Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6188
Gene name
LocationContig_616:834..1902
Strand+
Gene length (bp)1068
Transcript length (bp)1068
Coding sequence length (bp)1068
Protein length (aa) 356

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03069 FmdA_AmdA Acetamidase/Formamidase family 6.0E-13 113 201
PF03069 FmdA_AmdA Acetamidase/Formamidase family 8.2E-26 206 354

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q07838|AMDA_MYCSM Acetamidase OS=Mycobacterium smegmatis GN=amdA PE=1 SV=2 114 253 2.0E-12
sp|Q50228|FMDA_METME Formamidase OS=Methylophilus methylotrophus GN=fmdA PE=1 SV=1 114 275 4.0E-11

GO

GO Term Description Terminal node
GO:0016811 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides Yes
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6188
MAYFIQGRRSAEATSFTSLCIKYLLIAVVMALPTQCQVHRLEATPETIAYGYYWSEARPVLRIASGDIVDVDTLV
AGSPQQLAKAGVPDEEIQDSLKKVEAAFPEGSPGRGPGVHILTGPVYVEGAEANDVLEVNILSIDLQIGYGYNGC
GGFLPENCDSSLSERIVRLDNQTMTSEFLPGIVLPLKPFFGSMGVAPAPELGRVSSIPPGKHAGNLDNKELVAGS
TLYMPVFVPGALFQVGDGHAAQGDGEVDRNAIETSLNGKIQLTVRKDLKLTWPRAETATHYISMATDPDLAIATK
TAIQEMIDFLVVARGLTKHQAYQLVSIAGDVVVTQLVDRPNLGVHVKMAKDIFKL*
Coding >OphauG2|6188
ATGGCATATTTTATCCAGGGTAGACGTAGCGCCGAGGCGACAAGCTTTACAAGTTTATGCATCAAGTATCTGTTG
ATTGCCGTGGTGATGGCACTACCGACGCAATGTCAAGTACACCGGCTCGAGGCGACGCCTGAGACCATCGCCTAT
GGCTACTACTGGTCAGAAGCGAGACCGGTGCTGCGTATAGCATCCGGAGACATTGTTGATGTCGACACGCTGGTC
GCGGGCTCGCCCCAGCAACTCGCCAAGGCGGGGGTCCCTGATGAAGAAATTCAAGACTCGCTCAAGAAAGTCGAA
GCCGCGTTTCCTGAAGGCAGCCCCGGGCGGGGTCCGGGCGTCCATATCCTTACCGGCCCCGTCTATGTCGAGGGT
GCGGAAGCCAACGATGTTCTCGAAGTCAATATACTCTCCATCGACCTACAGATTGGATACGGCTACAACGGCTGT
GGTGGCTTCTTGCCTGAGAACTGCGACTCTTCGCTCAGCGAGCGCATCGTACGGCTGGATAACCAGACCATGACG
TCCGAGTTTCTCCCAGGTATCGTGCTGCCACTCAAACCCTTCTTCGGCAGCATGGGAGTCGCGCCGGCTCCAGAG
CTCGGTCGCGTGAGCAGCATTCCGCCGGGCAAACATGCCGGCAATCTCGATAATAAGGAACTCGTCGCCGGCTCG
ACACTCTACATGCCAGTCTTCGTGCCAGGTGCCTTGTTTCAAGTCGGCGACGGCCACGCGGCCCAGGGCGACGGC
GAGGTCGACCGCAACGCCATTGAGACATCATTAAATGGCAAGATCCAGCTTACTGTTCGCAAAGATTTGAAGCTC
ACGTGGCCACGGGCCGAGACTGCGACGCATTATATCTCCATGGCCACAGATCCAGATCTTGCCATTGCCACAAAG
ACGGCAATCCAAGAAATGATTGACTTTCTTGTTGTTGCTCGCGGCCTGACCAAGCATCAGGCCTATCAACTCGTC
AGCATCGCCGGAGATGTTGTCGTTACACAGCTCGTCGATCGTCCCAACTTGGGGGTGCACGTCAAGATGGCCAAG
GATATCTTTAAGCTCTAA
Transcript >OphauG2|6188
ATGGCATATTTTATCCAGGGTAGACGTAGCGCCGAGGCGACAAGCTTTACAAGTTTATGCATCAAGTATCTGTTG
ATTGCCGTGGTGATGGCACTACCGACGCAATGTCAAGTACACCGGCTCGAGGCGACGCCTGAGACCATCGCCTAT
GGCTACTACTGGTCAGAAGCGAGACCGGTGCTGCGTATAGCATCCGGAGACATTGTTGATGTCGACACGCTGGTC
GCGGGCTCGCCCCAGCAACTCGCCAAGGCGGGGGTCCCTGATGAAGAAATTCAAGACTCGCTCAAGAAAGTCGAA
GCCGCGTTTCCTGAAGGCAGCCCCGGGCGGGGTCCGGGCGTCCATATCCTTACCGGCCCCGTCTATGTCGAGGGT
GCGGAAGCCAACGATGTTCTCGAAGTCAATATACTCTCCATCGACCTACAGATTGGATACGGCTACAACGGCTGT
GGTGGCTTCTTGCCTGAGAACTGCGACTCTTCGCTCAGCGAGCGCATCGTACGGCTGGATAACCAGACCATGACG
TCCGAGTTTCTCCCAGGTATCGTGCTGCCACTCAAACCCTTCTTCGGCAGCATGGGAGTCGCGCCGGCTCCAGAG
CTCGGTCGCGTGAGCAGCATTCCGCCGGGCAAACATGCCGGCAATCTCGATAATAAGGAACTCGTCGCCGGCTCG
ACACTCTACATGCCAGTCTTCGTGCCAGGTGCCTTGTTTCAAGTCGGCGACGGCCACGCGGCCCAGGGCGACGGC
GAGGTCGACCGCAACGCCATTGAGACATCATTAAATGGCAAGATCCAGCTTACTGTTCGCAAAGATTTGAAGCTC
ACGTGGCCACGGGCCGAGACTGCGACGCATTATATCTCCATGGCCACAGATCCAGATCTTGCCATTGCCACAAAG
ACGGCAATCCAAGAAATGATTGACTTTCTTGTTGTTGCTCGCGGCCTGACCAAGCATCAGGCCTATCAACTCGTC
AGCATCGCCGGAGATGTTGTCGTTACACAGCTCGTCGATCGTCCCAACTTGGGGGTGCACGTCAAGATGGCCAAG
GATATCTTTAAGCTCTAA
Gene >OphauG2|6188
ATGGCATATTTTATCCAGGGTAGACGTAGCGCCGAGGCGACAAGCTTTACAAGTTTATGCATCAAGTATCTGTTG
ATTGCCGTGGTGATGGCACTACCGACGCAATGTCAAGTACACCGGCTCGAGGCGACGCCTGAGACCATCGCCTAT
GGCTACTACTGGTCAGAAGCGAGACCGGTGCTGCGTATAGCATCCGGAGACATTGTTGATGTCGACACGCTGGTC
GCGGGCTCGCCCCAGCAACTCGCCAAGGCGGGGGTCCCTGATGAAGAAATTCAAGACTCGCTCAAGAAAGTCGAA
GCCGCGTTTCCTGAAGGCAGCCCCGGGCGGGGTCCGGGCGTCCATATCCTTACCGGCCCCGTCTATGTCGAGGGT
GCGGAAGCCAACGATGTTCTCGAAGTCAATATACTCTCCATCGACCTACAGATTGGATACGGCTACAACGGCTGT
GGTGGCTTCTTGCCTGAGAACTGCGACTCTTCGCTCAGCGAGCGCATCGTACGGCTGGATAACCAGACCATGACG
TCCGAGTTTCTCCCAGGTATCGTGCTGCCACTCAAACCCTTCTTCGGCAGCATGGGAGTCGCGCCGGCTCCAGAG
CTCGGTCGCGTGAGCAGCATTCCGCCGGGCAAACATGCCGGCAATCTCGATAATAAGGAACTCGTCGCCGGCTCG
ACACTCTACATGCCAGTCTTCGTGCCAGGTGCCTTGTTTCAAGTCGGCGACGGCCACGCGGCCCAGGGCGACGGC
GAGGTCGACCGCAACGCCATTGAGACATCATTAAATGGCAAGATCCAGCTTACTGTTCGCAAAGATTTGAAGCTC
ACGTGGCCACGGGCCGAGACTGCGACGCATTATATCTCCATGGCCACAGATCCAGATCTTGCCATTGCCACAAAG
ACGGCAATCCAAGAAATGATTGACTTTCTTGTTGTTGCTCGCGGCCTGACCAAGCATCAGGCCTATCAACTCGTC
AGCATCGCCGGAGATGTTGTCGTTACACAGCTCGTCGATCGTCCCAACTTGGGGGTGCACGTCAAGATGGCCAAG
GATATCTTTAAGCTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail