Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6177
Gene name
LocationContig_613:3646..5344
Strand+
Gene length (bp)1698
Transcript length (bp)1563
Coding sequence length (bp)1563
Protein length (aa) 521

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01546 Peptidase_M20 Peptidase family M20/M25/M40 2.0E-19 129 516
PF07687 M20_dimer Peptidase dimerisation domain 2.3E-08 254 402

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P27614|CBPS_YEAST Carboxypeptidase S OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPS1 PE=1 SV=2 23 510 1.0E-76
sp|O13968|YE48_SCHPO Uncharacterized carboxypeptidase C24C9.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24C9.08 PE=3 SV=1 47 389 7.0E-71
sp|P0C155|CBPS2_YEAST Putative carboxypeptidase YOL153C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL153C PE=5 SV=1 26 410 3.0E-61
sp|Q8C165|P20D1_MOUSE Probable carboxypeptidase PM20D1 OS=Mus musculus GN=Pm20d1 PE=1 SV=1 2 408 1.0E-39
sp|Q2T9M7|P20D1_BOVIN Probable carboxypeptidase PM20D1 OS=Bos taurus GN=PM20D1 PE=2 SV=1 47 406 5.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P27614|CBPS_YEAST Carboxypeptidase S OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPS1 PE=1 SV=2 23 510 1.0E-76
sp|O13968|YE48_SCHPO Uncharacterized carboxypeptidase C24C9.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24C9.08 PE=3 SV=1 47 389 7.0E-71
sp|P0C155|CBPS2_YEAST Putative carboxypeptidase YOL153C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL153C PE=5 SV=1 26 410 3.0E-61
sp|Q8C165|P20D1_MOUSE Probable carboxypeptidase PM20D1 OS=Mus musculus GN=Pm20d1 PE=1 SV=1 2 408 1.0E-39
sp|Q2T9M7|P20D1_BOVIN Probable carboxypeptidase PM20D1 OS=Bos taurus GN=PM20D1 PE=2 SV=1 47 406 5.0E-37
sp|Q55FR8|CBPS2_DICDI Probable carboxypeptidase S-like 2 OS=Dictyostelium discoideum GN=DDB_G0267984 PE=3 SV=1 58 408 3.0E-34
sp|Q5ZL18|P20D1_CHICK Probable carboxypeptidase PM20D1 OS=Gallus gallus GN=PM20D1 PE=2 SV=1 7 408 9.0E-33
sp|Q08BB2|P2012_DANRE Probable carboxypeptidase PM20D1.2 OS=Danio rerio GN=pm20d1.2 PE=2 SV=1 57 408 3.0E-32
sp|Q08BT9|P20D1_XENTR Probable carboxypeptidase PM20D1 OS=Xenopus tropicalis GN=pm20d1 PE=2 SV=1 54 397 2.0E-31
sp|Q6GTS8|P20D1_HUMAN Probable carboxypeptidase PM20D1 OS=Homo sapiens GN=PM20D1 PE=2 SV=3 47 406 7.0E-31
sp|Q55DL1|CBPS1_DICDI Probable carboxypeptidase S-like 1 OS=Dictyostelium discoideum GN=DDB_G0270582 PE=3 SV=1 60 379 3.0E-30
sp|Q32LT9|P2011_DANRE Probable carboxypeptidase PM20D1.1 OS=Danio rerio GN=pm20d1.1 PE=2 SV=1 57 393 4.0E-28
sp|P37111|ACY1_PIG Aminoacylase-1 OS=Sus scrofa GN=ACY1 PE=1 SV=2 115 237 8.0E-09
sp|Q6AYS7|ACY1A_RAT Aminoacylase-1A OS=Rattus norvegicus GN=Acy1a PE=1 SV=1 115 238 3.0E-08
sp|Q99JW2|ACY1_MOUSE Aminoacylase-1 OS=Mus musculus GN=Acy1 PE=1 SV=1 115 238 4.0E-08
sp|Q5RFB0|ACY1_PONAB Aminoacylase-1 OS=Pongo abelii GN=ACY1 PE=2 SV=2 115 238 5.0E-08
sp|Q03154|ACY1_HUMAN Aminoacylase-1 OS=Homo sapiens GN=ACY1 PE=1 SV=1 115 238 6.0E-08
sp|A4VMY9|DAPE_PSEU5 Succinyl-diaminopimelate desuccinylase OS=Pseudomonas stutzeri (strain A1501) GN=dapE PE=3 SV=1 109 222 9.0E-08
sp|Q6PTT0|ACY1B_RAT Aminoacylase-1B OS=Rattus norvegicus GN=Acy1b PE=1 SV=1 115 238 1.0E-07
sp|Q31G37|DAPE_THICR Succinyl-diaminopimelate desuccinylase OS=Thiomicrospira crunogena (strain XCL-2) GN=dapE PE=3 SV=1 127 246 2.0E-07
sp|Q1R039|DAPE_CHRSD Succinyl-diaminopimelate desuccinylase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=dapE PE=3 SV=1 112 222 3.0E-07
sp|Q55DP8|ACY1_DICDI Aminoacylase-1 OS=Dictyostelium discoideum GN=acy1 PE=2 SV=1 106 237 1.0E-06
sp|Q9I4H5|DAPE_PSEAE Succinyl-diaminopimelate desuccinylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=dapE PE=3 SV=1 127 222 1.0E-06
sp|B7UX27|DAPE_PSEA8 Succinyl-diaminopimelate desuccinylase OS=Pseudomonas aeruginosa (strain LESB58) GN=dapE PE=3 SV=1 127 222 1.0E-06
sp|Q02IY2|DAPE_PSEAB Succinyl-diaminopimelate desuccinylase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=dapE PE=3 SV=1 127 222 3.0E-06
sp|Q6VE94|DAPE_PSESY Succinyl-diaminopimelate desuccinylase OS=Pseudomonas syringae pv. syringae GN=dapE PE=3 SV=1 127 222 4.0E-06
sp|A6V936|DAPE_PSEA7 Succinyl-diaminopimelate desuccinylase OS=Pseudomonas aeruginosa (strain PA7) GN=dapE PE=3 SV=1 127 222 5.0E-06
sp|A1K719|DAPE_AZOSB Succinyl-diaminopimelate desuccinylase OS=Azoarcus sp. (strain BH72) GN=dapE PE=3 SV=1 111 246 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6177
MAWATLLALLASSASAALASLGHDFQCDLPDPVDPDSDGLPSANQLFSSDAALKLQIERLRASVQIATVCYDDMG
NYGDDERWKPFYQLHEMLDQTYPKLHQHTKRETVNDIGLVYTIQGSDSDLKPILLLAHQDVVPVESQESEAWEHP
PFDGFYDSDGWLHGRGAVDKSSLTSIMSAFEALFAADADWKPERTMVLAFGFDEECGGLRGAPSISEHLKQRYGQ
DGIAVILDEGGAGLNTLGDTLWALPAVYEKGYLDVWFDLSVQGGPSGTPPPNTAIGIMSEIVTGLEQDPFQPSIP
RDGPIHHQLICQARYSPDAVPQLTTAIYNGDLDLAATLMANISRHTQSAVQTTRAIDYMAGGSKINSLPEYVTLG
INHRFTPQDNKYQVMHDIAHKSRQVLADHDITLVPFEDDNNYHAWVKAHGLESSRWPPSYPDHPYPGRPYPGHPP
FQPPFHPPHQRPYPRPSPDIPHWRPDYHGKLTLSTKRSFDPSPVSPTQGPVWDLFAGTLRHTLGAAHQTV*
Coding >OphauG2|6177
ATGGCCTGGGCCACGCTTCTTGCTCTGCTGGCCAGCAGCGCCAGCGCCGCCTTGGCCTCTCTTGGCCATGACTTC
CAGTGCGACTTGCCAGACCCCGTCGACCCAGACTCGGACGGCCTCCCCTCTGCCAACCAGCTCTTCTCGTCCGAC
GCGGCCCTCAAGCTCCAGATTGAGCGTCTGCGTGCCTCGGTCCAGATCGCCACCGTGTGCTACGATGACATGGGC
AACTATGGTGATGACGAGCGCTGGAAGCCCTTTTACCAGCTCCACGAGATGCTGGACCAGACGTATCCCAAGCTA
CACCAACATACCAAGCGGGAAACGGTTAATGACATCGGCCTCGTCTACACCATTCAAGGCTCCGACTCCGACCTC
AAGCCCATCCTCCTCCTGGCCCATCAGGACGTAGTCCCCGTTGAATCTCAAGAGTCCGAGGCTTGGGAACATCCC
CCCTTTGACGGCTTCTATGACTCGGACGGCTGGCTCCATGGCCGCGGCGCCGTCGACAAGTCGAGTCTGACGTCA
ATCATGTCCGCCTTTGAGGCTCTCTTCGCCGCCGACGCCGACTGGAAGCCCGAGCGAACCATGGTCTTGGCCTTT
GGCTTCGACGAGGAGTGTGGTGGCTTGCGCGGCGCCCCTTCGATTTCAGAGCACCTCAAGCAGCGCTACGGCCAA
GATGGAATTGCCGTCATCCTGGACGAGGGCGGCGCCGGACTCAACACCCTCGGCGACACCCTCTGGGCCTTGCCC
GCCGTCTACGAAAAGGGCTATCTCGACGTCTGGTTCGACCTCAGTGTCCAAGGCGGCCCCAGTGGCACGCCCCCG
CCCAACACTGCCATTGGCATCATGTCTGAAATCGTCACAGGGTTGGAACAGGATCCCTTTCAGCCCAGCATTCCT
CGCGACGGCCCCATCCATCATCAACTCATCTGCCAGGCCCGCTACTCGCCCGACGCCGTCCCCCAGCTCACAACC
GCCATCTACAACGGCGACCTCGATCTCGCCGCCACCCTCATGGCCAACATCAGCCGCCACACCCAGTCCGCCGTC
CAAACCACCCGCGCCATTGACTACATGGCCGGCGGCTCCAAAATCAACTCCCTCCCCGAATACGTCACCCTGGGC
ATAAATCACCGCTTCACGCCCCAGGACAACAAGTACCAAGTCATGCACGACATAGCCCACAAGTCTCGCCAAGTC
CTTGCAGACCATGACATTACCCTCGTGCCCTTTGAAGACGACAACAACTATCATGCATGGGTCAAGGCCCACGGC
CTCGAATCCTCGCGCTGGCCGCCGTCCTATCCCGACCATCCTTACCCAGGCCGCCCATACCCAGGCCATCCGCCT
TTCCAGCCGCCCTTTCACCCTCCCCATCAACGCCCCTATCCGCGCCCGAGCCCCGACATCCCTCATTGGCGCCCC
GACTACCACGGCAAACTCACCCTGTCCACCAAGAGAAGCTTCGACCCGTCCCCCGTTTCGCCTACACAAGGCCCC
GTCTGGGACTTGTTTGCCGGAACTCTTCGCCACACCCTTGGAGCCGCCCATCAAACAGTCTGA
Transcript >OphauG2|6177
ATGGCCTGGGCCACGCTTCTTGCTCTGCTGGCCAGCAGCGCCAGCGCCGCCTTGGCCTCTCTTGGCCATGACTTC
CAGTGCGACTTGCCAGACCCCGTCGACCCAGACTCGGACGGCCTCCCCTCTGCCAACCAGCTCTTCTCGTCCGAC
GCGGCCCTCAAGCTCCAGATTGAGCGTCTGCGTGCCTCGGTCCAGATCGCCACCGTGTGCTACGATGACATGGGC
AACTATGGTGATGACGAGCGCTGGAAGCCCTTTTACCAGCTCCACGAGATGCTGGACCAGACGTATCCCAAGCTA
CACCAACATACCAAGCGGGAAACGGTTAATGACATCGGCCTCGTCTACACCATTCAAGGCTCCGACTCCGACCTC
AAGCCCATCCTCCTCCTGGCCCATCAGGACGTAGTCCCCGTTGAATCTCAAGAGTCCGAGGCTTGGGAACATCCC
CCCTTTGACGGCTTCTATGACTCGGACGGCTGGCTCCATGGCCGCGGCGCCGTCGACAAGTCGAGTCTGACGTCA
ATCATGTCCGCCTTTGAGGCTCTCTTCGCCGCCGACGCCGACTGGAAGCCCGAGCGAACCATGGTCTTGGCCTTT
GGCTTCGACGAGGAGTGTGGTGGCTTGCGCGGCGCCCCTTCGATTTCAGAGCACCTCAAGCAGCGCTACGGCCAA
GATGGAATTGCCGTCATCCTGGACGAGGGCGGCGCCGGACTCAACACCCTCGGCGACACCCTCTGGGCCTTGCCC
GCCGTCTACGAAAAGGGCTATCTCGACGTCTGGTTCGACCTCAGTGTCCAAGGCGGCCCCAGTGGCACGCCCCCG
CCCAACACTGCCATTGGCATCATGTCTGAAATCGTCACAGGGTTGGAACAGGATCCCTTTCAGCCCAGCATTCCT
CGCGACGGCCCCATCCATCATCAACTCATCTGCCAGGCCCGCTACTCGCCCGACGCCGTCCCCCAGCTCACAACC
GCCATCTACAACGGCGACCTCGATCTCGCCGCCACCCTCATGGCCAACATCAGCCGCCACACCCAGTCCGCCGTC
CAAACCACCCGCGCCATTGACTACATGGCCGGCGGCTCCAAAATCAACTCCCTCCCCGAATACGTCACCCTGGGC
ATAAATCACCGCTTCACGCCCCAGGACAACAAGTACCAAGTCATGCACGACATAGCCCACAAGTCTCGCCAAGTC
CTTGCAGACCATGACATTACCCTCGTGCCCTTTGAAGACGACAACAACTATCATGCATGGGTCAAGGCCCACGGC
CTCGAATCCTCGCGCTGGCCGCCGTCCTATCCCGACCATCCTTACCCAGGCCGCCCATACCCAGGCCATCCGCCT
TTCCAGCCGCCCTTTCACCCTCCCCATCAACGCCCCTATCCGCGCCCGAGCCCCGACATCCCTCATTGGCGCCCC
GACTACCACGGCAAACTCACCCTGTCCACCAAGAGAAGCTTCGACCCGTCCCCCGTTTCGCCTACACAAGGCCCC
GTCTGGGACTTGTTTGCCGGAACTCTTCGCCACACCCTTGGAGCCGCCCATCAAACAGTCTGA
Gene >OphauG2|6177
ATGGCCTGGGCCACGCTTCTTGCTCTGCTGGCCAGCAGCGCCAGCGCCGCCTTGGCCTCTCTTGGCCATGACTTC
CAGTGCGACTTGCCAGACCCCGTCGACCCAGACTCGGACGGCCTCCCCTCTGCCAACCAGCTCTTCTCGTCCGAC
GCGGCCCTCAAGCTCCAGATTGAGCGTCTGCGTGCCTCGGTCCAGATCGCCACCGTGTGCTACGATGACATGGGC
AACTATGGTGATGACGAGCGCTGGAAGCCCTTTTACCAGCTCCACGAGATGCTGGACCAGACGTATCCCAAGCTG
TATGTATTTGAGCCATTTTCCTCGTCTCTTTGCTTCGTCTCTCGCCCAAAGCTAAAGTTAACCAACCCAACTACT
TGCTAGACACCAACATACCAAGCGGGAAACGGTTAATGACATCGGCCTCGTCTACACCATTCAAGGCTCCGACTC
CGACCTCAAGCCCATCCTCCTCCTGGCCCATCAGGACGTAGTCCCCGTTGAATCTCAAGAGTCCGAGGCTTGGGA
ACATCCCCCCTTTGACGGCTTCTATGACTCGGACGGCTGGCTCCATGGCCGCGGCGCCGTCGACAAGTCGAGTCT
GACGTCAATCATGTCCGCCTTTGAGGCTCTCTTCGCCGCCGACGCCGACTGGAAGCCCGAGCGAACCATGGTCTT
GGCCTTTGGCTTCGACGAGGAGTGTGGTGGCTTGCGCGGCGCCCCTTCGATTTCAGAGCACCTCAAGCAGCGCTA
CGGCCAAGATGGAATTGCCGTCATCCTGGACGAGGGCGGCGCCGGACTCAACACCCTCGGCGACACCCTCTGGGC
CTTGCCCGCCGTCTACGAAAAGGGCTATCTCGACGTCTGGTTCGACCTCAGTGTCCAAGGCGGCCCCAGTGGCAC
GCCCCCGCCCAACACTGCCATTGGCATCATGTCTGAAATCGTCACAGGGTTGGAACAGGATCCCTTTCAGCCCAG
CATTCCTCGCGACGGCCCCATCCATCATCAACTCATCTGCCAGGCCCGCTACTCGCCCGACGCCGTCCCCCAGCT
CACAACCGCCATCTACAACGGCGACCTCGATCTCGCCGCCACCCTCATGGCCAACATCAGCCGCCACACCCAGTC
CGCCGTCCAAACCACCCGCGCCATTGACTACATGGCCGGCGGCTCCAAAATCAACTCCCTCCCCGAATACGTCAC
CCTGGGCATAAATCACCGCTTCACGCCCCAGGACAACAAGTACCAAGTCATGCACGACATAGCCCACAAGTCTCG
CCAAGTCCTTGCAGACCATGACATTACCCTCGTGCCCTTTGAAGACGACAACAACTATCATGCATGGGTCAAGGC
CCACGGCCTCGAATCCTCGCGCTGGCCGCCGTCCTATCCCGACCATCCTTACCCAGGCCGCCCATACCCAGGCCA
TCCGCCTTTCCAGCCGCCCTTTCACCCTCCCCATCAACGCCCCTATCCGCGCCCGAGCCCCGACATCCCTCATTG
GCGCCCCGACTACCACGGCAAACTCACCCTGTCCACCAAGAGAAGCTTCGACCCGTCCCCCGTTTCGCCTACACA
AGGCCCCGTCTGGGACTTGTTTGCCGGAACTCTTCGCCACACCCTTGGAGCCGCCCATCAAACAGTCGTCACAGC
CCCAGCCACCATGCCCGGAAACACTGACACGAGGCATTTTATCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail