Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6175
Gene name
LocationContig_612:8109..9815
Strand+
Gene length (bp)1706
Transcript length (bp)1530
Coding sequence length (bp)1530
Protein length (aa) 510

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09362 DUF1996 Domain of unknown function (DUF1996) 1.4E-83 34 285

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999635

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3939
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6175 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1713
Ophiocordyceps camponoti-floridani Ophcf2|05319
Ophiocordyceps camponoti-rufipedis Ophun1|5818
Ophiocordyceps kimflemingae Ophio5|3770
Ophiocordyceps subramaniannii Hirsu2|784

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6175
MLYHALVASAALVAGANAFWRMECPGRVGLARMDPIMNPGEMSPHVHSIHGSSGFTESASTQDLLDGGCTSCRVS
QDKSSYWHPALYFQHDDTGSYELVPQVGGMLSYYLLYGDNITAFPPGFRMLSGTTERRSYTVGDPAQPDPPKSMW
ASLGQTKQEDLAQRALGFNCLNYDKTPEGTLYRHFLPDKAYLDANCKDGIRLETMFPSCWKGGNAIDSPNHKDHV
AFPDLVMTGTCPEGYPVRTPSLLYEVIWNTAAFKDKSGHFLFSNGDTTGYGYHSDFMMGWDPAVLQEAVDKCRNP
SGRIEDCSVFDVVDEGTATSCSLSRPLPQALARENVKGPMAKLPGKSEVPNVDGKSPQASSNPPPNLTYAPGERA
SESASPLPGQIFKEKSKSKPSFAAADIPTPSVVPPPVAPTPVVNAATPVAESPTTQALTTSVSTAGPAIENKEYY
STEWATSGTIVSKILWEAQTETVYVTESAAPIPTGVAKAVLRRHRVGNLHGHGHGRFLH*
Coding >OphauG2|6175
ATGCTCTATCACGCTCTGGTCGCGTCGGCCGCTCTGGTGGCGGGCGCAAATGCCTTTTGGCGTATGGAGTGTCCT
GGGCGCGTTGGTCTTGCACGGATGGACCCCATCATGAACCCAGGCGAGATGTCGCCTCATGTTCATTCCATTCAT
GGCTCCTCTGGCTTTACCGAGTCCGCCAGCACACAGGATCTTCTTGATGGAGGCTGCACCTCGTGCCGAGTATCG
CAGGACAAGTCGTCGTACTGGCACCCTGCTCTCTATTTTCAACACGATGATACAGGATCATATGAACTCGTCCCG
CAAGTCGGAGGCATGCTATCATACTATCTTCTATACGGAGACAACATCACTGCTTTCCCTCCTGGATTCCGCATG
CTCTCTGGTACCACGGAGCGGCGAAGCTATACGGTGGGCGATCCAGCTCAACCGGATCCCCCAAAGTCGATGTGG
GCCTCGTTGGGCCAAACCAAGCAAGAGGATCTTGCACAGCGGGCCTTGGGCTTCAACTGCCTCAATTACGACAAG
ACGCCTGAAGGTACACTGTATCGCCACTTTCTGCCAGACAAGGCCTATCTTGATGCGAACTGCAAGGATGGTATT
CGGCTGGAAACCATGTTTCCCTCTTGCTGGAAGGGAGGCAATGCCATTGACAGCCCCAACCACAAGGATCATGTG
GCGTTTCCGGATCTTGTCATGACTGGCACATGCCCCGAAGGTTATCCCGTGCGGACGCCCAGTCTTTTGTATGAA
GTTATCTGGAACACGGCTGCCTTCAAAGACAAGAGTGGCCACTTTCTCTTCTCGAATGGCGATACCACTGGCTAT
GGCTATCACTCTGATTTCATGATGGGTTGGGACCCAGCCGTGCTTCAAGAGGCTGTTGACAAGTGCAGGAACCCG
TCTGGAAGAATCGAGGATTGCTCAGTCTTTGATGTTGTCGATGAAGGGACTGCCACCAGCTGCAGCCTGTCAAGA
CCTCTTCCGCAAGCACTAGCACGCGAAAATGTCAAGGGTCCCATGGCCAAGCTACCAGGCAAGAGTGAAGTGCCC
AATGTTGATGGGAAGAGCCCTCAGGCCTCATCGAACCCGCCACCTAATCTGACGTATGCGCCTGGAGAGAGGGCT
TCTGAATCTGCATCGCCCCTCCCAGGTCAAATCTTCAAGGAGAAGTCCAAGTCGAAACCATCATTTGCGGCGGCA
GATATTCCTACCCCTTCAGTGGTGCCTCCTCCGGTCGCGCCGACGCCTGTTGTGAACGCGGCAACACCTGTTGCC
GAGAGCCCAACAACACAGGCTCTCACGACTTCTGTTTCGACAGCTGGACCCGCGATTGAAAACAAAGAGTACTAC
AGCACGGAATGGGCCACGTCTGGCACAATTGTCAGCAAGATTCTTTGGGAGGCCCAGACCGAGACTGTGTATGTG
ACGGAGTCGGCGGCTCCGATTCCAACTGGTGTTGCCAAGGCTGTATTGCGTCGGCACCGTGTCGGAAATTTGCAT
GGGCATGGCCACGGCAGGTTTTTACACTGA
Transcript >OphauG2|6175
ATGCTCTATCACGCTCTGGTCGCGTCGGCCGCTCTGGTGGCGGGCGCAAATGCCTTTTGGCGTATGGAGTGTCCT
GGGCGCGTTGGTCTTGCACGGATGGACCCCATCATGAACCCAGGCGAGATGTCGCCTCATGTTCATTCCATTCAT
GGCTCCTCTGGCTTTACCGAGTCCGCCAGCACACAGGATCTTCTTGATGGAGGCTGCACCTCGTGCCGAGTATCG
CAGGACAAGTCGTCGTACTGGCACCCTGCTCTCTATTTTCAACACGATGATACAGGATCATATGAACTCGTCCCG
CAAGTCGGAGGCATGCTATCATACTATCTTCTATACGGAGACAACATCACTGCTTTCCCTCCTGGATTCCGCATG
CTCTCTGGTACCACGGAGCGGCGAAGCTATACGGTGGGCGATCCAGCTCAACCGGATCCCCCAAAGTCGATGTGG
GCCTCGTTGGGCCAAACCAAGCAAGAGGATCTTGCACAGCGGGCCTTGGGCTTCAACTGCCTCAATTACGACAAG
ACGCCTGAAGGTACACTGTATCGCCACTTTCTGCCAGACAAGGCCTATCTTGATGCGAACTGCAAGGATGGTATT
CGGCTGGAAACCATGTTTCCCTCTTGCTGGAAGGGAGGCAATGCCATTGACAGCCCCAACCACAAGGATCATGTG
GCGTTTCCGGATCTTGTCATGACTGGCACATGCCCCGAAGGTTATCCCGTGCGGACGCCCAGTCTTTTGTATGAA
GTTATCTGGAACACGGCTGCCTTCAAAGACAAGAGTGGCCACTTTCTCTTCTCGAATGGCGATACCACTGGCTAT
GGCTATCACTCTGATTTCATGATGGGTTGGGACCCAGCCGTGCTTCAAGAGGCTGTTGACAAGTGCAGGAACCCG
TCTGGAAGAATCGAGGATTGCTCAGTCTTTGATGTTGTCGATGAAGGGACTGCCACCAGCTGCAGCCTGTCAAGA
CCTCTTCCGCAAGCACTAGCACGCGAAAATGTCAAGGGTCCCATGGCCAAGCTACCAGGCAAGAGTGAAGTGCCC
AATGTTGATGGGAAGAGCCCTCAGGCCTCATCGAACCCGCCACCTAATCTGACGTATGCGCCTGGAGAGAGGGCT
TCTGAATCTGCATCGCCCCTCCCAGGTCAAATCTTCAAGGAGAAGTCCAAGTCGAAACCATCATTTGCGGCGGCA
GATATTCCTACCCCTTCAGTGGTGCCTCCTCCGGTCGCGCCGACGCCTGTTGTGAACGCGGCAACACCTGTTGCC
GAGAGCCCAACAACACAGGCTCTCACGACTTCTGTTTCGACAGCTGGACCCGCGATTGAAAACAAAGAGTACTAC
AGCACGGAATGGGCCACGTCTGGCACAATTGTCAGCAAGATTCTTTGGGAGGCCCAGACCGAGACTGTGTATGTG
ACGGAGTCGGCGGCTCCGATTCCAACTGGTGTTGCCAAGGCTGTATTGCGTCGGCACCGTGTCGGAAATTTGCAT
GGGCATGGCCACGGCAGGTTTTTACACTGA
Gene >OphauG2|6175
ATGCTCTATCACGCTCTGGTCGCGTCGGCCGCTCTGGTGGCGGGCGCAAATGCCTTTTGGCGTATGGAGTGTCCT
GGGCGCGTTGGTCTTGCACGGATGGACCCCATCATGAACCCAGGCGAGATGTCGCCTCATGTTCATTCCATTCAT
GGCTCCTCTGGTACGTCGAAATGCTATTTTTTAGTCTCGAGTGCCATCTGATCTTGGGGAACAACAGGCTTTACC
GAGTCCGCCAGCACACAGGATCTTCTTGATGGAGGCTGCACCTCGTGCCGAGTATCGCAGGACAAGTCGTCGTAC
TGGCACCCTGCTCTCTATTTTCAACACGATGATACAGGATCATATGAACTCGTCCCGCAAGTCGGAGGCATGCTA
TCGTAAGTTGATGCGGCATGTATTGTCCTTGATGCAAGAGGCCTTTCTGACGTCTTGTTTTCAAGATACTATCTT
CTATACGGAGACAACATCACTGCTTTCCCTCCTGGATTCCGCATGCTCTCTGGTACCACGGAGCGGCGAAGCTAT
ACGGTGGGCGATCCAGCTCAACCGGATCCCCCAAAGTCGATGTGGGCCTCGTTGGGCCAAACCAAGCAAGAGGAT
CTTGCACAGCGGGCCTTGGGCTTCAACTGCCTCAATTACGACAAGACGCCTGAAGGTACACTGTATCGCCACTTT
CTGCCAGACAAGGCCTATCTTGATGCGAACTGCAAGGATGGTATTCGGCTGGAAACCATGTTTCCCTCTTGCTGG
AAGGGAGGCAATGCCATTGACAGCCCCAACCACAAGGATCATGTGGCGTTTCCGGATCTTGTCATGACTGGCACA
TGCCCCGAAGGTTATCCCGTGCGGACGCCCAGTCTTTTGTATGAAGTTATCTGGAACACGGCTGCCTTCAAAGAC
AAGAGTGGCCACTTTCTCTTCTCGAATGGCGATACCACTGGTGAGACATTTTCGCGTATAATCTCTTGAGGTTTG
CCATTTGCTAACTGGTAGCAGGCTATGGCTATCACTCTGATTTCATGATGGGTTGGGACCCAGCCGTGCTTCAAG
AGGCTGTTGACAAGTGCAGGAACCCGTCTGGAAGAATCGAGGATTGCTCAGTCTTTGATGTTGTCGATGAAGGGA
CTGCCACCAGCTGCAGCCTGTCAAGACCTCTTCCGCAAGCACTAGCACGCGAAAATGTCAAGGGTCCCATGGCCA
AGCTACCAGGCAAGAGTGAAGTGCCCAATGTTGATGGGAAGAGCCCTCAGGCCTCATCGAACCCGCCACCTAATC
TGACGTATGCGCCTGGAGAGAGGGCTTCTGAATCTGCATCGCCCCTCCCAGGTCAAATCTTCAAGGAGAAGTCCA
AGTCGAAACCATCATTTGCGGCGGCAGATATTCCTACCCCTTCAGTGGTGCCTCCTCCGGTCGCGCCGACGCCTG
TTGTGAACGCGGCAACACCTGTTGCCGAGAGCCCAACAACACAGGCTCTCACGACTTCTGTTTCGACAGCTGGAC
CCGCGATTGAAAACAAAGAGTACTACAGCACGGAATGGGCCACGTCTGGCACAATTGTCAGCAAGATTCTTTGGG
AGGCCCAGACCGAGACTGTGTATGTGACGGAGTCGGCGGCTCCGATTCCAACTGGTGTTGCCAAGGCTGTATTGC
GTCGGCACCGTGTCGGAAATTTGCATGGGCATGGCCACGGCAGGTTTTTACACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail