Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|618
Gene name
LocationContig_1152:1565..2262
Strand+
Gene length (bp)697
Transcript length (bp)636
Coding sequence length (bp)636
Protein length (aa) 212

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08286 Spc24 Spc24 subunit of Ndc80 1.6E-33 85 209

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IBU5|SPC24_GIBZE Probable kinetochore protein SPC24 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SPC24 PE=3 SV=1 11 211 3.0E-61
sp|Q7S8M2|SPC24_NEUCR Probable kinetochore protein spc24 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=kpr-3 PE=3 SV=1 7 211 7.0E-52
sp|Q4X0I7|SPC24_ASPFU Probable kinetochore protein spc24 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=spc24 PE=3 SV=2 7 211 4.0E-49
sp|Q5AZQ6|SPC24_EMENI Probable kinetochore protein spc24 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=spc24 PE=3 SV=1 11 211 5.0E-48
sp|Q2UF95|SPC24_ASPOR Probable kinetochore protein spc24 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=spc24 PE=3 SV=1 11 211 5.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IBU5|SPC24_GIBZE Probable kinetochore protein SPC24 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SPC24 PE=3 SV=1 11 211 3.0E-61
sp|Q7S8M2|SPC24_NEUCR Probable kinetochore protein spc24 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=kpr-3 PE=3 SV=1 7 211 7.0E-52
sp|Q4X0I7|SPC24_ASPFU Probable kinetochore protein spc24 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=spc24 PE=3 SV=2 7 211 4.0E-49
sp|Q5AZQ6|SPC24_EMENI Probable kinetochore protein spc24 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=spc24 PE=3 SV=1 11 211 5.0E-48
sp|Q2UF95|SPC24_ASPOR Probable kinetochore protein spc24 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=spc24 PE=3 SV=1 11 211 5.0E-43
sp|Q9UST6|SPC24_SCHPO Kinetochore protein spc24 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spc24 PE=1 SV=1 9 211 5.0E-12
sp|Q6BXB6|SPC24_DEBHA Probable kinetochore protein SPC24 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SPC24 PE=3 SV=1 14 208 3.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|618
MELELRDVVALTKSVVDNFDIENDKNAHSRIMEGLARMQQVRDATIRHLQDDLHKLSRQHTALDAQLRHLADAQK
EADHASRNTKLDTLKFRTAKAASDAEAETERLASQAADLAARLEELDLEGVEGRLIHGQGSMTGGAARAMGDVVD
DEVLLRLKIYRTLGIEIERDDDSGEWRRAVVRNDDKGDVHVVNMDKKFSRFFYANYFWKTL*
Coding >OphauG2|618
ATGGAGTTGGAATTACGAGATGTAGTAGCTCTCACCAAATCCGTGGTTGACAACTTTGACATTGAAAACGACAAA
AATGCGCACTCACGCATCATGGAAGGGCTCGCGCGGATGCAGCAAGTCCGCGACGCAACGATCCGCCACCTCCAA
GACGACCTGCACAAGCTCTCGCGCCAGCACACGGCGCTCGACGCGCAGCTGCGCCACCTCGCCGACGCGCAAAAG
GAAGCCGACCACGCATCGCGCAACACCAAGCTCGACACGCTAAAGTTCCGCACCGCAAAGGCCGCGTCCGACGCC
GAAGCCGAAACGGAGCGCCTGGCCAGCCAGGCCGCAGACCTGGCTGCGCGCCTCGAGGAGCTGGACCTCGAGGGC
GTCGAGGGCCGACTCATCCATGGCCAAGGCAGCATGACGGGCGGCGCCGCGCGGGCCATGGGAGACGTGGTCGAC
GACGAAGTCCTGCTGCGCTTAAAGATTTACCGGACCCTGGGCATTGAGATTGAGCGCGACGACGATAGCGGCGAG
TGGAGGCGCGCAGTGGTGCGCAACGACGACAAGGGCGATGTGCACGTGGTCAACATGGACAAGAAGTTTTCGCGC
TTCTTTTACGCAAACTATTTCTGGAAGACGCTGTGA
Transcript >OphauG2|618
ATGGAGTTGGAATTACGAGATGTAGTAGCTCTCACCAAATCCGTGGTTGACAACTTTGACATTGAAAACGACAAA
AATGCGCACTCACGCATCATGGAAGGGCTCGCGCGGATGCAGCAAGTCCGCGACGCAACGATCCGCCACCTCCAA
GACGACCTGCACAAGCTCTCGCGCCAGCACACGGCGCTCGACGCGCAGCTGCGCCACCTCGCCGACGCGCAAAAG
GAAGCCGACCACGCATCGCGCAACACCAAGCTCGACACGCTAAAGTTCCGCACCGCAAAGGCCGCGTCCGACGCC
GAAGCCGAAACGGAGCGCCTGGCCAGCCAGGCCGCAGACCTGGCTGCGCGCCTCGAGGAGCTGGACCTCGAGGGC
GTCGAGGGCCGACTCATCCATGGCCAAGGCAGCATGACGGGCGGCGCCGCGCGGGCCATGGGAGACGTGGTCGAC
GACGAAGTCCTGCTGCGCTTAAAGATTTACCGGACCCTGGGCATTGAGATTGAGCGCGACGACGATAGCGGCGAG
TGGAGGCGCGCAGTGGTGCGCAACGACGACAAGGGCGATGTGCACGTGGTCAACATGGACAAGAAGTTTTCGCGC
TTCTTTTACGCAAACTATTTCTGGAAGACGCTGTGA
Gene >OphauG2|618
ATGGAGTTGGAATTACGAGATGTAGTAGCTGTAAGTCACGGCCAGGTCCCTAAACAGAAACCCAGCAACTAAAAG
GGGGGAGCGAGGGCAGCTCACCAAATCCGTGGTTGACAACTTTGACATTGAAAACGACAAAAATGCGCACTCACG
CATCATGGAAGGGCTCGCGCGGATGCAGCAAGTCCGCGACGCAACGATCCGCCACCTCCAAGACGACCTGCACAA
GCTCTCGCGCCAGCACACGGCGCTCGACGCGCAGCTGCGCCACCTCGCCGACGCGCAAAAGGAAGCCGACCACGC
ATCGCGCAACACCAAGCTCGACACGCTAAAGTTCCGCACCGCAAAGGCCGCGTCCGACGCCGAAGCCGAAACGGA
GCGCCTGGCCAGCCAGGCCGCAGACCTGGCTGCGCGCCTCGAGGAGCTGGACCTCGAGGGCGTCGAGGGCCGACT
CATCCATGGCCAAGGCAGCATGACGGGCGGCGCCGCGCGGGCCATGGGAGACGTGGTCGACGACGAAGTCCTGCT
GCGCTTAAAGATTTACCGGACCCTGGGCATTGAGATTGAGCGCGACGACGATAGCGGCGAGTGGAGGCGCGCAGT
GGTGCGCAACGACGACAAGGGCGATGTGCACGTGGTCAACATGGACAAGAAGTTTTCGCGCTTCTTTTACGCAAA
CTATTTCTGGAAGACGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail