Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6202
Gene name
LocationContig_619:4136..5195
Strand+
Gene length (bp)1059
Transcript length (bp)1002
Coding sequence length (bp)1002
Protein length (aa) 334

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04909 Amidohydro_2 Amidohydrolase 4.9E-34 40 328

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P80402|DBD23_ASPOR 2,3-dihydroxybenzoate decarboxylase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090005000447 PE=1 SV=2 1 328 0.0E+00
sp|P0CT50|SDC_TRIMF Salicylate decarboxylase OS=Trichosporon moniliiforme GN=sdc PE=1 SV=1 1 328 7.0E-120
sp|P80346|DBD23_ASPNG 2,3-dihydroxybenzoate decarboxylase (Fragments) OS=Aspergillus niger PE=1 SV=1 1 212 2.0E-36
sp|Q0II68|ACMSD_BOVIN 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase OS=Bos taurus GN=ACMSD PE=2 SV=1 43 294 5.0E-19
sp|Q8R5M5|ACMSD_RAT 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase OS=Rattus norvegicus GN=Acmsd PE=1 SV=1 45 294 2.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P80402|DBD23_ASPOR 2,3-dihydroxybenzoate decarboxylase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090005000447 PE=1 SV=2 1 328 0.0E+00
sp|P0CT50|SDC_TRIMF Salicylate decarboxylase OS=Trichosporon moniliiforme GN=sdc PE=1 SV=1 1 328 7.0E-120
sp|P80346|DBD23_ASPNG 2,3-dihydroxybenzoate decarboxylase (Fragments) OS=Aspergillus niger PE=1 SV=1 1 212 2.0E-36
sp|Q0II68|ACMSD_BOVIN 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase OS=Bos taurus GN=ACMSD PE=2 SV=1 43 294 5.0E-19
sp|Q8R5M5|ACMSD_RAT 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase OS=Rattus norvegicus GN=Acmsd PE=1 SV=1 45 294 2.0E-17
sp|Q8R519|ACMSD_MOUSE 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase OS=Mus musculus GN=Acmsd PE=1 SV=2 45 294 2.0E-17
sp|Q8TDX5|ACMSD_HUMAN 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase OS=Homo sapiens GN=ACMSD PE=1 SV=1 45 294 1.0E-16
sp|Q54LN9|ACMSD_DICDI 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase OS=Dictyostelium discoideum GN=acmsd PE=3 SV=1 43 294 2.0E-16
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6202
MKGKIALEEAFALPRFHDKTLWWASMFSVDAERHASEMTDITDRRLKYMDEHGVGYTILSYTAPGVQDEWDAAVA
QRLAVEVNDYIAAQIKDHGDRFGAFATLSMHNPDEAASELRRCVRQYGFKGALVNDTQRAGQDGDDMIFYDGPEW
DVFWATVTQLDVPFYLHPRNPTGTMHDKLWAKRKWLIGPPLSFAQGVSLHALGMITNGVFDRHPKLQVILGHLGE
HIPFDMWRINHWFEDIKKPLGLGCQRTIRQYFNDNVWITTSGHFSTTTLQFCMAEIGAHRILFSIDYPFESFGQA
CDWYNGVELKPEDKLAIGRQNAERLFKLKPSTA*
Coding >OphauG2|6202
ATGAAGGGCAAGATTGCGCTTGAAGAGGCCTTTGCGCTGCCTCGGTTTCATGACAAGACACTGTGGTGGGCGTCC
ATGTTTTCAGTCGACGCGGAGCGCCACGCGAGTGAAATGACGGACATTACCGACAGGCGGCTCAAGTACATGGAC
GAGCATGGCGTGGGATACACGATTCTGTCTTACACGGCGCCCGGAGTGCAGGATGAATGGGACGCCGCGGTGGCG
CAAAGGCTGGCGGTCGAGGTCAATGACTATATTGCGGCGCAGATCAAGGACCATGGCGACCGGTTTGGGGCATTT
GCAACGCTGTCCATGCACAATCCCGACGAGGCAGCCTCGGAGCTGAGGCGCTGCGTGAGGCAATATGGCTTCAAG
GGCGCCCTGGTCAACGACACGCAGCGAGCGGGCCAAGACGGCGACGACATGATCTTTTACGACGGCCCTGAATGG
GACGTCTTTTGGGCCACGGTGACGCAGCTCGACGTGCCCTTTTATCTGCATCCGCGCAACCCAACGGGCACCATG
CACGACAAGCTCTGGGCCAAGAGGAAGTGGCTGATTGGGCCGCCGCTCTCCTTTGCGCAGGGCGTCAGTCTGCAC
GCGCTGGGCATGATTACCAATGGCGTCTTTGACCGGCATCCCAAGCTTCAAGTGATTCTCGGACACCTTGGCGAG
CACATTCCCTTTGACATGTGGCGCATCAACCACTGGTTCGAGGACATTAAGAAGCCGCTTGGGCTGGGCTGCCAA
AGGACGATTCGGCAGTATTTCAACGACAATGTGTGGATCACGACGAGCGGCCACTTTTCCACCACGACGCTGCAG
TTTTGCATGGCCGAGATTGGCGCCCACCGCATCCTGTTCTCCATAGACTATCCCTTTGAGTCGTTTGGCCAGGCC
TGTGACTGGTATAATGGTGTTGAGTTAAAGCCCGAGGATAAGCTCGCCATTGGCAGGCAAAACGCCGAGCGGCTG
TTTAAGCTCAAGCCGTCGACTGCCTGA
Transcript >OphauG2|6202
ATGAAGGGCAAGATTGCGCTTGAAGAGGCCTTTGCGCTGCCTCGGTTTCATGACAAGACACTGTGGTGGGCGTCC
ATGTTTTCAGTCGACGCGGAGCGCCACGCGAGTGAAATGACGGACATTACCGACAGGCGGCTCAAGTACATGGAC
GAGCATGGCGTGGGATACACGATTCTGTCTTACACGGCGCCCGGAGTGCAGGATGAATGGGACGCCGCGGTGGCG
CAAAGGCTGGCGGTCGAGGTCAATGACTATATTGCGGCGCAGATCAAGGACCATGGCGACCGGTTTGGGGCATTT
GCAACGCTGTCCATGCACAATCCCGACGAGGCAGCCTCGGAGCTGAGGCGCTGCGTGAGGCAATATGGCTTCAAG
GGCGCCCTGGTCAACGACACGCAGCGAGCGGGCCAAGACGGCGACGACATGATCTTTTACGACGGCCCTGAATGG
GACGTCTTTTGGGCCACGGTGACGCAGCTCGACGTGCCCTTTTATCTGCATCCGCGCAACCCAACGGGCACCATG
CACGACAAGCTCTGGGCCAAGAGGAAGTGGCTGATTGGGCCGCCGCTCTCCTTTGCGCAGGGCGTCAGTCTGCAC
GCGCTGGGCATGATTACCAATGGCGTCTTTGACCGGCATCCCAAGCTTCAAGTGATTCTCGGACACCTTGGCGAG
CACATTCCCTTTGACATGTGGCGCATCAACCACTGGTTCGAGGACATTAAGAAGCCGCTTGGGCTGGGCTGCCAA
AGGACGATTCGGCAGTATTTCAACGACAATGTGTGGATCACGACGAGCGGCCACTTTTCCACCACGACGCTGCAG
TTTTGCATGGCCGAGATTGGCGCCCACCGCATCCTGTTCTCCATAGACTATCCCTTTGAGTCGTTTGGCCAGGCC
TGTGACTGGTATAATGGTGTTGAGTTAAAGCCCGAGGATAAGCTCGCCATTGGCAGGCAAAACGCCGAGCGGCTG
TTTAAGCTCAAGCCGTCGACTGCCTGA
Gene >OphauG2|6202
ATGAAGGGCAAGATTGCGCTTGAAGAGGCCTTTGCGCTGCCTCGGTTTCATGACAAGACACTGTGGTGGGCGTCC
ATGTTTTCAGTCGACGCGGAGCGCCACGCGAGTGAAATGACGGACATTACCGACAGGCGGCTCAAGTACATGGAC
GAGCATGGCGTGGGATACACGATTCTGTCTTACACGGCGCCCGGAGTGCAGGATGAATGGGACGCCGCGGTGGCG
CAAAGGCTGGCGGTCGAGGTCAATGACTATATTGCGGCGCAGATCAAGGACCATGGCGACCGGTTTGGGGCATTT
GCGTCAGTTGCTCTGCCATGCTCTGCGGGCAGACGAATGGCGGGCTGACAAGTGGACAGAACGCTGTCCATGCAC
AATCCCGACGAGGCAGCCTCGGAGCTGAGGCGCTGCGTGAGGCAATATGGCTTCAAGGGCGCCCTGGTCAACGAC
ACGCAGCGAGCGGGCCAAGACGGCGACGACATGATCTTTTACGACGGCCCTGAATGGGACGTCTTTTGGGCCACG
GTGACGCAGCTCGACGTGCCCTTTTATCTGCATCCGCGCAACCCAACGGGCACCATGCACGACAAGCTCTGGGCC
AAGAGGAAGTGGCTGATTGGGCCGCCGCTCTCCTTTGCGCAGGGCGTCAGTCTGCACGCGCTGGGCATGATTACC
AATGGCGTCTTTGACCGGCATCCCAAGCTTCAAGTGATTCTCGGACACCTTGGCGAGCACATTCCCTTTGACATG
TGGCGCATCAACCACTGGTTCGAGGACATTAAGAAGCCGCTTGGGCTGGGCTGCCAAAGGACGATTCGGCAGTAT
TTCAACGACAATGTGTGGATCACGACGAGCGGCCACTTTTCCACCACGACGCTGCAGTTTTGCATGGCCGAGATT
GGCGCCCACCGCATCCTGTTCTCCATAGACTATCCCTTTGAGTCGTTTGGCCAGGCCTGTGACTGGTATAATGGT
GTTGAGTTAAAGCCCGAGGATAAGCTCGCCATTGGCAGGCAAAACGCCGAGCGGCTGTTTAAGCTCAAGCCGTCG
ACTGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail