Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6215
Gene name
LocationContig_62:28370..30006
Strand-
Gene length (bp)1636
Transcript length (bp)1500
Coding sequence length (bp)1500
Protein length (aa) 500

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10602 RPN7 26S proteasome subunit RPN7 1.3E-55 107 280
PF01399 PCI PCI domain 1.1E-14 360 455

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10335|RPN7_SCHPO Probable 26S proteasome regulatory subunit rpn7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn7 PE=2 SV=1 13 496 1.0E-96
sp|Q06103|RPN7_YEAST 26S proteasome regulatory subunit RPN7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN7 PE=1 SV=3 4 498 1.0E-87
sp|Q93Y35|PSMD6_ARATH 26S proteasome non-ATPase regulatory subunit 6 homolog OS=Arabidopsis thaliana GN=RPN7 PE=1 SV=1 104 493 1.0E-79
sp|Q99JI4|PSMD6_MOUSE 26S proteasome non-ATPase regulatory subunit 6 OS=Mus musculus GN=Psmd6 PE=1 SV=1 89 493 9.0E-78
sp|Q15008|PSMD6_HUMAN 26S proteasome non-ATPase regulatory subunit 6 OS=Homo sapiens GN=PSMD6 PE=1 SV=1 103 493 2.0E-77
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10335|RPN7_SCHPO Probable 26S proteasome regulatory subunit rpn7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn7 PE=2 SV=1 13 496 1.0E-96
sp|Q06103|RPN7_YEAST 26S proteasome regulatory subunit RPN7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN7 PE=1 SV=3 4 498 1.0E-87
sp|Q93Y35|PSMD6_ARATH 26S proteasome non-ATPase regulatory subunit 6 homolog OS=Arabidopsis thaliana GN=RPN7 PE=1 SV=1 104 493 1.0E-79
sp|Q99JI4|PSMD6_MOUSE 26S proteasome non-ATPase regulatory subunit 6 OS=Mus musculus GN=Psmd6 PE=1 SV=1 89 493 9.0E-78
sp|Q15008|PSMD6_HUMAN 26S proteasome non-ATPase regulatory subunit 6 OS=Homo sapiens GN=PSMD6 PE=1 SV=1 103 493 2.0E-77
sp|Q3T0B2|PSMD6_BOVIN 26S proteasome non-ATPase regulatory subunit 6 OS=Bos taurus GN=PSMD6 PE=2 SV=1 103 493 2.0E-76
sp|Q20585|PSMD6_CAEEL 26S proteasome non-ATPase regulatory subunit 6 OS=Caenorhabditis elegans GN=rpn-7 PE=3 SV=1 6 491 4.0E-72
sp|Q55C75|PSMD6_DICDI 26S proteasome non-ATPase regulatory subunit 6 OS=Dictyostelium discoideum GN=psmD6 PE=1 SV=1 104 493 9.0E-68
sp|Q9V3G7|PSMD6_DROME 26S proteasome non-ATPase regulatory subunit 6 OS=Drosophila melanogaster GN=Rpn7 PE=2 SV=1 9 291 4.0E-42
sp|Q8W425|PSMD6_ORYSJ 26S proteasome non-ATPase regulatory subunit 6 OS=Oryza sativa subsp. japonica GN=RPN7 PE=2 SV=1 55 292 8.0E-40
sp|Q9V3G7|PSMD6_DROME 26S proteasome non-ATPase regulatory subunit 6 OS=Drosophila melanogaster GN=Rpn7 PE=2 SV=1 363 493 1.0E-35
sp|Q8W425|PSMD6_ORYSJ 26S proteasome non-ATPase regulatory subunit 6 OS=Oryza sativa subsp. japonica GN=RPN7 PE=2 SV=1 325 493 2.0E-34
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3154
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6215 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7082
Ophiocordyceps camponoti-floridani Ophcf2|01195
Ophiocordyceps camponoti-rufipedis Ophun1|2624
Ophiocordyceps kimflemingae Ophio5|698
Ophiocordyceps subramaniannii Hirsu2|5568

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6215
MGSDPLYAKWPLLPLSQHVFTLTNVYASRTAQQAAVKTLQDAITSDKMAPFYRYLAHPVDGILNVAGEASSSGAA
TSSSTATSAKPLSRKSSLVVGRSASGISLPWDEELYTRLKKDNDGQLAGFQKEEDEAVEQAGDTEIMAAKGKRAE
FWARVGDKDKAIASYEDVFEKTGILGTKIDLVLAIIRMALFYGDRALVKKHVERAKTLVDSGGDWDRRNRLKAYE
GLHLLTVRSYNLAAPLLLDSLSTFTSYELCSYSNLVVYAVLAGSVSLPRVDFKSKVVDAPEIKAIMGDGEDKLLA
LSGALSAGPGADDEPNSSSQMSSQTTVAAVKPAVNLTIIGSSTEQPEAEMAIDFSPLALLVSSLYNGNYQAFFKA
LADVEEQFLNQDRFLHEHKSWFIREMRLAAYQQLLQSYRVVGLESMANDFGVTVDFLDRDLARFIAAGRIPCTID
RVSGKGVIETNRPDDKNKQYQDVVRQGDQLITKLQKYGQAVRLRGSERA*
Coding >OphauG2|6215
ATGGGGTCGGATCCGCTCTACGCCAAATGGCCTTTGCTGCCTCTCTCGCAGCACGTCTTCACCCTGACAAACGTC
TACGCCTCGCGCACCGCCCAGCAGGCCGCTGTTAAGACGCTGCAGGACGCCATCACCTCAGACAAGATGGCTCCC
TTTTACCGCTACCTGGCTCACCCTGTAGACGGCATTCTCAATGTTGCCGGCGAAGCATCGTCGTCGGGCGCCGCC
ACTAGCTCCTCCACTGCCACCTCTGCAAAGCCGCTGAGTAGAAAGTCGAGCCTGGTTGTGGGCAGGTCCGCCTCG
GGAATCAGCCTGCCTTGGGACGAAGAACTCTATACCCGCCTCAAAAAGGACAACGATGGCCAGCTGGCTGGCTTT
CAAAAGGAGGAGGACGAAGCGGTCGAACAGGCGGGCGATACTGAAATCATGGCGGCAAAGGGCAAGCGCGCAGAA
TTCTGGGCCCGCGTGGGAGACAAGGACAAGGCCATTGCTTCGTACGAGGACGTGTTTGAAAAGACGGGCATCCTC
GGCACCAAAATCGACCTCGTCTTGGCCATAATACGCATGGCCCTCTTCTATGGCGACCGTGCCCTCGTCAAGAAG
CACGTGGAGCGCGCCAAGACACTCGTCGACTCTGGCGGTGACTGGGATCGCCGCAATCGTCTCAAGGCTTATGAA
GGCTTGCACCTCCTTACTGTCCGCTCCTACAATCTTGCCGCGCCGCTTCTGCTCGACTCTCTGTCCACATTTACC
AGCTACGAGCTTTGCTCATACTCCAACCTGGTCGTCTATGCCGTGCTTGCCGGTTCTGTCTCTCTCCCCCGCGTC
GACTTCAAATCAAAGGTGGTTGATGCCCCCGAGATCAAGGCTATTATGGGCGACGGGGAGGACAAGCTGCTGGCC
TTGAGCGGTGCGCTTAGCGCTGGGCCTGGGGCTGATGATGAGCCCAATTCAAGCTCTCAAATGTCGTCGCAAACC
ACCGTCGCCGCCGTCAAGCCTGCCGTCAACCTGACCATTATTGGCTCCAGCACAGAGCAGCCAGAGGCTGAAATG
GCCATTGATTTTAGCCCCTTGGCCCTGCTCGTCAGCAGTCTGTATAATGGAAACTACCAGGCCTTCTTCAAGGCC
TTGGCCGATGTGGAGGAGCAGTTCCTCAACCAAGACCGCTTCCTACACGAGCACAAGAGCTGGTTCATTCGCGAG
ATGCGTCTTGCCGCCTACCAGCAACTATTGCAGAGTTACCGTGTTGTTGGCCTGGAGAGCATGGCCAACGATTTC
GGCGTCACTGTTGATTTCCTTGACCGCGATCTCGCCCGCTTTATTGCTGCCGGTCGCATTCCCTGCACCATTGAC
CGCGTCTCCGGGAAAGGTGTCATTGAGACAAACCGGCCCGACGACAAAAACAAGCAGTACCAGGACGTGGTTCGC
CAGGGCGACCAACTCATTACCAAGCTGCAAAAATACGGCCAGGCCGTCAGACTCAGAGGTAGTGAGCGGGCGTAG
Transcript >OphauG2|6215
ATGGGGTCGGATCCGCTCTACGCCAAATGGCCTTTGCTGCCTCTCTCGCAGCACGTCTTCACCCTGACAAACGTC
TACGCCTCGCGCACCGCCCAGCAGGCCGCTGTTAAGACGCTGCAGGACGCCATCACCTCAGACAAGATGGCTCCC
TTTTACCGCTACCTGGCTCACCCTGTAGACGGCATTCTCAATGTTGCCGGCGAAGCATCGTCGTCGGGCGCCGCC
ACTAGCTCCTCCACTGCCACCTCTGCAAAGCCGCTGAGTAGAAAGTCGAGCCTGGTTGTGGGCAGGTCCGCCTCG
GGAATCAGCCTGCCTTGGGACGAAGAACTCTATACCCGCCTCAAAAAGGACAACGATGGCCAGCTGGCTGGCTTT
CAAAAGGAGGAGGACGAAGCGGTCGAACAGGCGGGCGATACTGAAATCATGGCGGCAAAGGGCAAGCGCGCAGAA
TTCTGGGCCCGCGTGGGAGACAAGGACAAGGCCATTGCTTCGTACGAGGACGTGTTTGAAAAGACGGGCATCCTC
GGCACCAAAATCGACCTCGTCTTGGCCATAATACGCATGGCCCTCTTCTATGGCGACCGTGCCCTCGTCAAGAAG
CACGTGGAGCGCGCCAAGACACTCGTCGACTCTGGCGGTGACTGGGATCGCCGCAATCGTCTCAAGGCTTATGAA
GGCTTGCACCTCCTTACTGTCCGCTCCTACAATCTTGCCGCGCCGCTTCTGCTCGACTCTCTGTCCACATTTACC
AGCTACGAGCTTTGCTCATACTCCAACCTGGTCGTCTATGCCGTGCTTGCCGGTTCTGTCTCTCTCCCCCGCGTC
GACTTCAAATCAAAGGTGGTTGATGCCCCCGAGATCAAGGCTATTATGGGCGACGGGGAGGACAAGCTGCTGGCC
TTGAGCGGTGCGCTTAGCGCTGGGCCTGGGGCTGATGATGAGCCCAATTCAAGCTCTCAAATGTCGTCGCAAACC
ACCGTCGCCGCCGTCAAGCCTGCCGTCAACCTGACCATTATTGGCTCCAGCACAGAGCAGCCAGAGGCTGAAATG
GCCATTGATTTTAGCCCCTTGGCCCTGCTCGTCAGCAGTCTGTATAATGGAAACTACCAGGCCTTCTTCAAGGCC
TTGGCCGATGTGGAGGAGCAGTTCCTCAACCAAGACCGCTTCCTACACGAGCACAAGAGCTGGTTCATTCGCGAG
ATGCGTCTTGCCGCCTACCAGCAACTATTGCAGAGTTACCGTGTTGTTGGCCTGGAGAGCATGGCCAACGATTTC
GGCGTCACTGTTGATTTCCTTGACCGCGATCTCGCCCGCTTTATTGCTGCCGGTCGCATTCCCTGCACCATTGAC
CGCGTCTCCGGGAAAGGTGTCATTGAGACAAACCGGCCCGACGACAAAAACAAGCAGTACCAGGACGTGGTTCGC
CAGGGCGACCAACTCATTACCAAGCTGCAAAAATACGGCCAGGCCGTCAGACTCAGAGGTAGTGAGCGGGCGTAG
Gene >OphauG2|6215
ATGGGGTCGGATCCGCTCTACGCCAAATGGCCTTTGCTGCCTCTCTCGCAGCACGTCTTCACCCTGACAAACGTC
TACGCCTCGCGCACCGCCCAGCAGGCCGCTGTTAAGACGCTGCAGGACGCCATCACCTCAGACAAGATGGCTCCC
TTTTACCGCTACCTGGCTCACCCTGTAGACGGCATTCTCAATGTTGCCGGCGAAGCATCGTCGTCGGGCGCCGCC
ACTAGCTCCTCCACTGCCACCTCTGCAAAGCCGCTGAGTAGAAAGTCGAGCCTGGTTGTGGGCAGGTCCGCCTCG
GGAATCAGCCTGCCTTGGGACGAAGAACTCTATACCCGCCTCAAAAAGGACAACGATGGCCAGCTGGCTGGCTTT
CAAAAGGAGGAGGACGAAGCGGTCGAACAGGCGGGCGATACTGAAATCATGGCGGCAAAGGGCAAGCGCGCAGAA
TTCTGGGCCCGCGTGGGAGACAAGGTTGGCCGGCTGCGTCTGTCTTTTCCTCCTCACTCATGCATCTTGCTGACT
TGACTCGTGGCGCAGGACAAGGCCATTGCTTCGTACGAGGACGTGTTTGAAAAGACGGGCATCCTCGGCACCAAA
ATCGACCTCGTCTTGGCCATAATACGCATGGCCCTCTTCTATGGCGACCGTGCCCTCGTCAAGAAGCACGTGGAG
CGCGCCAAGACACTCGTCGACTCTGGCGGTGACTGGGATCGCCGCAATCGTCTCAAGGCTTATGAAGGCTTGCAC
CTCCTTACTGTCCGCTCCTACAATCTTGCCGCGCCGCTTCTGCTCGACTCTCTGTCCACATTTACCAGCTACGAG
CTTTGCTCATACTCCAACCTGGTCGTCTATGCCGTGCTTGCCGGTTCTGTCTCTCTCCCCCGCGTCGACTTCAAA
TCAAAGGTGGTTGATGCCCCCGAGATCAAGGCTATTATGGGCGACGGGGAGGACAAGCTGCTGGCCTTGAGCGGT
GCGCTTAGCGCTGGGCCTGGGGCTGATGATGAGCCCAATTCAAGCTCTCAAATGTCGTCGCAAACCACCGTCGCC
GCCGTCAAGCCTGCCGTCAACCTGACCATTATTGGCTCCAGCACAGAGCAGCCAGAGGCTGAAATGGCCATTGAT
TTTAGCCCCTTGGCCCTGCTCGTCAGCAGTCTGTATAATGGAAACTACCAGGCCTTCTTCAAGGCCTTGGCCGAT
GTGGAGGAGCAGTTCCTCAACCAAGACCGCTTCCTACACGAGCACAAGAGCTGGTTCATTCGCGAGATGCGTCTT
GCCGCCTACCAGCAACTATTGCAGAGTTACCGTGTTGTTGGCCTGGAGAGCATGGCCAACGATTTCGGCGTCACT
GTTGATTTCCTTGACCGGTAAGCGCCCTCAGTTGGTTACGTGGCCACAACTCCCACTTGGCCGGTTCCTAACCTG
TCGTTTTTGCAGCGATCTCGCCCGCTTTATTGCTGCCGGTCGCATTCCCTGCACCATTGACCGCGTCTCCGGGAA
AGGTGTCATTGAGACAAACCGGCCCGACGACAAAAACAAGCAGTACCAGGACGTGGTTCGCCAGGGCGACCAACT
CATTACCAAGCTGCAAAAATACGGCCAGGCCGTCAGACTCAGAGGTAGTGAGCGGGCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail