10
sp|A1ZBE8|DOP1_DROME Protein dopey-1 homolog OS=Drosophila melanogaster GN=CG15099 PE=1 SV=1 1347 1742 5.0E-09
sp|Q642P2|DOP2_XENLA Protein dopey-2 OS=Xenopus laevis GN=dopey2 PE=2 SV=1 1472 1739 3.0E-08
sp|Q9XW10|PAD1_CAEEL Protein pad-1 OS=Caenorhabditis elegans GN=pad-1 PE=2 SV=2 1488 1754 3.0E-08
sp|Q292H2|DOP1_DROPS Protein dopey-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA13490 PE=3 SV=1 1347 1742 7.0E-08
sp|Q3UHQ6|DOP2_MOUSE Protein dopey-2 OS=Mus musculus GN=Dopey2 PE=1 SV=3 1082 1766 2.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6222
MALELAASPESSGRGSPISRQWRNQLDAEEPPVKDRAYRRYAAGVDKALSLFESALEEWADYISFLNKLLKALQA
RPSSLTAIPSKTLVAKRLSQCLNPSLPSGVHQKALDVYNYIFTTIGKDGLSRDLPLYLPGLAPTLSFASLSVRSP
YLHLLETHFLAVDARSLRPALKSIVLALLPGLEDETSDDFDRTMSLVTSFKQALRPQGASDITDRHSSGDDFFWQ
CFFLACVTGHSRRAGALAYLVRCFPVLGPDPPHATSALSSLLSPDPTHDAASSRLAAMVTSPEPGLLVRCFASGL
ADDQLLIQRGFLDLLVSHLPLNSAVLQSRVKPKDLQLLLKAAVGVVTRRDMSLNRRLWAWLLGPEPATGDGDATV
SSPTSPTGRQTYLQTATNYFEEYGLQPLTQALLEMINGVSRGNVSERARPYRICLSLMDRWEIGGLVIPEVFLPV
VQSVRHFHETAASDSEFAEVLRSASVFFDGIESGLIYSELLGLLSEALGCSTLSAQDRADKISLVNFIVANFNVR
EEDMVTVHVPLTCLAALTMLQEYNKQGQKLQLTEKVLGLVVTLTELIPDRAFPPGDGRNGHEVASAPSNDAMMKK
IKVFYEHEQGNLDSPAIPYNAMDCGELLLQKAVEYMCQDVQDDLSLRVRILVLILLKTPPTYRFDVERLLSHLQS
KLDQHGSLPFPYFSSALQLATHLHSTHRIGQMQLSQLAGPLVRQAWLYLSASDPKYHVETVRSLWQLQTALGPSN
RDIEAALSDIVVSATWSGELTDASVEAGRTFGVLWSHTLQDTTSERRASSKAQTQDHRLGMRLAGMDHYQLMLTQ
PLFNLIDALFDDRTQLYMVMKFWLNTMIGIDRLFLVLVAKLSELSFLSSLNSASSKDSLDSLSPIMFEDDDDVDL
CLYYLRSLNQILGCTGPVARHVLASKHLMFDGQEMQIRSAGEKNEMTLQDYFMRVSMMCALGEARCPDNQGLGQR
VSGLQRYSLTMLHEFLSSSHAACWANFQMEDVLINRLSRCMEGGDAYVQVLLFDVICDGLKLQELAGVERPVSPR
SEKTATGVDRGRRSRASVSTSDGQQAGTAVPGQLLKCLEAGLSSANSRGVLDGWVGFMGDCLPFYGHGIFQVLIP
LVETLCGQIGRTLSGMQHMFEAKTRVVQCEASGPDSTLISLLNGLERVLALGHEQIVAEEARVELLKGPEQPHSL
FGSMVSGVFQSDGRQPRSATANDRLTVHLAFQDSMRMCYKIWCWGQGDEAKRQDAVSVASFHHTSMRMRNRARRL
LEQLFAAETLECLETAVEIWKSSGSARERGQMFKFLAALDACRPRQVMPALFNAIYSRTNPGALEAWRKSTMTIS
LEDVDLVTFLVDYARSLDDDAMDEIWQDCIVFLKDLLGNPFPHRQTLAKLLEFAGILGEKVDNTNFGEQRRMRRE
LGDMFLRLLAALFTTRPMVFEGERGSRDGAGRRSTAGAGKEGTDDIVSVLGWVVPQLGKIVVDNDRVLSAAAAIS
ANVIGPSMRSKLFPETMSRETVGLLEELSRVPNNQKTWKKDVGEAFNDGRFFGTKAQLAREAWLPLLQQWVVRDK
ERMAELVGRISTPTTAGIVFGVGATSARLEADRKTQLNLRRMATLVVASADDFFVADLALMLDKLVELLGATPTS
SPSSATRADVYLVMRALVLKTSAVHLAVLWPVVNAEMHAAMASVVAPDHSAASDTYANSAVLQACKLLDVLVCVA
PDDFQLHEWLFVTDTIDAIYRPATFEPVALVDELSDELGSSGCWPGADMPENATTTAPMTARRLLLGPGGINVDV
ALERRDELVAKVLRPFFAQLTIFAFESTYAMAPVDKTACIDVLVDDVFDEGTIVRAL*
Coding >OphauG2|6222
ATGGCGCTTGAGCTTGCTGCTTCGCCCGAGAGCTCGGGCCGTGGCTCGCCCATCTCGCGCCAATGGAGGAACCAG
CTCGATGCAGAAGAGCCGCCAGTCAAGGACCGAGCATATCGCAGATATGCCGCCGGCGTCGATAAGGCGCTGTCA
TTGTTTGAATCAGCTTTGGAGGAATGGGCCGACTACATCTCGTTTCTCAACAAGCTGCTCAAGGCTTTGCAGGCC
CGCCCTTCCTCCCTGACAGCAATCCCTTCAAAGACGCTTGTTGCTAAGCGCCTCTCTCAATGCCTCAACCCTTCC
TTACCATCTGGCGTTCACCAAAAAGCCCTTGACGTGTACAACTACATCTTTACCACCATTGGAAAGGATGGCCTG
TCTCGAGACTTGCCGCTCTACCTGCCCGGACTTGCTCCTACTCTCTCCTTCGCATCGCTTTCGGTCCGCTCTCCC
TATCTCCACCTGCTTGAGACGCATTTCCTCGCCGTTGATGCCCGCTCCCTTCGACCTGCTCTCAAATCCATTGTG
CTGGCGCTGCTTCCGGGCTTGGAGGATGAGACGAGCGACGACTTTGATCGGACAATGAGCCTAGTCACCAGCTTC
AAACAAGCTCTCAGGCCTCAGGGGGCCAGCGACATCACAGACCGTCATAGCTCGGGTGACGATTTCTTCTGGCAA
TGCTTCTTTCTCGCCTGCGTCACGGGTCATTCTCGGCGTGCTGGCGCATTGGCGTACCTGGTGCGATGTTTTCCC
GTTCTAGGGCCGGATCCGCCTCATGCCACTTCAGCTCTTTCTTCACTTCTTTCTCCAGACCCGACTCACGACGCT
GCAAGCTCCCGGCTAGCCGCCATGGTAACCTCACCTGAGCCAGGTCTTTTGGTCCGCTGCTTTGCCAGTGGCTTG
GCTGACGACCAGCTGCTCATTCAACGCGGCTTTCTTGATCTGCTCGTCTCCCATCTGCCTCTCAATTCAGCTGTT
CTGCAGTCCCGTGTCAAACCAAAAGATCTTCAACTTTTACTAAAGGCTGCCGTTGGAGTTGTGACAAGACGAGAC
ATGAGCCTCAATCGGCGACTTTGGGCATGGCTTCTTGGCCCTGAGCCTGCGACGGGCGACGGAGATGCCACGGTG
AGCTCTCCAACCTCCCCTACAGGGCGGCAGACGTACTTGCAGACTGCCACCAACTACTTTGAGGAGTACGGCTTG
CAGCCGTTGACACAAGCCCTCTTGGAAATGATCAATGGGGTCAGCCGTGGCAATGTCTCTGAACGAGCACGGCCA
TACAGGATTTGTCTGTCTCTTATGGATCGATGGGAAATTGGAGGCTTGGTCATCCCCGAGGTGTTTCTTCCAGTC
GTGCAGAGCGTGCGGCACTTCCACGAAACAGCCGCATCCGATAGCGAGTTTGCAGAAGTGCTTCGAAGCGCCAGC
GTCTTTTTTGACGGCATTGAGAGCGGACTCATCTACAGCGAGCTTCTCGGACTGCTCTCAGAGGCCTTGGGTTGC
TCAACCCTGAGCGCCCAAGATCGGGCCGACAAAATATCCCTCGTCAACTTCATCGTGGCCAACTTTAACGTGCGA
GAAGAGGACATGGTGACGGTGCATGTCCCTCTGACTTGTCTGGCTGCATTGACTATGCTCCAGGAATACAACAAG
CAAGGCCAGAAACTCCAGCTGACTGAAAAAGTGCTCGGCCTGGTGGTGACTTTGACGGAATTGATACCAGATCGT
GCATTTCCACCAGGAGATGGGCGAAATGGCCACGAGGTAGCAAGTGCTCCCTCGAATGACGCCATGATGAAGAAA
ATCAAGGTCTTCTATGAGCACGAACAAGGCAATCTGGATTCGCCTGCAATACCATACAATGCCATGGATTGTGGC
GAGCTGTTGCTTCAAAAGGCGGTTGAGTACATGTGTCAAGACGTTCAAGACGATTTGAGTCTCCGCGTCCGCATT
CTTGTCCTGATTCTGCTCAAGACTCCACCAACGTATAGATTTGATGTGGAGCGTCTCCTATCTCACCTCCAGAGT
AAACTGGATCAACATGGGAGCCTGCCATTTCCCTATTTCTCATCGGCTCTCCAGCTAGCCACGCACTTGCACTCT
ACCCATAGAATAGGCCAGATGCAGCTCTCGCAACTCGCAGGGCCTCTAGTACGCCAAGCCTGGCTGTACTTGTCA
GCATCAGATCCGAAATATCATGTCGAGACTGTTCGCAGTCTCTGGCAATTGCAGACTGCCCTGGGGCCGTCGAAC
CGCGATATCGAGGCAGCGCTTTCAGACATTGTCGTCAGTGCTACATGGAGTGGCGAGTTGACGGATGCATCTGTC
GAGGCAGGGCGCACCTTTGGCGTCCTGTGGTCGCACACGCTGCAGGACACGACTTCGGAGCGGCGTGCTTCATCC
AAAGCGCAGACTCAGGACCACCGACTCGGCATGAGGCTAGCGGGCATGGATCACTATCAGCTCATGTTGACTCAG
CCGCTCTTTAACCTGATTGACGCCCTATTCGACGACAGGACGCAGCTCTACATGGTGATGAAATTTTGGCTCAAT
ACCATGATTGGCATCGACAGGCTATTTCTTGTCTTGGTGGCAAAGCTTTCCGAACTATCATTTCTGTCGTCGCTC
AACTCGGCCAGTAGCAAAGACAGCCTGGACTCTCTCAGTCCCATAATGTTTGAGGACGACGACGATGTTGATCTC
TGTCTTTACTATCTGCGCTCTCTCAACCAGATCCTCGGGTGCACGGGCCCAGTAGCCCGCCATGTCCTTGCCTCG
AAGCATTTGATGTTTGACGGACAAGAGATGCAGATTCGATCCGCAGGAGAAAAGAACGAAATGACGCTGCAAGAC
TATTTCATGCGCGTGTCCATGATGTGCGCATTGGGTGAGGCGCGATGCCCCGACAACCAAGGCCTTGGCCAACGA
GTGTCAGGGCTGCAGCGATACTCGCTGACAATGCTGCATGAATTTCTGAGTAGCAGTCATGCTGCTTGTTGGGCC
AATTTTCAAATGGAAGACGTCTTGATTAACCGACTGTCGAGGTGCATGGAGGGGGGAGATGCTTATGTTCAGGTG
CTGCTATTCGACGTTATTTGCGATGGCCTCAAGCTGCAGGAATTAGCGGGGGTAGAAAGACCCGTGTCGCCCAGG
TCAGAAAAGACGGCGACTGGAGTAGACAGAGGGCGTCGGAGCAGAGCGTCTGTGTCGACTAGCGACGGGCAGCAG
GCTGGTACGGCAGTTCCGGGGCAGCTACTCAAATGCCTTGAAGCCGGACTGAGCTCGGCCAACAGCCGGGGTGTT
CTGGACGGGTGGGTTGGATTCATGGGCGACTGCTTGCCATTTTACGGGCACGGCATCTTCCAGGTCTTGATCCCG
TTGGTGGAAACGTTGTGCGGGCAGATTGGCAGGACGCTGTCGGGGATGCAGCACATGTTTGAGGCAAAAACACGG
GTGGTGCAATGCGAGGCAAGCGGGCCTGACTCGACTCTAATCTCGCTGCTCAATGGGCTGGAGAGGGTGCTGGCT
CTTGGGCATGAGCAGATTGTGGCCGAGGAGGCTCGGGTGGAGTTGCTCAAGGGGCCGGAGCAGCCGCACTCGCTG
TTTGGCAGCATGGTGTCGGGCGTCTTCCAGTCGGACGGGCGGCAGCCGCGAAGTGCGACGGCCAATGATCGTCTG
ACGGTGCACCTGGCCTTTCAAGACTCGATGCGCATGTGCTACAAGATCTGGTGCTGGGGCCAGGGAGACGAGGCC
AAGAGACAAGACGCGGTGTCTGTGGCGTCGTTTCACCACACGTCCATGAGGATGAGGAACCGAGCGCGGCGGTTG
CTGGAGCAGCTGTTTGCGGCGGAGACACTTGAATGCTTGGAGACGGCGGTGGAGATATGGAAGAGCAGTGGGAGC
GCGAGGGAGCGGGGACAAATGTTCAAGTTTCTGGCGGCTCTGGACGCATGCCGGCCGAGACAGGTGATGCCGGCT
CTCTTCAACGCGATTTACAGCCGGACCAACCCGGGGGCTCTGGAGGCGTGGCGCAAGTCGACAATGACCATCAGC
CTCGAGGACGTTGACCTGGTGACGTTTCTGGTGGACTATGCTCGGTCGCTGGACGACGATGCCATGGACGAGATC
TGGCAGGACTGCATCGTGTTCCTCAAGGACCTGCTGGGCAACCCGTTTCCGCACCGGCAGACACTGGCGAAGCTG
CTCGAGTTTGCGGGGATCCTGGGGGAAAAGGTGGACAACACCAACTTTGGAGAGCAGCGACGGATGCGGCGGGAG
CTGGGAGACATGTTCCTGCGGCTGCTGGCGGCTCTCTTCACCACTCGGCCCATGGTTTTCGAGGGCGAGCGAGGC
AGCAGGGACGGGGCGGGGCGGCGAAGCACGGCGGGAGCGGGCAAGGAGGGGACCGACGACATTGTGTCGGTGCTG
GGGTGGGTGGTGCCGCAGCTGGGCAAGATTGTGGTGGACAATGACCGCGTCTTGTCGGCGGCGGCGGCGATTTCG
GCAAACGTGATTGGGCCGAGCATGCGGTCCAAGCTGTTTCCCGAGACGATGAGCCGCGAGACGGTTGGGCTGCTG
GAAGAGCTGTCGCGGGTGCCAAACAACCAAAAGACGTGGAAGAAGGACGTGGGCGAGGCCTTCAACGACGGGCGC
TTCTTTGGCACCAAGGCGCAGCTGGCGCGCGAGGCGTGGCTGCCGCTGCTGCAGCAGTGGGTGGTGCGCGACAAG
GAGCGCATGGCGGAGCTGGTGGGCCGCATCAGCACGCCGACGACGGCGGGCATTGTGTTTGGCGTGGGCGCCACG
TCGGCGCGGCTCGAGGCGGACCGCAAGACGCAGCTCAACCTGCGGCGCATGGCGACGCTGGTGGTGGCGTCGGCC
GACGACTTTTTTGTCGCGGACCTGGCCCTGATGCTGGACAAGCTGGTGGAGCTGCTGGGCGCCACGCCCACGTCG
TCGCCGTCGTCGGCCACGCGCGCCGACGTGTACCTGGTGATGCGCGCCCTGGTGCTCAAGACGAGCGCCGTGCAC
CTGGCCGTGCTGTGGCCCGTGGTGAATGCCGAGATGCACGCCGCCATGGCCTCGGTGGTGGCGCCCGACCACAGC
GCCGCCTCGGACACGTATGCCAACTCGGCCGTCTTGCAGGCCTGCAAGCTGCTCGACGTCTTGGTGTGTGTGGCG
CCCGACGACTTCCAGCTGCACGAGTGGCTGTTTGTCACGGACACCATTGACGCCATCTACCGGCCCGCCACCTTT
GAGCCCGTGGCCCTGGTGGACGAGCTGTCGGACGAGCTGGGCAGCAGTGGCTGCTGGCCGGGCGCCGACATGCCC
GAGAACGCCACCACCACCGCCCCCATGACGGCGCGCCGCCTGCTGCTGGGGCCGGGCGGCATCAATGTCGACGTG
GCCCTGGAGCGCCGCGATGAGCTGGTGGCCAAGGTGCTGCGGCCCTTTTTTGCCCAGCTGACCATTTTTGCCTTT
GAGTCCACCTATGCCATGGCGCCCGTGGACAAGACGGCCTGCATCGACGTGCTGGTGGACGATGTGTTTGACGAG
GGCACCATTGTGCGGGCCTTGTAG
Transcript >OphauG2|6222
ATGGCGCTTGAGCTTGCTGCTTCGCCCGAGAGCTCGGGCCGTGGCTCGCCCATCTCGCGCCAATGGAGGAACCAG
CTCGATGCAGAAGAGCCGCCAGTCAAGGACCGAGCATATCGCAGATATGCCGCCGGCGTCGATAAGGCGCTGTCA
TTGTTTGAATCAGCTTTGGAGGAATGGGCCGACTACATCTCGTTTCTCAACAAGCTGCTCAAGGCTTTGCAGGCC
CGCCCTTCCTCCCTGACAGCAATCCCTTCAAAGACGCTTGTTGCTAAGCGCCTCTCTCAATGCCTCAACCCTTCC
TTACCATCTGGCGTTCACCAAAAAGCCCTTGACGTGTACAACTACATCTTTACCACCATTGGAAAGGATGGCCTG
TCTCGAGACTTGCCGCTCTACCTGCCCGGACTTGCTCCTACTCTCTCCTTCGCATCGCTTTCGGTCCGCTCTCCC
TATCTCCACCTGCTTGAGACGCATTTCCTCGCCGTTGATGCCCGCTCCCTTCGACCTGCTCTCAAATCCATTGTG
CTGGCGCTGCTTCCGGGCTTGGAGGATGAGACGAGCGACGACTTTGATCGGACAATGAGCCTAGTCACCAGCTTC
AAACAAGCTCTCAGGCCTCAGGGGGCCAGCGACATCACAGACCGTCATAGCTCGGGTGACGATTTCTTCTGGCAA
TGCTTCTTTCTCGCCTGCGTCACGGGTCATTCTCGGCGTGCTGGCGCATTGGCGTACCTGGTGCGATGTTTTCCC
GTTCTAGGGCCGGATCCGCCTCATGCCACTTCAGCTCTTTCTTCACTTCTTTCTCCAGACCCGACTCACGACGCT
GCAAGCTCCCGGCTAGCCGCCATGGTAACCTCACCTGAGCCAGGTCTTTTGGTCCGCTGCTTTGCCAGTGGCTTG
GCTGACGACCAGCTGCTCATTCAACGCGGCTTTCTTGATCTGCTCGTCTCCCATCTGCCTCTCAATTCAGCTGTT
CTGCAGTCCCGTGTCAAACCAAAAGATCTTCAACTTTTACTAAAGGCTGCCGTTGGAGTTGTGACAAGACGAGAC
ATGAGCCTCAATCGGCGACTTTGGGCATGGCTTCTTGGCCCTGAGCCTGCGACGGGCGACGGAGATGCCACGGTG
AGCTCTCCAACCTCCCCTACAGGGCGGCAGACGTACTTGCAGACTGCCACCAACTACTTTGAGGAGTACGGCTTG
CAGCCGTTGACACAAGCCCTCTTGGAAATGATCAATGGGGTCAGCCGTGGCAATGTCTCTGAACGAGCACGGCCA
TACAGGATTTGTCTGTCTCTTATGGATCGATGGGAAATTGGAGGCTTGGTCATCCCCGAGGTGTTTCTTCCAGTC
GTGCAGAGCGTGCGGCACTTCCACGAAACAGCCGCATCCGATAGCGAGTTTGCAGAAGTGCTTCGAAGCGCCAGC
GTCTTTTTTGACGGCATTGAGAGCGGACTCATCTACAGCGAGCTTCTCGGACTGCTCTCAGAGGCCTTGGGTTGC
TCAACCCTGAGCGCCCAAGATCGGGCCGACAAAATATCCCTCGTCAACTTCATCGTGGCCAACTTTAACGTGCGA
GAAGAGGACATGGTGACGGTGCATGTCCCTCTGACTTGTCTGGCTGCATTGACTATGCTCCAGGAATACAACAAG
CAAGGCCAGAAACTCCAGCTGACTGAAAAAGTGCTCGGCCTGGTGGTGACTTTGACGGAATTGATACCAGATCGT
GCATTTCCACCAGGAGATGGGCGAAATGGCCACGAGGTAGCAAGTGCTCCCTCGAATGACGCCATGATGAAGAAA
ATCAAGGTCTTCTATGAGCACGAACAAGGCAATCTGGATTCGCCTGCAATACCATACAATGCCATGGATTGTGGC
GAGCTGTTGCTTCAAAAGGCGGTTGAGTACATGTGTCAAGACGTTCAAGACGATTTGAGTCTCCGCGTCCGCATT
CTTGTCCTGATTCTGCTCAAGACTCCACCAACGTATAGATTTGATGTGGAGCGTCTCCTATCTCACCTCCAGAGT
AAACTGGATCAACATGGGAGCCTGCCATTTCCCTATTTCTCATCGGCTCTCCAGCTAGCCACGCACTTGCACTCT
ACCCATAGAATAGGCCAGATGCAGCTCTCGCAACTCGCAGGGCCTCTAGTACGCCAAGCCTGGCTGTACTTGTCA
GCATCAGATCCGAAATATCATGTCGAGACTGTTCGCAGTCTCTGGCAATTGCAGACTGCCCTGGGGCCGTCGAAC
CGCGATATCGAGGCAGCGCTTTCAGACATTGTCGTCAGTGCTACATGGAGTGGCGAGTTGACGGATGCATCTGTC
GAGGCAGGGCGCACCTTTGGCGTCCTGTGGTCGCACACGCTGCAGGACACGACTTCGGAGCGGCGTGCTTCATCC
AAAGCGCAGACTCAGGACCACCGACTCGGCATGAGGCTAGCGGGCATGGATCACTATCAGCTCATGTTGACTCAG
CCGCTCTTTAACCTGATTGACGCCCTATTCGACGACAGGACGCAGCTCTACATGGTGATGAAATTTTGGCTCAAT
ACCATGATTGGCATCGACAGGCTATTTCTTGTCTTGGTGGCAAAGCTTTCCGAACTATCATTTCTGTCGTCGCTC
AACTCGGCCAGTAGCAAAGACAGCCTGGACTCTCTCAGTCCCATAATGTTTGAGGACGACGACGATGTTGATCTC
TGTCTTTACTATCTGCGCTCTCTCAACCAGATCCTCGGGTGCACGGGCCCAGTAGCCCGCCATGTCCTTGCCTCG
AAGCATTTGATGTTTGACGGACAAGAGATGCAGATTCGATCCGCAGGAGAAAAGAACGAAATGACGCTGCAAGAC
TATTTCATGCGCGTGTCCATGATGTGCGCATTGGGTGAGGCGCGATGCCCCGACAACCAAGGCCTTGGCCAACGA
GTGTCAGGGCTGCAGCGATACTCGCTGACAATGCTGCATGAATTTCTGAGTAGCAGTCATGCTGCTTGTTGGGCC
AATTTTCAAATGGAAGACGTCTTGATTAACCGACTGTCGAGGTGCATGGAGGGGGGAGATGCTTATGTTCAGGTG
CTGCTATTCGACGTTATTTGCGATGGCCTCAAGCTGCAGGAATTAGCGGGGGTAGAAAGACCCGTGTCGCCCAGG
TCAGAAAAGACGGCGACTGGAGTAGACAGAGGGCGTCGGAGCAGAGCGTCTGTGTCGACTAGCGACGGGCAGCAG
GCTGGTACGGCAGTTCCGGGGCAGCTACTCAAATGCCTTGAAGCCGGACTGAGCTCGGCCAACAGCCGGGGTGTT
CTGGACGGGTGGGTTGGATTCATGGGCGACTGCTTGCCATTTTACGGGCACGGCATCTTCCAGGTCTTGATCCCG
TTGGTGGAAACGTTGTGCGGGCAGATTGGCAGGACGCTGTCGGGGATGCAGCACATGTTTGAGGCAAAAACACGG
GTGGTGCAATGCGAGGCAAGCGGGCCTGACTCGACTCTAATCTCGCTGCTCAATGGGCTGGAGAGGGTGCTGGCT
CTTGGGCATGAGCAGATTGTGGCCGAGGAGGCTCGGGTGGAGTTGCTCAAGGGGCCGGAGCAGCCGCACTCGCTG
TTTGGCAGCATGGTGTCGGGCGTCTTCCAGTCGGACGGGCGGCAGCCGCGAAGTGCGACGGCCAATGATCGTCTG
ACGGTGCACCTGGCCTTTCAAGACTCGATGCGCATGTGCTACAAGATCTGGTGCTGGGGCCAGGGAGACGAGGCC
AAGAGACAAGACGCGGTGTCTGTGGCGTCGTTTCACCACACGTCCATGAGGATGAGGAACCGAGCGCGGCGGTTG
CTGGAGCAGCTGTTTGCGGCGGAGACACTTGAATGCTTGGAGACGGCGGTGGAGATATGGAAGAGCAGTGGGAGC
GCGAGGGAGCGGGGACAAATGTTCAAGTTTCTGGCGGCTCTGGACGCATGCCGGCCGAGACAGGTGATGCCGGCT
CTCTTCAACGCGATTTACAGCCGGACCAACCCGGGGGCTCTGGAGGCGTGGCGCAAGTCGACAATGACCATCAGC
CTCGAGGACGTTGACCTGGTGACGTTTCTGGTGGACTATGCTCGGTCGCTGGACGACGATGCCATGGACGAGATC
TGGCAGGACTGCATCGTGTTCCTCAAGGACCTGCTGGGCAACCCGTTTCCGCACCGGCAGACACTGGCGAAGCTG
CTCGAGTTTGCGGGGATCCTGGGGGAAAAGGTGGACAACACCAACTTTGGAGAGCAGCGACGGATGCGGCGGGAG
CTGGGAGACATGTTCCTGCGGCTGCTGGCGGCTCTCTTCACCACTCGGCCCATGGTTTTCGAGGGCGAGCGAGGC
AGCAGGGACGGGGCGGGGCGGCGAAGCACGGCGGGAGCGGGCAAGGAGGGGACCGACGACATTGTGTCGGTGCTG
GGGTGGGTGGTGCCGCAGCTGGGCAAGATTGTGGTGGACAATGACCGCGTCTTGTCGGCGGCGGCGGCGATTTCG
GCAAACGTGATTGGGCCGAGCATGCGGTCCAAGCTGTTTCCCGAGACGATGAGCCGCGAGACGGTTGGGCTGCTG
GAAGAGCTGTCGCGGGTGCCAAACAACCAAAAGACGTGGAAGAAGGACGTGGGCGAGGCCTTCAACGACGGGCGC
TTCTTTGGCACCAAGGCGCAGCTGGCGCGCGAGGCGTGGCTGCCGCTGCTGCAGCAGTGGGTGGTGCGCGACAAG
GAGCGCATGGCGGAGCTGGTGGGCCGCATCAGCACGCCGACGACGGCGGGCATTGTGTTTGGCGTGGGCGCCACG
TCGGCGCGGCTCGAGGCGGACCGCAAGACGCAGCTCAACCTGCGGCGCATGGCGACGCTGGTGGTGGCGTCGGCC
GACGACTTTTTTGTCGCGGACCTGGCCCTGATGCTGGACAAGCTGGTGGAGCTGCTGGGCGCCACGCCCACGTCG
TCGCCGTCGTCGGCCACGCGCGCCGACGTGTACCTGGTGATGCGCGCCCTGGTGCTCAAGACGAGCGCCGTGCAC
CTGGCCGTGCTGTGGCCCGTGGTGAATGCCGAGATGCACGCCGCCATGGCCTCGGTGGTGGCGCCCGACCACAGC
GCCGCCTCGGACACGTATGCCAACTCGGCCGTCTTGCAGGCCTGCAAGCTGCTCGACGTCTTGGTGTGTGTGGCG
CCCGACGACTTCCAGCTGCACGAGTGGCTGTTTGTCACGGACACCATTGACGCCATCTACCGGCCCGCCACCTTT
GAGCCCGTGGCCCTGGTGGACGAGCTGTCGGACGAGCTGGGCAGCAGTGGCTGCTGGCCGGGCGCCGACATGCCC
GAGAACGCCACCACCACCGCCCCCATGACGGCGCGCCGCCTGCTGCTGGGGCCGGGCGGCATCAATGTCGACGTG
GCCCTGGAGCGCCGCGATGAGCTGGTGGCCAAGGTGCTGCGGCCCTTTTTTGCCCAGCTGACCATTTTTGCCTTT
GAGTCCACCTATGCCATGGCGCCCGTGGACAAGACGGCCTGCATCGACGTGCTGGTGGACGATGTGTTTGACGAG
GGCACCATTGTGCGGGCCTTGTAG
Gene >OphauG2|6222
ATGGCGCTTGAGCTTGCTGCTTCGCCCGAGAGCTCGGGCCGTGGCTCGCCCATCTCGCGCCAATGGAGGAACCAG
CTCGATGCAGGTTGGTCTGTCGCGTCTTGCACCTTGCGCAAAAGCATTTCCGCTCACCCCTTGGCCAGAAGAGCC
GCCAGTCAAGGACCGAGCATATCGCAGATATGCCGCCGGCGTCGATAAGGCGCTGTCATTGTTTGAATCAGCTTT
GGAGGAATGGGCCGACTACATCTCGTTTCTCAACAAGCTGCTCAAGGTTTGTCTTTGTCTGCCTCCTAACTCTTC
CCCTGACTCTTCCTGGCCCTTTCTGACCCTCTCTGACCCTTTTCTTCTCGGTAGGCTTTGCAGGCCCGCCCTTCC
TCCCTGACAGCAATCCCTTCAAAGACGCTTGTTGCTAAGCGCCTCTCTCAATGCCTCAACCCTTCCTTACCATCT
GGCGTTCACCAAAAAGCCCTTGACGTGTACAACTACATCTTTACCACCATTGGAAAGGATGGCCTGTCTCGAGAC
TTGCCGCTCTACCTGCCCGGACTTGCTCCTACTCTCTCCTTCGCATCGCTTTCGGTCCGCTCTCCCTATCTCCAC
CTGCTTGAGACGCATTTCCTCGCCGTTGATGCCCGCTCCCTTCGACCTGCTCTCAAATCCATTGTGCTGGCGCTG
CTTCCGGGCTTGGAGGATGAGACGAGCGACGACTTTGATCGGACAATGAGCCTAGTCACCAGCTTCAAACAAGCT
CTCAGGCCTCAGGGGGCCAGCGACATCACAGACCGTCATAGCTCGGGTGACGATTTCTTCTGGCAATGCTTCTTT
CTCGCCTGCGTCACGGGTCATTCTCGGCGTGCTGGCGCATTGGCGTACCTGGTGCGATGTTTTCCCGTTCTAGGG
CCGGATCCGCCTCATGCCACTTCAGCTCTTTCTTCACTTCTTTCTCCAGACCCGACTCACGACGCTGCAAGCTCC
CGGCTAGCCGCCATGGTAACCTCACCTGAGCCAGGTCTTTTGGTCCGCTGCTTTGCCAGTGGCTTGGCTGACGAC
CAGCTGCTCATTCAACGCGGCTTTCTTGATCTGCTCGTCTCCCATCTGCCTCTCAATTCAGCTGTTCTGCAGTCC
CGTGTCAAACCAAAAGATCTTCAACTTTTACTAAAGGCTGCCGTTGGAGTTGTGACAAGACGAGACATGAGCCTC
AATCGGCGACTTTGGGCATGGCTTCTTGGCCCTGAGCCTGCGACGGGCGACGGAGATGCCACGGTGAGCTCTCCA
ACCTCCCCTACAGGGCGGCAGACGTACTTGCAGACTGCCACCAACTACTTTGAGGAGTACGGCTTGCAGCCGTTG
ACACAAGCCCTCTTGGAAATGATCAATGGGGTCAGCCGTGGCAATGTCTCTGAACGAGCACGGCCATACAGGATT
TGTCTGTCTCTTATGGATCGATGGGAAATTGGAGGCTTGGTCATCCCCGAGGTGTTTCTTCCAGTCGTGCAGAGC
GTGCGGCACTTCCACGAAACAGCCGCATCCGATAGCGAGTTTGCAGAAGTGCTTCGAAGCGCCAGCGTCTTTTTT
GACGGCATTGAGAGCGGACTCATCTACAGCGAGCTTCTCGGACTGCTCTCAGAGGCCTTGGGTTGCTCAACCCTG
AGCGCCCAAGATCGGGCCGACAAAATATCCCTCGTCAACTTCATCGTGGCCAACTTTAACGTGCGAGAAGAGGAC
ATGGTGACGGTGCATGTCCCTCTGACTTGTCTGGCTGCATTGACTATGCTCCAGGAATACAACAAGCAAGGCCAG
AAACTCCAGCTGACTGAAAAAGTGCTCGGCCTGGTGGTGACTTTGACGGAATTGATACCAGATCGTGCATTTCCA
CCAGGAGATGGGCGAAATGGCCACGAGGTAGCAAGTGCTCCCTCGAATGACGCCATGATGAAGAAAATCAAGGTC
TTCTATGAGCACGAACAAGGCAATCTGGATTCGCCTGCAATACCATACAATGCCATGGATTGTGGCGAGCTGTTG
CTTCAAAAGGCGGTTGAGTACATGTGTCAAGACGTTCAAGACGATTTGAGTCTCCGCGTCCGCATTCTTGTCCTG
ATTCTGCTCAAGACTCCACCAACGTATAGATTTGATGTGGAGCGTCTCCTATCTCACCTCCAGAGTAAACTGGAT
CAACATGGGAGCCTGCCATTTCCCTATTTCTCATCGGCTCTCCAGCTAGCCACGCACTTGCACTCTACCCATAGA
ATAGGCCAGATGCAGCTCTCGCAACTCGCAGGGCCTCTAGTACGCCAAGCCTGGCTGTACTTGTCAGCATCAGAT
CCGAAATATCATGTCGAGACTGTTCGCAGTCTCTGGCAATTGCAGACTGCCCTGGGGCCGTCGAACCGCGATATC
GAGGCAGCGCTTTCAGACATTGTCGTCAGTGCTACATGGAGTGGCGAGTTGACGGATGCATCTGTCGAGGCAGGG
CGCACCTTTGGCGTCCTGTGGTCGCACACGCTGCAGGACACGACTTCGGAGCGGCGTGCTTCATCCAAAGCGCAG
ACTCAGGACCACCGACTCGGCATGAGGCTAGCGGGCATGGATCACTATCAGCTCATGTTGACTCAGCCGCTCTTT
AACCTGATTGACGCCCTATTCGACGACAGGACGCAGCTCTACATGGTGATGAAATTTTGGCTCAATACCATGATT
GGCATCGACAGGTGAGATGAATGGCTCTCAAAGTCGAGGGTGGATGGTTTGCTGACGCGTCCCTTGGCAGGCTAT
TTCTTGTCTTGGTGGCAAAGCTTTCCGAACTATCATTTCTGTCGTCGCTCAACTCGGCCAGTAGCAAAGACAGCC
TGGACTCTCTCAGTCCCATAATGTTTGAGGACGACGACGATGTTGATCTCTGTCTTTACTATCTGCGCTCTCTCA
ACCAGATCCTCGGGTGCACGGGCCCAGTAGCCCGCCATGTCCTTGCCTCGAAGCATTTGATGTTTGACGGACAAG
AGATGCAGATTCGATGTATGCATGGCCCCCTTTAGCCCAGCTCCAAAAGACAATGGCGTATGCTTACGTGGTGCC
AGCCGCAGGAGAAAAGAACGAAATGACGCTGCAAGACTATTTCATGCGCGTGTCCATGATGTGCGCATTGGGTGA
GGCGCGATGCCCCGACAACCAAGGCCTTGGCCAACGAGTGTCAGGGCTGCAGCGATACTCGCTGACAATGCTGCA
TGAATTTCTGAGTAGCAGTCATGCTGCTTGTTGGGCCAATTTTCAAATGGAAGACGTCTTGATTAACCGACTGTC
GAGGTGCATGGAGGGGGGAGATGCTTATGTTCAGGTGCTGCTATTCGACGTTATTTGCGATGGCCTCAAGCTGCA
GGAATTAGCGGGGGTAGAAAGACCCGTGTCGCCCAGGTCAGAAAAGACGGCGACTGGAGTAGACAGAGGGCGTCG
GAGCAGAGCGTCTGTGTCGACTAGCGACGGGCAGCAGGCTGGTACGGCAGTTCCGGGGCAGCTACTCAAATGCCT
TGAAGCCGGACTGAGCTCGGCCAACAGCCGGGGTGTTCTGGACGGGTGGGTTGGATTCATGGGCGACTGCTTGCC
ATTTTACGGGCACGGCATCTTCCAGGTCTTGATCCCGTTGGTGGAAACGTTGTGCGGGCAGATTGGCAGGACGCT
GTCGGGGATGCAGCACATGTTTGAGGCAAAAACACGGGTGGTGCAATGCGAGGCAAGCGGGCCTGACTCGACTCT
AATCTCGCTGCTCAATGGGCTGGAGAGGGTGCTGGCTCTTGGGCATGAGCAGATTGTGGCCGAGGAGGCTCGGGT
GGAGTTGCTCAAGGGGCCGGAGCAGCCGCACTCGCTGTTTGGCAGCATGGTGTCGGGCGTCTTCCAGTCGGACGG
GCGGCAGCCGCGAAGTGCGACGGCCAATGATCGTCTGACGGTGCACCTGGCCTTTCAAGACTCGATGCGCATGTG
CTACAAGATCTGGTGCTGGGGCCAGGGAGACGAGGCCAAGAGACAAGACGCGGTGTCTGTGGCGTCGTTTCACCA
CACGTCCATGAGGATGAGGAACCGAGCGCGGCGGTTGCTGGAGCAGCTGTTTGCGGCGGAGACACTTGAATGCTT
GGAGACGGCGGTGGAGATATGGAAGAGCAGTGGGAGCGCGAGGGAGCGGGGACAAATGTTCAAGTTTCTGGCGGC
TCTGGACGCATGCCGGCCGAGACAGGTGATGCCGGCTCTCTTCAACGCGATTTACAGCCGGACCAACCCGGGGGC
TCTGGAGGCGTGGCGCAAGTCGACAATGACCATCAGCCTCGAGGACGTTGACCTGGTGACGTTTCTGGTGGACTA
TGCTCGGTCGCTGGACGACGATGCCATGGACGAGATCTGGCAGGACTGCATCGTGTTCCTCAAGGACCTGCTGGG
CAACCCGTTTCCGCACCGGCAGACACTGGCGAAGCTGCTCGAGTTTGCGGGGATCCTGGGGGAAAAGGTGGACAA
CACCAACTTTGGAGAGCAGCGACGGATGCGGCGGGAGCTGGGAGACATGTTCCTGCGGCTGCTGGCGGCTCTCTT
CACCACTCGGCCCATGGTTTTCGAGGGCGAGCGAGGCAGCAGGGACGGGGCGGGGCGGCGAAGCACGGCGGGAGC
GGGCAAGGAGGGGACCGACGACATTGTGTCGGTGCTGGGGTGGGTGGTGCCGCAGCTGGGCAAGATTGTGGTGGA
CAATGACCGCGTCTTGTCGGCGGCGGCGGCGATTTCGGCAAACGTGATTGGGCCGAGCATGCGGTCCAAGCTGTT
TCCCGAGACGATGAGCCGCGAGACGGTTGGGCTGCTGGAAGAGCTGTCGCGGGTGCCAAACAACCAAAAGACGTG
GAAGAAGGACGTGGGCGAGGCCTTCAACGACGGGCGCTTCTTTGGCACCAAGGCGCAGCTGGCGCGCGAGGCGTG
GCTGCCGCTGCTGCAGCAGTGGGTGGTGCGCGACAAGGAGCGCATGGCGGAGCTGGTGGGCCGCATCAGCACGCC
GACGACGGCGGGCATTGTGTTTGGCGTGGGCGCCACGTCGGCGCGGCTCGAGGCGGACCGCAAGACGCAGCTCAA
CCTGCGGCGCATGGCGACGCTGGTGGTGGCGTCGGCCGACGACTTTTTTGTCGCGGACCTGGCCCTGATGCTGGA
CAAGCTGGTGGAGCTGCTGGGCGCCACGCCCACGTCGTCGCCGTCGTCGGCCACGCGCGCCGACGTGTACCTGGT
GATGCGCGCCCTGGTGCTCAAGACGAGCGCCGTGCACCTGGCCGTGCTGTGGCCCGTGGTGAATGCCGAGATGCA
CGCCGCCATGGCCTCGGTGGTGGCGCCCGACCACAGCGCCGCCTCGGACACGTATGCCAACTCGGCCGTCTTGCA
GGCCTGCAAGCTGCTCGACGTCTTGGTGTGTGTGGCGCCCGACGACTTCCAGCTGCACGAGTGGCTGTTTGTCAC
GGACACCATTGACGCCATCTACCGGCCCGCCACCTTTGAGCCCGTGGCCCTGGTGGACGAGCTGTCGGACGAGCT
GGGCAGCAGTGGCTGCTGGCCGGGCGCCGACATGCCCGAGAACGCCACCACCACCGCCCCCATGACGGCGCGCCG
CCTGCTGCTGGGGCCGGGCGGCATCAATGTCGACGTGGCCCTGGAGCGCCGCGATGAGCTGGTGGCCAAGGTGCT
GCGGCCCTTTTTTGCCCAGCTGACCATTTTTGCCTTTGAGTCCACCTATGCCATGGCGCCCGTGGACAAGACGGC
CTGCATCGACGTGCTGGTGGACGATGTGTTTGACGAGGGCACCATTGTGCGGGCCTTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail