Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6206
Gene name
LocationContig_62:376..1135
Strand+
Gene length (bp)759
Transcript length (bp)759
Coding sequence length (bp)759
Protein length (aa) 253

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10294 Methyltransf_16 Lysine methyltransferase 4.3E-12 50 204

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I2X5|NNT1_GIBZE Protein N-methyltransferase NNT1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=NNT1 PE=3 SV=2 9 246 5.0E-103
sp|Q7S634|NNT1_NEUCR Protein N-methyltransferase nnt1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nnt-1 PE=3 SV=1 26 247 2.0E-76
sp|Q9UT28|NNT1_SCHPO Protein N-methyltransferase nnt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nnt1 PE=3 SV=1 11 247 2.0E-55
sp|Q5BAD0|NNT1_EMENI Protein N-methyltransferase nnt1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nnt1 PE=3 SV=1 7 248 8.0E-54
sp|Q4WYS7|NNT1_ASPFU Protein N-methyltransferase nnt1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nnt1 PE=3 SV=1 12 246 4.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I2X5|NNT1_GIBZE Protein N-methyltransferase NNT1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=NNT1 PE=3 SV=2 9 246 5.0E-103
sp|Q7S634|NNT1_NEUCR Protein N-methyltransferase nnt1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nnt-1 PE=3 SV=1 26 247 2.0E-76
sp|Q9UT28|NNT1_SCHPO Protein N-methyltransferase nnt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nnt1 PE=3 SV=1 11 247 2.0E-55
sp|Q5BAD0|NNT1_EMENI Protein N-methyltransferase nnt1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nnt1 PE=3 SV=1 7 248 8.0E-54
sp|Q4WYS7|NNT1_ASPFU Protein N-methyltransferase nnt1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nnt1 PE=3 SV=1 12 246 4.0E-49
sp|Q6CUI0|NNT1_KLULA Protein N-methyltransferase NNT1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NNT1 PE=3 SV=1 5 245 3.0E-47
sp|Q74ZB5|NNT1_ASHGO Protein N-methyltransferase NNT1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NNT1 PE=3 SV=1 33 245 1.0E-46
sp|Q05874|NNT1_YEAST Protein N-methyltransferase NNT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NNT1 PE=1 SV=1 5 245 3.0E-43
sp|Q6FJ22|NNT1_CANGA Protein N-methyltransferase NNT1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NNT1 PE=3 SV=1 5 245 2.0E-41
sp|P0CP44|NNT1_CRYNJ Protein N-methyltransferase NNT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=NNT1 PE=3 SV=1 36 242 5.0E-38
sp|P0CP45|NNT1_CRYNB Protein N-methyltransferase NNT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=NNT1 PE=3 SV=1 36 242 5.0E-38
sp|Q5A013|NNT1_CANAL Protein N-methyltransferase NNT1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NNT1 PE=3 SV=1 2 244 7.0E-36
sp|Q6BKI8|NNT1_DEBHA Protein N-methyltransferase NNT1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NNT1 PE=3 SV=1 34 244 8.0E-36
sp|Q6CHE9|NNT1_YARLI Protein N-methyltransferase NNT1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NNT1 PE=3 SV=1 5 245 6.0E-34
sp|Q28IN4|MT21B_XENTR Protein-lysine methyltransferase METTL21B OS=Xenopus tropicalis GN=mettl21b PE=2 SV=1 53 220 6.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6206
MDNYMSDVASLMQEPQDYYPPSPPPTEQCHTLQDGRRVALHLVGHSATEAHHVWNGSRFVADLFEAEPERVRGRS
VLELGAGAGLPSLVAGLVGARRVVMTDFPDPELVAAMQRNVDEAAVQQVVRVLGFVWGGDAAPLLAALAPEDKGF
DVLVLADLLFRHSEHGALVRTICQTMRRTASSAAYVFFTSYRPWKQAADMAFFDVARAAGLAVRLLAERKLDAPL
FADDPGDVEVQKTVRGFMVCWPDSAPE*
Coding >OphauG2|6206
ATGGATAACTACATGTCCGACGTCGCGTCTCTCATGCAAGAGCCCCAGGACTACTACCCGCCTTCGCCTCCGCCA
ACAGAGCAATGCCACACGCTACAAGACGGACGACGAGTAGCGCTGCACCTAGTAGGACACAGCGCAACCGAGGCG
CACCACGTATGGAACGGCAGTCGCTTTGTCGCCGACTTGTTCGAGGCCGAGCCGGAGCGAGTGCGCGGGCGCAGC
GTCTTGGAGCTGGGTGCCGGAGCTGGCCTGCCGTCGCTGGTGGCAGGCCTTGTGGGAGCGCGGCGAGTCGTCATG
ACGGACTTTCCAGACCCGGAACTAGTAGCAGCCATGCAGCGCAACGTGGACGAAGCTGCGGTGCAACAAGTGGTG
CGTGTACTGGGCTTTGTCTGGGGAGGAGACGCGGCGCCCCTGCTGGCGGCTCTGGCTCCCGAGGACAAGGGCTTT
GATGTGCTCGTCTTGGCCGATCTTCTCTTCCGCCACTCTGAGCACGGCGCACTGGTGCGGACCATTTGCCAGACG
ATGCGCCGCACGGCATCGAGTGCAGCCTACGTCTTCTTCACCTCGTACCGTCCCTGGAAGCAGGCTGCCGACATG
GCCTTTTTCGACGTTGCCAGGGCCGCGGGCCTTGCAGTCCGGTTGCTTGCTGAGCGTAAGCTAGACGCACCTCTG
TTTGCTGACGATCCCGGCGATGTCGAGGTGCAGAAGACGGTTAGGGGCTTCATGGTCTGCTGGCCAGACAGTGCG
CCAGAATGA
Transcript >OphauG2|6206
ATGGATAACTACATGTCCGACGTCGCGTCTCTCATGCAAGAGCCCCAGGACTACTACCCGCCTTCGCCTCCGCCA
ACAGAGCAATGCCACACGCTACAAGACGGACGACGAGTAGCGCTGCACCTAGTAGGACACAGCGCAACCGAGGCG
CACCACGTATGGAACGGCAGTCGCTTTGTCGCCGACTTGTTCGAGGCCGAGCCGGAGCGAGTGCGCGGGCGCAGC
GTCTTGGAGCTGGGTGCCGGAGCTGGCCTGCCGTCGCTGGTGGCAGGCCTTGTGGGAGCGCGGCGAGTCGTCATG
ACGGACTTTCCAGACCCGGAACTAGTAGCAGCCATGCAGCGCAACGTGGACGAAGCTGCGGTGCAACAAGTGGTG
CGTGTACTGGGCTTTGTCTGGGGAGGAGACGCGGCGCCCCTGCTGGCGGCTCTGGCTCCCGAGGACAAGGGCTTT
GATGTGCTCGTCTTGGCCGATCTTCTCTTCCGCCACTCTGAGCACGGCGCACTGGTGCGGACCATTTGCCAGACG
ATGCGCCGCACGGCATCGAGTGCAGCCTACGTCTTCTTCACCTCGTACCGTCCCTGGAAGCAGGCTGCCGACATG
GCCTTTTTCGACGTTGCCAGGGCCGCGGGCCTTGCAGTCCGGTTGCTTGCTGAGCGTAAGCTAGACGCACCTCTG
TTTGCTGACGATCCCGGCGATGTCGAGGTGCAGAAGACGGTTAGGGGCTTCATGGTCTGCTGGCCAGACAGTGCG
CCAGAATGA
Gene >OphauG2|6206
ATGGATAACTACATGTCCGACGTCGCGTCTCTCATGCAAGAGCCCCAGGACTACTACCCGCCTTCGCCTCCGCCA
ACAGAGCAATGCCACACGCTACAAGACGGACGACGAGTAGCGCTGCACCTAGTAGGACACAGCGCAACCGAGGCG
CACCACGTATGGAACGGCAGTCGCTTTGTCGCCGACTTGTTCGAGGCCGAGCCGGAGCGAGTGCGCGGGCGCAGC
GTCTTGGAGCTGGGTGCCGGAGCTGGCCTGCCGTCGCTGGTGGCAGGCCTTGTGGGAGCGCGGCGAGTCGTCATG
ACGGACTTTCCAGACCCGGAACTAGTAGCAGCCATGCAGCGCAACGTGGACGAAGCTGCGGTGCAACAAGTGGTG
CGTGTACTGGGCTTTGTCTGGGGAGGAGACGCGGCGCCCCTGCTGGCGGCTCTGGCTCCCGAGGACAAGGGCTTT
GATGTGCTCGTCTTGGCCGATCTTCTCTTCCGCCACTCTGAGCACGGCGCACTGGTGCGGACCATTTGCCAGACG
ATGCGCCGCACGGCATCGAGTGCAGCCTACGTCTTCTTCACCTCGTACCGTCCCTGGAAGCAGGCTGCCGACATG
GCCTTTTTCGACGTTGCCAGGGCCGCGGGCCTTGCAGTCCGGTTGCTTGCTGAGCGTAAGCTAGACGCACCTCTG
TTTGCTGACGATCCCGGCGATGTCGAGGTGCAGAAGACGGTTAGGGGCTTCATGGTCTGCTGGCCAGACAGTGCG
CCAGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail