Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6172
Gene name
LocationContig_611:8082..9122
Strand-
Gene length (bp)1040
Transcript length (bp)984
Coding sequence length (bp)984
Protein length (aa) 328

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00096 zf-C2H2 Zinc finger, C2H2 type 1.1E-04 246 268
PF00096 zf-C2H2 Zinc finger, C2H2 type 1.2E-03 274 293
PF13894 zf-C2H2_4 C2H2-type zinc finger 8.8E-04 246 268

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12041|MET32_YEAST Transcriptional regulator MET32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET32 PE=1 SV=1 240 292 2.0E-11
sp|Q8NDX6|ZN740_HUMAN Zinc finger protein 740 OS=Homo sapiens GN=ZNF740 PE=1 SV=1 243 305 2.0E-11
sp|Q09838|PRZ1_SCHPO Transcriptional regulator prz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prz1 PE=1 SV=1 244 306 4.0E-11
sp|P18718|ZG3_XENLA Gastrula zinc finger protein xLCGF3.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 243 295 1.0E-10
sp|Q6NZQ6|ZN740_MOUSE Zinc finger protein 740 OS=Mus musculus GN=Znf740 PE=1 SV=1 243 305 1.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12041|MET32_YEAST Transcriptional regulator MET32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET32 PE=1 SV=1 240 292 2.0E-11
sp|Q8NDX6|ZN740_HUMAN Zinc finger protein 740 OS=Homo sapiens GN=ZNF740 PE=1 SV=1 243 305 2.0E-11
sp|Q09838|PRZ1_SCHPO Transcriptional regulator prz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prz1 PE=1 SV=1 244 306 4.0E-11
sp|P18718|ZG3_XENLA Gastrula zinc finger protein xLCGF3.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 243 295 1.0E-10
sp|Q6NZQ6|ZN740_MOUSE Zinc finger protein 740 OS=Mus musculus GN=Znf740 PE=1 SV=1 243 305 1.0E-10
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 243 295 1.0E-10
sp|O14258|ACE2_SCHPO Metallothionein expression activator OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ace2 PE=3 SV=1 242 298 1.0E-10
sp|Q8VCZ7|ZBT7C_MOUSE Zinc finger and BTB domain-containing protein 7C OS=Mus musculus GN=Zbtb7c PE=2 SV=1 243 298 3.0E-10
sp|A1YPR0|ZBT7C_HUMAN Zinc finger and BTB domain-containing protein 7C OS=Homo sapiens GN=ZBTB7C PE=2 SV=1 243 298 3.0E-10
sp|Q5A4H5|CRZ1_CANAL Transcriptional regulator CRZ1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRZ1 PE=1 SV=1 243 303 5.0E-10
sp|O88939|ZBT7A_MOUSE Zinc finger and BTB domain-containing protein 7A OS=Mus musculus GN=Zbtb7a PE=1 SV=2 243 298 6.0E-10
sp|O95365|ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens GN=ZBTB7A PE=1 SV=1 243 298 6.0E-10
sp|Q9QZ48|ZBT7A_RAT Zinc finger and BTB domain-containing protein 7A OS=Rattus norvegicus GN=Zbtb7a PE=1 SV=1 243 298 6.0E-10
sp|P20385|CF2_DROME Chorion transcription factor Cf2 OS=Drosophila melanogaster GN=Cf2 PE=2 SV=3 224 292 6.0E-10
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 243 326 7.0E-10
sp|Q03081|MET31_YEAST Transcriptional regulator MET31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET31 PE=1 SV=1 246 312 8.0E-10
sp|O93567|ZBT7A_CHICK Zinc finger and BTB domain-containing protein 7A OS=Gallus gallus GN=ZBTB7A PE=2 SV=1 243 298 8.0E-10
sp|Q24266|BTD_DROME Transcription factor btd OS=Drosophila melanogaster GN=btd PE=2 SV=1 227 304 9.0E-10
sp|P46974|RSF2_YEAST Respiration factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSF2 PE=1 SV=1 171 293 1.0E-09
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 244 295 1.0E-09
sp|Q9Y2X9|ZN281_HUMAN Zinc finger protein 281 OS=Homo sapiens GN=ZNF281 PE=1 SV=1 243 306 1.0E-09
sp|Q25C93|FEZF1_DANRE Fez family zinc finger protein 1 OS=Danio rerio GN=fezf1 PE=2 SV=1 243 311 1.0E-09
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 243 295 2.0E-09
sp|Q15697|ZN174_HUMAN Zinc finger protein 174 OS=Homo sapiens GN=ZNF174 PE=1 SV=1 220 295 2.0E-09
sp|Q3B7M4|ZN746_BOVIN Zinc finger protein 746 OS=Bos taurus GN=ZNF746 PE=2 SV=1 243 293 2.0E-09
sp|Q3U133|ZN746_MOUSE Zinc finger protein 746 OS=Mus musculus GN=Znf746 PE=1 SV=3 243 293 2.0E-09
sp|O95600|KLF8_HUMAN Krueppel-like factor 8 OS=Homo sapiens GN=KLF8 PE=1 SV=2 243 293 2.0E-09
sp|Q6NUN9|ZN746_HUMAN Zinc finger protein 746 OS=Homo sapiens GN=ZNF746 PE=1 SV=1 243 293 2.0E-09
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 243 292 2.0E-09
sp|Q99LI5|ZN281_MOUSE Zinc finger protein 281 OS=Mus musculus GN=Znf281 PE=1 SV=1 243 305 2.0E-09
sp|Q8TD17|ZN398_HUMAN Zinc finger protein 398 OS=Homo sapiens GN=ZNF398 PE=1 SV=1 243 292 2.0E-09
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 245 295 2.0E-09
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 243 295 3.0E-09
sp|Q04545|TDA9_YEAST Probable transcription factor TDA9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TDA9 PE=1 SV=1 236 293 3.0E-09
sp|Q8BLM0|KLF8_MOUSE Krueppel-like factor 8 OS=Mus musculus GN=Klf8 PE=2 SV=1 243 293 3.0E-09
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 242 295 3.0E-09
sp|Q9UDV7|ZN282_HUMAN Zinc finger protein 282 OS=Homo sapiens GN=ZNF282 PE=2 SV=3 241 295 3.0E-09
sp|P33749|MSN4_YEAST Zinc finger protein MSN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSN4 PE=1 SV=1 244 292 3.0E-09
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 243 295 4.0E-09
sp|Q9IAJ2|FEZF1_XENLA Fez family zinc finger protein 1 OS=Xenopus laevis GN=fezf1 PE=2 SV=1 243 311 4.0E-09
sp|A0PJY2|FEZF1_HUMAN Fez family zinc finger protein 1 OS=Homo sapiens GN=FEZF1 PE=1 SV=1 243 311 4.0E-09
sp|Q0P4W9|FEZF1_XENTR Fez family zinc finger protein 1 OS=Xenopus tropicalis GN=fezf1 PE=2 SV=1 243 311 4.0E-09
sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 PE=1 SV=2 243 292 4.0E-09
sp|Q9UL36|ZN236_HUMAN Zinc finger protein 236 OS=Homo sapiens GN=ZNF236 PE=2 SV=2 240 292 4.0E-09
sp|Q12132|USV1_YEAST Nutrient and stress factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=USV1 PE=1 SV=1 230 293 4.0E-09
sp|O62651|WT1_PIG Wilms tumor protein homolog OS=Sus scrofa GN=WT1 PE=2 SV=1 243 292 4.0E-09
sp|P49952|WT1_RAT Wilms tumor protein homolog OS=Rattus norvegicus GN=Wt1 PE=2 SV=1 243 292 4.0E-09
sp|P22561|WT1_MOUSE Wilms tumor protein homolog OS=Mus musculus GN=Wt1 PE=1 SV=1 243 292 4.0E-09
sp|Q0VDQ9|FEZF1_MOUSE Fez family zinc finger protein 1 OS=Mus musculus GN=Fezf1 PE=2 SV=1 243 311 5.0E-09
sp|P07248|ADR1_YEAST Regulatory protein ADR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADR1 PE=1 SV=2 244 311 5.0E-09
sp|Q06889|EGR3_HUMAN Early growth response protein 3 OS=Homo sapiens GN=EGR3 PE=2 SV=1 244 305 5.0E-09
sp|Q8IYN0|ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens GN=ZNF100 PE=2 SV=2 243 295 6.0E-09
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 243 295 6.0E-09
sp|Q80YP6|ZIK1_MOUSE Zinc finger protein interacting with ribonucleoprotein K OS=Mus musculus GN=Zik1 PE=1 SV=1 243 295 6.0E-09
sp|Q5T619|ZN648_HUMAN Zinc finger protein 648 OS=Homo sapiens GN=ZNF648 PE=2 SV=1 243 295 6.0E-09
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 243 292 7.0E-09
sp|P50902|WT1_ALLMI Wilms tumor protein homolog (Fragment) OS=Alligator mississippiensis GN=WT1 PE=2 SV=1 243 292 7.0E-09
sp|Q5R782|ZN148_PONAB Zinc finger protein 148 OS=Pongo abelii GN=ZNF148 PE=2 SV=1 243 321 7.0E-09
sp|Q3Y4E1|ZN148_BOVIN Zinc finger protein 148 OS=Bos taurus GN=ZNF148 PE=2 SV=1 243 321 7.0E-09
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 243 295 8.0E-09
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 243 308 8.0E-09
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 243 295 8.0E-09
sp|O14771|ZN213_HUMAN Zinc finger protein 213 OS=Homo sapiens GN=ZNF213 PE=2 SV=2 243 314 8.0E-09
sp|Q9UQR1|ZN148_HUMAN Zinc finger protein 148 OS=Homo sapiens GN=ZNF148 PE=1 SV=2 243 321 8.0E-09
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 243 295 8.0E-09
sp|Q61624|ZN148_MOUSE Zinc finger protein 148 OS=Mus musculus GN=Znf148 PE=1 SV=2 243 321 8.0E-09
sp|P43301|EGR3_RAT Early growth response protein 3 OS=Rattus norvegicus GN=Egr3 PE=2 SV=1 244 305 8.0E-09
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 243 292 8.0E-09
sp|P43300|EGR3_MOUSE Early growth response protein 3 OS=Mus musculus GN=Egr3 PE=2 SV=2 244 305 8.0E-09
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 243 295 8.0E-09
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 243 295 9.0E-09
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 243 295 9.0E-09
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 243 295 9.0E-09
sp|A6NP11|ZN716_HUMAN Zinc finger protein 716 OS=Homo sapiens GN=ZNF716 PE=2 SV=4 243 312 9.0E-09
sp|Q2VWH6|FEZF2_BOVIN Fez family zinc finger protein 2 OS=Bos taurus GN=FEZF2 PE=2 SV=2 243 311 9.0E-09
sp|Q3SWU4|ZBT44_RAT Zinc finger and BTB domain-containing protein 44 OS=Rattus norvegicus GN=Zbtb44 PE=1 SV=1 234 294 9.0E-09
sp|Q62806|ZN148_RAT Zinc finger protein 148 OS=Rattus norvegicus GN=Znf148 PE=1 SV=1 243 321 9.0E-09
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 243 295 9.0E-09
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 243 292 9.0E-09
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 230 303 9.0E-09
sp|Q8R0A2|ZBT44_MOUSE Zinc finger and BTB domain-containing protein 44 OS=Mus musculus GN=Zbtb44 PE=1 SV=2 234 294 9.0E-09
sp|Q8TBJ5|FEZF2_HUMAN Fez family zinc finger protein 2 OS=Homo sapiens GN=FEZF2 PE=2 SV=2 243 311 9.0E-09
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 243 295 9.0E-09
sp|P49953|WT1_SMIMA Wilms tumor protein homolog (Fragment) OS=Sminthopsis macroura GN=WT1 PE=2 SV=1 243 292 9.0E-09
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 243 295 9.0E-09
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 243 295 1.0E-08
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 243 295 1.0E-08
sp|Q9BYN7|ZN341_HUMAN Zinc finger protein 341 OS=Homo sapiens GN=ZNF341 PE=1 SV=2 246 295 1.0E-08
sp|Q9ESP5|FEZF2_MOUSE Fez family zinc finger protein 2 OS=Mus musculus GN=Fezf2 PE=1 SV=1 243 311 1.0E-08
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 243 295 1.0E-08
sp|Q6ZS27|ZN662_HUMAN Zinc finger protein 662 OS=Homo sapiens GN=ZNF662 PE=1 SV=1 243 321 1.0E-08
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 243 292 1.0E-08
sp|Q9WTJ4|FIZ1_MOUSE Flt3-interacting zinc finger protein 1 OS=Mus musculus GN=Fiz1 PE=1 SV=1 237 300 1.0E-08
sp|O35738|KLF12_MOUSE Krueppel-like factor 12 OS=Mus musculus GN=Klf12 PE=1 SV=2 243 293 1.0E-08
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 243 292 1.0E-08
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 243 295 1.0E-08
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 243 295 1.0E-08
sp|Q9Y4X4|KLF12_HUMAN Krueppel-like factor 12 OS=Homo sapiens GN=KLF12 PE=1 SV=2 243 293 1.0E-08
sp|O95125|ZN202_HUMAN Zinc finger protein 202 OS=Homo sapiens GN=ZNF202 PE=1 SV=4 243 295 1.0E-08
sp|P18744|ZO20_XENLA Oocyte zinc finger protein XlCOF20 (Fragment) OS=Xenopus laevis PE=3 SV=1 218 295 1.0E-08
sp|A0MS83|ZN148_DANRE Zinc finger protein 148 OS=Danio rerio GN=znf148 PE=2 SV=2 243 317 1.0E-08
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 243 295 1.0E-08
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 243 292 1.0E-08
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 243 293 1.0E-08
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 243 292 1.0E-08
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 243 295 1.0E-08
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 243 293 1.0E-08
sp|Q0P4X6|ZBT44_XENTR Zinc finger and BTB domain-containing protein 44 OS=Xenopus tropicalis GN=zbtb44 PE=2 SV=1 234 294 1.0E-08
sp|Q8NCP5|ZBT44_HUMAN Zinc finger and BTB domain-containing protein 44 OS=Homo sapiens GN=ZBTB44 PE=1 SV=1 234 294 1.0E-08
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 243 295 2.0E-08
sp|Q9UDV7|ZN282_HUMAN Zinc finger protein 282 OS=Homo sapiens GN=ZNF282 PE=2 SV=3 243 295 2.0E-08
sp|Q80YP6|ZIK1_MOUSE Zinc finger protein interacting with ribonucleoprotein K OS=Mus musculus GN=Zik1 PE=1 SV=1 243 295 2.0E-08
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 230 303 2.0E-08
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 243 293 2.0E-08
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 243 295 2.0E-08
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 243 295 2.0E-08
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 243 295 2.0E-08
sp|Q02446|SP4_HUMAN Transcription factor Sp4 OS=Homo sapiens GN=SP4 PE=1 SV=2 243 306 2.0E-08
sp|Q96NJ3|ZN285_HUMAN Zinc finger protein 285 OS=Homo sapiens GN=ZNF285 PE=2 SV=2 243 295 2.0E-08
sp|Q2TAR3|FEZF2_XENLA Fez family zinc finger protein 2 OS=Xenopus laevis GN=fezf2 PE=2 SV=1 243 311 2.0E-08
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 243 295 2.0E-08
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 243 295 2.0E-08
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 243 293 2.0E-08
sp|Q6ZNG1|ZN600_HUMAN Zinc finger protein 600 OS=Homo sapiens GN=ZNF600 PE=1 SV=2 243 295 2.0E-08
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 243 295 2.0E-08
sp|Q62445|SP4_MOUSE Transcription factor Sp4 OS=Mus musculus GN=Sp4 PE=2 SV=2 243 306 2.0E-08
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 243 295 2.0E-08
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 243 295 2.0E-08
sp|P51815|ZN75D_HUMAN Zinc finger protein 75D OS=Homo sapiens GN=ZNF75D PE=2 SV=2 243 292 2.0E-08
sp|Q68DI1|ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens GN=ZNF776 PE=1 SV=2 226 295 2.0E-08
sp|Q8TDD2|SP7_HUMAN Transcription factor Sp7 OS=Homo sapiens GN=SP7 PE=1 SV=1 227 293 2.0E-08
sp|Q28G88|FEZF2_XENTR Fez family zinc finger protein 2 OS=Xenopus tropicalis GN=fezf2 PE=2 SV=1 243 311 2.0E-08
sp|Q60980|KLF3_MOUSE Krueppel-like factor 3 OS=Mus musculus GN=Klf3 PE=1 SV=1 243 295 2.0E-08
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 218 295 2.0E-08
sp|P57682|KLF3_HUMAN Krueppel-like factor 3 OS=Homo sapiens GN=KLF3 PE=1 SV=1 243 295 2.0E-08
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 243 295 2.0E-08
sp|A6NHJ4|ZN860_HUMAN Zinc finger protein 860 OS=Homo sapiens GN=ZNF860 PE=2 SV=3 243 295 2.0E-08
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 243 295 2.0E-08
sp|Q8VI67|SP7_MOUSE Transcription factor Sp7 OS=Mus musculus GN=Sp7 PE=1 SV=1 227 293 2.0E-08
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 243 295 2.0E-08
sp|Q9ERR8|ZN319_MOUSE Zinc finger protein 319 OS=Mus musculus GN=Znf319 PE=2 SV=1 243 308 2.0E-08
sp|P18718|ZG3_XENLA Gastrula zinc finger protein xLCGF3.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 243 295 3.0E-08
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 243 295 3.0E-08
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 243 295 3.0E-08
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 243 295 3.0E-08
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 243 293 3.0E-08
sp|P85977|ZNFP_CHLAE Zinc finger protein (Fragment) OS=Chlorocebus aethiops PE=1 SV=1 243 295 3.0E-08
sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 241 295 3.0E-08
sp|Q59U10|BCR1_CANAL Biofilm and cell wall regulator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BCR1 PE=1 SV=1 236 293 3.0E-08
sp|Q2I689|PLAL1_PIG Zinc finger protein PLAGL1 OS=Sus scrofa GN=PLAGL1 PE=2 SV=1 229 292 3.0E-08
sp|Q8N7Q3|ZN676_HUMAN Zinc finger protein 676 OS=Homo sapiens GN=ZNF676 PE=2 SV=2 243 295 3.0E-08
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 243 326 3.0E-08
sp|Q3U288|ZN710_MOUSE Zinc finger protein 710 OS=Mus musculus GN=Znf710 PE=2 SV=1 244 316 3.0E-08
sp|Q5R741|ZN394_PONAB Zinc finger protein 394 OS=Pongo abelii GN=ZNF394 PE=2 SV=1 239 292 3.0E-08
sp|Q9P2F9|ZN319_HUMAN Zinc finger protein 319 OS=Homo sapiens GN=ZNF319 PE=1 SV=2 243 309 3.0E-08
sp|Q10096|YAOH_SCHPO Zinc finger protein C11D3.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.17 PE=1 SV=1 238 292 3.0E-08
sp|P53035|MIG2_YEAST Regulatory protein MIG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIG2 PE=1 SV=1 244 292 3.0E-08
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 243 311 3.0E-08
sp|Q53GI3|ZN394_HUMAN Zinc finger protein 394 OS=Homo sapiens GN=ZNF394 PE=1 SV=2 239 292 3.0E-08
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 243 295 3.0E-08
sp|Q3SY52|ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens GN=ZIK1 PE=2 SV=1 243 311 3.0E-08
sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 243 295 3.0E-08
sp|A1YG48|ZN394_PANPA Zinc finger protein 394 OS=Pan paniscus GN=ZNF394 PE=3 SV=1 239 292 3.0E-08
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 243 295 3.0E-08
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 215 295 4.0E-08
sp|Q9UM63|PLAL1_HUMAN Zinc finger protein PLAGL1 OS=Homo sapiens GN=PLAGL1 PE=1 SV=2 229 292 4.0E-08
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 243 303 4.0E-08
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 243 303 4.0E-08
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 243 295 4.0E-08
sp|P39943|MIG3_YEAST Transcription corepressor MIG3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIG3 PE=1 SV=1 235 292 4.0E-08
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 243 295 4.0E-08
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 243 295 4.0E-08
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 243 293 4.0E-08
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 243 295 4.0E-08
sp|P26632|EGR1_DANRE Early growth response protein 1 OS=Danio rerio GN=egr1 PE=2 SV=2 243 292 4.0E-08
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 243 295 4.0E-08
sp|Q29RZ4|ZNF2_BOVIN Zinc finger protein 2 OS=Bos taurus GN=ZNF2 PE=2 SV=1 243 295 4.0E-08
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 243 295 5.0E-08
sp|Q8TD17|ZN398_HUMAN Zinc finger protein 398 OS=Homo sapiens GN=ZNF398 PE=1 SV=1 243 293 5.0E-08
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 243 295 5.0E-08
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 243 295 5.0E-08
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 243 295 5.0E-08
sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 243 295 5.0E-08
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 243 295 5.0E-08
sp|Q3SY52|ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens GN=ZIK1 PE=2 SV=1 243 295 5.0E-08
sp|Q804Q5|FEZF2_DANRE Fez family zinc finger protein 2 OS=Danio rerio GN=fezf2 PE=1 SV=2 243 294 5.0E-08
sp|Q6XDT6|IKZF_MYXGL Ikaros family zinc finger protein OS=Myxine glutinosa PE=1 SV=2 243 292 5.0E-08
sp|P58334|KLF16_MOUSE Krueppel-like factor 16 OS=Mus musculus GN=Klf16 PE=1 SV=2 243 292 5.0E-08
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 243 295 5.0E-08
sp|Q9Z1D9|ZN394_MOUSE Zinc finger protein 394 OS=Mus musculus GN=Znf394 PE=2 SV=3 239 292 5.0E-08
sp|Q08876|SUHW_DROVI Protein suppressor of hairy wing OS=Drosophila virilis GN=su(Hw) PE=2 SV=1 243 292 5.0E-08
sp|A4II20|EGR1_XENTR Early growth response protein 1 OS=Xenopus tropicalis GN=egr1 PE=2 SV=2 243 292 5.0E-08
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 243 295 6.0E-08
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 243 315 6.0E-08
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 244 295 6.0E-08
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 243 295 6.0E-08
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 228 295 6.0E-08
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 243 295 6.0E-08
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 243 295 6.0E-08
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 243 295 6.0E-08
sp|Q59SN6|CRZ2_CANAL Transcriptional regulator CRZ2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRZ2 PE=2 SV=1 242 292 6.0E-08
sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens GN=ZSCAN30 PE=1 SV=1 243 295 6.0E-08
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 243 295 6.0E-08
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 243 311 6.0E-08
sp|Q5AF56|ADR1_CANAL Transcriptional regulator ADR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADR1 PE=2 SV=1 238 302 6.0E-08
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 242 295 6.0E-08
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 242 292 6.0E-08
sp|Q8N1W2|ZN710_HUMAN Zinc finger protein 710 OS=Homo sapiens GN=ZNF710 PE=2 SV=2 244 316 6.0E-08
sp|Q7Z398|ZN550_HUMAN Zinc finger protein 550 OS=Homo sapiens GN=ZNF550 PE=1 SV=2 245 295 6.0E-08
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 243 292 7.0E-08
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 243 295 7.0E-08
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 243 303 7.0E-08
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 243 303 7.0E-08
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 243 295 7.0E-08
sp|P26632|EGR1_DANRE Early growth response protein 1 OS=Danio rerio GN=egr1 PE=2 SV=2 243 295 7.0E-08
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 243 295 7.0E-08
sp|O14335|SCR1_SCHPO DNA-binding protein scr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=scr1 PE=3 SV=1 244 295 7.0E-08
sp|Q6NTY6|EGR1B_XENLA Early growth response protein 1-B OS=Xenopus laevis GN=egr1-b PE=2 SV=1 243 292 7.0E-08
sp|G3X9G7|ZN809_MOUSE Zinc finger protein 809 OS=Mus musculus GN=Zfp809 PE=2 SV=1 243 292 7.0E-08
sp|Q05159|EGR2B_DANRE Early growth response protein 2b OS=Danio rerio GN=egr2b PE=2 SV=1 244 295 7.0E-08
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 243 295 7.0E-08
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 243 295 7.0E-08
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 243 295 8.0E-08
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 243 295 8.0E-08
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 243 295 8.0E-08
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 243 295 8.0E-08
sp|Q5R7I8|ZNF19_PONAB Zinc finger protein 19 OS=Pongo abelii GN=ZNF19 PE=2 SV=1 226 295 8.0E-08
sp|Q5JT82|KLF17_HUMAN Krueppel-like factor 17 OS=Homo sapiens GN=KLF17 PE=1 SV=1 243 293 8.0E-08
sp|Q96HQ0|ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens GN=ZNF419 PE=1 SV=2 243 295 8.0E-08
sp|Q01714|SP1_RAT Transcription factor Sp1 OS=Rattus norvegicus GN=Sp1 PE=1 SV=2 243 292 8.0E-08
sp|P18146|EGR1_HUMAN Early growth response protein 1 OS=Homo sapiens GN=EGR1 PE=1 SV=1 243 295 8.0E-08
sp|Q9H7X3|ZN696_HUMAN Zinc finger protein 696 OS=Homo sapiens GN=ZNF696 PE=2 SV=2 243 295 8.0E-08
sp|P10075|GLI4_HUMAN Zinc finger protein GLI4 OS=Homo sapiens GN=GLI4 PE=1 SV=2 243 315 8.0E-08
sp|O89090|SP1_MOUSE Transcription factor Sp1 OS=Mus musculus GN=Sp1 PE=1 SV=2 243 301 8.0E-08
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 226 311 8.0E-08
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 243 295 8.0E-08
sp|Q2M3X9|ZN674_HUMAN Zinc finger protein 674 OS=Homo sapiens GN=ZNF674 PE=2 SV=1 243 295 8.0E-08
sp|P18749|ZO6_XENLA Oocyte zinc finger protein XlCOF6 (Fragment) OS=Xenopus laevis PE=3 SV=1 243 295 8.0E-08
sp|P08046|EGR1_MOUSE Early growth response protein 1 OS=Mus musculus GN=Egr1 PE=1 SV=2 243 295 8.0E-08
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 229 295 8.0E-08
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 243 292 9.0E-08
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 243 303 9.0E-08
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 243 292 9.0E-08
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 230 295 9.0E-08
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 243 295 9.0E-08
sp|Q90WR8|SP3_CHICK Transcription factor Sp3 OS=Gallus gallus GN=SP3 PE=1 SV=1 243 301 9.0E-08
sp|P18741|ZO15_XENLA Oocyte zinc finger protein XlCOF15 (Fragment) OS=Xenopus laevis PE=3 SV=1 243 295 9.0E-08
sp|Q02447|SP3_HUMAN Transcription factor Sp3 OS=Homo sapiens GN=SP3 PE=1 SV=3 243 301 9.0E-08
sp|P17023|ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens GN=ZNF19 PE=2 SV=4 226 295 9.0E-08
sp|P08154|EGR1_RAT Early growth response protein 1 OS=Rattus norvegicus GN=Egr1 PE=1 SV=2 243 295 9.0E-08
sp|Q6PDB4|ZN880_HUMAN Zinc finger protein 880 OS=Homo sapiens GN=ZNF880 PE=2 SV=2 243 295 9.0E-08
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 243 295 1.0E-07
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 243 295 1.0E-07
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 243 295 1.0E-07
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 243 292 1.0E-07
sp|O14771|ZN213_HUMAN Zinc finger protein 213 OS=Homo sapiens GN=ZNF213 PE=2 SV=2 243 317 1.0E-07
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 242 295 1.0E-07
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 242 295 1.0E-07
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 243 293 1.0E-07
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 244 295 1.0E-07
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 243 311 1.0E-07
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 243 311 1.0E-07
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 243 293 1.0E-07
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 243 295 1.0E-07
sp|Q5R741|ZN394_PONAB Zinc finger protein 394 OS=Pongo abelii GN=ZNF394 PE=2 SV=1 241 295 1.0E-07
sp|Q53GI3|ZN394_HUMAN Zinc finger protein 394 OS=Homo sapiens GN=ZNF394 PE=1 SV=2 241 295 1.0E-07
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 243 311 1.0E-07
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 243 311 1.0E-07
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 243 295 1.0E-07
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 243 295 1.0E-07
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 243 295 1.0E-07
sp|A4II20|EGR1_XENTR Early growth response protein 1 OS=Xenopus tropicalis GN=egr1 PE=2 SV=2 243 295 1.0E-07
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 243 292 1.0E-07
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 243 295 1.0E-07
sp|Q6NTY6|EGR1B_XENLA Early growth response protein 1-B OS=Xenopus laevis GN=egr1-b PE=2 SV=1 243 295 1.0E-07
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 154 292 1.0E-07
sp|Q5TC79|ZBT37_HUMAN Zinc finger and BTB domain-containing protein 37 OS=Homo sapiens GN=ZBTB37 PE=2 SV=1 228 292 1.0E-07
sp|A1YFX5|ZSCA4_PANPA Zinc finger and SCAN domain-containing protein 4 OS=Pan paniscus GN=ZSCAN4 PE=3 SV=1 241 295 1.0E-07
sp|Q8N859|ZN713_HUMAN Zinc finger protein 713 OS=Homo sapiens GN=ZNF713 PE=2 SV=1 243 292 1.0E-07
sp|Q8N859|ZN713_HUMAN Zinc finger protein 713 OS=Homo sapiens GN=ZNF713 PE=2 SV=1 218 295 1.0E-07
sp|Q8N782|ZN525_HUMAN Zinc finger protein 525 OS=Homo sapiens GN=ZNF525 PE=2 SV=2 243 322 1.0E-07
sp|Q14593|ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens GN=ZNF273 PE=1 SV=3 243 295 1.0E-07
sp|Q61751|Z354A_MOUSE Zinc finger protein 354A OS=Mus musculus GN=Znf354a PE=2 SV=2 243 295 1.0E-07
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 243 297 1.0E-07
sp|Q8NAM6|ZSCA4_HUMAN Zinc finger and SCAN domain-containing protein 4 OS=Homo sapiens GN=ZSCAN4 PE=2 SV=1 241 295 1.0E-07
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 242 292 1.0E-07
sp|O42409|GFI1B_CHICK Zinc finger protein Gfi-1b OS=Gallus gallus GN=GFI1B PE=2 SV=1 243 293 1.0E-07
sp|Q6GQH4|EGR1A_XENLA Early growth response protein 1-A OS=Xenopus laevis GN=egr1-a PE=2 SV=1 243 295 1.0E-07
sp|Q6PK81|ZN773_HUMAN Zinc finger protein 773 OS=Homo sapiens GN=ZNF773 PE=2 SV=1 243 292 1.0E-07
sp|Q6PK81|ZN773_HUMAN Zinc finger protein 773 OS=Homo sapiens GN=ZNF773 PE=2 SV=1 243 295 1.0E-07
sp|Q5EXX3|ZBT38_RAT Zinc finger and BTB domain-containing protein 38 OS=Rattus norvegicus GN=Zbtb38 PE=2 SV=1 243 295 1.0E-07
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 225 293 1.0E-07
sp|Q13106|ZN154_HUMAN Zinc finger protein 154 OS=Homo sapiens GN=ZNF154 PE=2 SV=3 244 295 1.0E-07
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 243 303 1.0E-07
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 243 295 1.0E-07
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 243 311 1.0E-07
sp|Q08427|EGR2_XENLA Early growth response protein 2 OS=Xenopus laevis GN=egr2 PE=2 SV=1 244 304 1.0E-07
sp|P0CG23|ZN853_HUMAN Zinc finger protein 853 OS=Homo sapiens GN=ZNF853 PE=2 SV=1 243 292 1.0E-07
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 243 303 1.0E-07
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 243 295 1.0E-07
sp|A1XSY8|EGR2_PIG E3 SUMO-protein ligase EGR2 OS=Sus scrofa GN=EGR2 PE=2 SV=1 244 295 1.0E-07
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 243 303 1.0E-07
sp|O70494|SP3_MOUSE Transcription factor Sp3 OS=Mus musculus GN=Sp3 PE=1 SV=2 243 301 1.0E-07
sp|P81183|IKZF2_MOUSE Zinc finger protein Helios OS=Mus musculus GN=Ikzf2 PE=1 SV=2 243 292 1.0E-07
sp|Q03267|IKZF1_MOUSE DNA-binding protein Ikaros OS=Mus musculus GN=Ikzf1 PE=1 SV=2 239 292 1.0E-07
sp|Q9UKS7|IKZF2_HUMAN Zinc finger protein Helios OS=Homo sapiens GN=IKZF2 PE=1 SV=2 243 292 1.0E-07
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 243 295 1.0E-07
sp|Q8TD94|KLF14_HUMAN Krueppel-like factor 14 OS=Homo sapiens GN=KLF14 PE=2 SV=1 243 292 1.0E-07
sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=1 SV=1 243 295 1.0E-07
sp|A2T7G6|ZSCA4_PONPY Zinc finger and SCAN domain-containing protein 4 OS=Pongo pygmaeus GN=ZSCAN4 PE=3 SV=1 241 295 1.0E-07
sp|Q8NAP3|ZBT38_HUMAN Zinc finger and BTB domain-containing protein 38 OS=Homo sapiens GN=ZBTB38 PE=1 SV=2 243 295 1.0E-07
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 243 295 1.0E-07
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 243 292 1.0E-07
sp|Q8C208|IKZF4_MOUSE Zinc finger protein Eos OS=Mus musculus GN=Ikzf4 PE=1 SV=2 243 292 1.0E-07
sp|Q9NSD4|ZN275_HUMAN Zinc finger protein 275 OS=Homo sapiens GN=ZNF275 PE=2 SV=2 243 295 1.0E-07
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 243 292 1.0E-07
sp|Q9Z0G7|ZBT22_MOUSE Zinc finger and BTB domain-containing protein 22 OS=Mus musculus GN=Zbtb22 PE=2 SV=1 244 293 1.0E-07
sp|A3KN36|ZNF19_BOVIN Zinc finger protein 19 OS=Bos taurus GN=ZNF19 PE=2 SV=1 226 292 1.0E-07
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 243 293 1.0E-07
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 243 295 2.0E-07
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 243 295 2.0E-07
sp|Q8IYN0|ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens GN=ZNF100 PE=2 SV=2 243 295 2.0E-07
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 243 293 2.0E-07
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 243 285 2.0E-07
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 243 293 2.0E-07
sp|A6NHJ4|ZN860_HUMAN Zinc finger protein 860 OS=Homo sapiens GN=ZNF860 PE=2 SV=3 229 295 2.0E-07
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 229 295 2.0E-07
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 243 295 2.0E-07
sp|P85977|ZNFP_CHLAE Zinc finger protein (Fragment) OS=Chlorocebus aethiops PE=1 SV=1 243 316 2.0E-07
sp|Q8N7Q3|ZN676_HUMAN Zinc finger protein 676 OS=Homo sapiens GN=ZNF676 PE=2 SV=2 243 295 2.0E-07
sp|Q8N7Q3|ZN676_HUMAN Zinc finger protein 676 OS=Homo sapiens GN=ZNF676 PE=2 SV=2 243 295 2.0E-07
sp|Q8N7Q3|ZN676_HUMAN Zinc finger protein 676 OS=Homo sapiens GN=ZNF676 PE=2 SV=2 243 295 2.0E-07
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 243 295 2.0E-07
sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 243 315 2.0E-07
sp|A1YG48|ZN394_PANPA Zinc finger protein 394 OS=Pan paniscus GN=ZNF394 PE=3 SV=1 241 295 2.0E-07
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 243 313 2.0E-07
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 243 311 2.0E-07
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 243 311 2.0E-07
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 243 295 2.0E-07
sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens GN=ZSCAN30 PE=1 SV=1 243 295 2.0E-07
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 243 295 2.0E-07
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 243 295 2.0E-07
sp|Q14593|ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens GN=ZNF273 PE=1 SV=3 243 295 2.0E-07
sp|Q13106|ZN154_HUMAN Zinc finger protein 154 OS=Homo sapiens GN=ZNF154 PE=2 SV=3 244 295 2.0E-07
sp|Q13106|ZN154_HUMAN Zinc finger protein 154 OS=Homo sapiens GN=ZNF154 PE=2 SV=3 244 295 2.0E-07
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 243 295 2.0E-07
sp|O43167|ZBT24_HUMAN Zinc finger and BTB domain-containing protein 24 OS=Homo sapiens GN=ZBTB24 PE=1 SV=2 243 292 2.0E-07
sp|Q9H2S9|IKZF4_HUMAN Zinc finger protein Eos OS=Homo sapiens GN=IKZF4 PE=1 SV=2 243 292 2.0E-07
sp|P08047|SP1_HUMAN Transcription factor Sp1 OS=Homo sapiens GN=SP1 PE=1 SV=3 243 301 2.0E-07
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 218 295 2.0E-07
sp|Q9QXT9|Z354B_MOUSE Zinc finger protein 354B OS=Mus musculus GN=Znf354b PE=2 SV=1 243 295 2.0E-07
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 243 292 2.0E-07
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 223 327 2.0E-07
sp|O60765|Z354A_HUMAN Zinc finger protein 354A OS=Homo sapiens GN=ZNF354A PE=2 SV=2 243 295 2.0E-07
sp|Q9UK12|ZN222_HUMAN Zinc finger protein 222 OS=Homo sapiens GN=ZNF222 PE=2 SV=2 243 295 2.0E-07
sp|P08152|EGR2_MOUSE E3 SUMO-protein ligase EGR2 OS=Mus musculus GN=Egr2 PE=1 SV=3 244 295 2.0E-07
sp|Q02526|ZFP41_MOUSE Zinc finger protein 41 OS=Mus musculus GN=Zfp41 PE=2 SV=2 243 311 2.0E-07
sp|Q19A40|KLF14_PANTR Krueppel-like factor 14 OS=Pan troglodytes GN=KLF14 PE=3 SV=1 243 292 2.0E-07
sp|Q14V87|KLF14_GORGO Krueppel-like factor 14 OS=Gorilla gorilla gorilla GN=KLF14 PE=3 SV=1 243 292 2.0E-07
sp|P51774|EGR2_RAT E3 SUMO-protein ligase EGR2 OS=Rattus norvegicus GN=Egr2 PE=2 SV=2 244 295 2.0E-07
sp|P08970|SUHW_DROME Protein suppressor of hairy wing OS=Drosophila melanogaster GN=su(Hw) PE=1 SV=2 243 292 2.0E-07
sp|Q96LW9|ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens GN=ZSCAN31 PE=1 SV=2 200 293 2.0E-07
sp|Q96LW9|ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens GN=ZSCAN31 PE=1 SV=2 243 295 2.0E-07
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 243 295 2.0E-07
sp|Q6ZMY9|ZN517_HUMAN Zinc finger protein 517 OS=Homo sapiens GN=ZNF517 PE=2 SV=2 229 292 2.0E-07
sp|O73693|EGR1_TAEGU Early growth response protein 1 (Fragment) OS=Taeniopygia guttata GN=EGR1 PE=3 SV=1 243 292 2.0E-07
sp|Q8K2R5|ZN668_MOUSE Zinc finger protein 668 OS=Mus musculus GN=Znf668 PE=2 SV=1 191 292 2.0E-07
sp|Q8N823|ZN611_HUMAN Zinc finger protein 611 OS=Homo sapiens GN=ZNF611 PE=2 SV=2 243 294 2.0E-07
sp|Q6ZSB9|ZBT49_HUMAN Zinc finger and BTB domain-containing protein 49 OS=Homo sapiens GN=ZBTB49 PE=1 SV=3 243 293 2.0E-07
sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens GN=ZNF233 PE=2 SV=3 243 295 2.0E-07
sp|Q9Y7G2|MIG1_CANAX Regulatory protein MIG1 OS=Candida albicans GN=MIG1 PE=3 SV=1 236 295 2.0E-07
sp|O15209|ZBT22_HUMAN Zinc finger and BTB domain-containing protein 22 OS=Homo sapiens GN=ZBTB22 PE=1 SV=1 244 293 2.0E-07
sp|Q5TJE2|ZBT22_CANLF Zinc finger and BTB domain-containing protein 22 OS=Canis lupus familiaris GN=ZBTB22 PE=3 SV=1 244 293 2.0E-07
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 243 295 2.0E-07
sp|Q6GQR8|ZN329_MOUSE Zinc finger protein 329 OS=Mus musculus GN=Znf329 PE=1 SV=2 243 295 2.0E-07
sp|Q80X44|ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 OS=Mus musculus GN=Zbtb24 PE=1 SV=1 243 292 2.0E-07
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 235 303 2.0E-07
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 234 303 2.0E-07
sp|Q8BI67|ZN473_MOUSE Zinc finger protein 473 homolog OS=Mus musculus GN=Znf473 PE=2 SV=1 213 295 2.0E-07
sp|P11161|EGR2_HUMAN E3 SUMO-protein ligase EGR2 OS=Homo sapiens GN=EGR2 PE=1 SV=3 244 295 2.0E-07
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 243 320 2.0E-07
sp|Q8NEM1|ZN680_HUMAN Zinc finger protein 680 OS=Homo sapiens GN=ZNF680 PE=2 SV=2 243 295 2.0E-07
sp|Q5RBY9|ZNF2_PONAB Zinc finger protein 2 OS=Pongo abelii GN=ZNF2 PE=2 SV=1 243 295 2.0E-07
sp|O70237|GFI1B_MOUSE Zinc finger protein Gfi-1b OS=Mus musculus GN=Gfi1b PE=1 SV=1 243 293 2.0E-07
sp|Q8CFA7|KLF17_MOUSE Krueppel-like factor 17 OS=Mus musculus GN=Klf17 PE=1 SV=2 214 293 2.0E-07
sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens GN=ZNF311 PE=2 SV=2 243 295 2.0E-07
sp|P41696|AZF1_YEAST Asparagine-rich zinc finger protein AZF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZF1 PE=1 SV=1 244 295 2.0E-07
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 243 289 2.0E-07
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 229 295 2.0E-07
sp|Q24732|GLAS_DROVI Protein glass OS=Drosophila virilis GN=gl PE=3 SV=1 243 295 2.0E-07
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 243 295 2.0E-07
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 242 295 2.0E-07
sp|Q9H9D4|ZN408_HUMAN Zinc finger protein 408 OS=Homo sapiens GN=ZNF408 PE=1 SV=1 244 293 2.0E-07
sp|P17032|ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens GN=ZNF37A PE=2 SV=3 243 292 2.0E-07
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 243 293 2.0E-07
sp|P13360|GLAS_DROME Protein glass OS=Drosophila melanogaster GN=gl PE=1 SV=2 243 295 2.0E-07
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 243 295 2.0E-07
sp|P24399|ZN239_MOUSE Zinc finger protein 239 OS=Mus musculus GN=Znf239 PE=2 SV=2 243 295 2.0E-07
sp|Q969J2|ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens GN=ZKSCAN4 PE=1 SV=1 243 304 2.0E-07
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 243 295 3.0E-07
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 243 295 3.0E-07
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 242 295 3.0E-07
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 242 295 3.0E-07
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 243 295 3.0E-07
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 243 293 3.0E-07
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 243 293 3.0E-07
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 243 292 3.0E-07
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 243 292 3.0E-07
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 243 292 3.0E-07
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 243 292 3.0E-07
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 243 295 3.0E-07
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 223 292 3.0E-07
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 243 292 3.0E-07
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 243 295 3.0E-07
sp|G3X9G7|ZN809_MOUSE Zinc finger protein 809 OS=Mus musculus GN=Zfp809 PE=2 SV=1 243 300 3.0E-07
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 243 311 3.0E-07
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 243 295 3.0E-07
sp|Q14593|ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens GN=ZNF273 PE=1 SV=3 243 295 3.0E-07
sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=1 SV=1 243 295 3.0E-07
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 223 327 3.0E-07
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 243 295 3.0E-07
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 243 303 3.0E-07
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 243 303 3.0E-07
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 243 295 3.0E-07
sp|O15535|ZSC9_HUMAN Zinc finger and SCAN domain-containing protein 9 OS=Homo sapiens GN=ZSCAN9 PE=1 SV=1 226 293 3.0E-07
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 243 293 3.0E-07
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 161 297 3.0E-07
sp|P18722|ZG46_XENLA Gastrula zinc finger protein XlCGF46.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 244 294 3.0E-07
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 226 295 3.0E-07
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 243 295 3.0E-07
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 228 304 3.0E-07
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 243 295 3.0E-07
sp|Q07120|GFI1_RAT Zinc finger protein Gfi-1 OS=Rattus norvegicus GN=Gfi1 PE=1 SV=1 243 293 3.0E-07
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 243 295 3.0E-07
sp|Q8IWY8|ZSC29_HUMAN Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens GN=ZSCAN29 PE=1 SV=2 241 295 3.0E-07
sp|Q8N9Z0|ZN610_HUMAN Zinc finger protein 610 OS=Homo sapiens GN=ZNF610 PE=2 SV=2 242 295 3.0E-07
sp|Q5DWN0|GFI1_CANLF Zinc finger protein Gfi-1 OS=Canis lupus familiaris GN=GFI1 PE=2 SV=1 243 293 3.0E-07
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 243 311 3.0E-07
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 243 295 3.0E-07
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 242 295 3.0E-07
sp|Q2VY69|ZN284_HUMAN Zinc finger protein 284 OS=Homo sapiens GN=ZNF284 PE=2 SV=1 243 292 3.0E-07
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 243 292 3.0E-07
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 229 295 3.0E-07
sp|Q13422|IKZF1_HUMAN DNA-binding protein Ikaros OS=Homo sapiens GN=IKZF1 PE=1 SV=1 243 292 3.0E-07
sp|Q9BSG1|ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens GN=ZNF2 PE=1 SV=4 243 295 3.0E-07
sp|Q9Z2K3|ZN394_RAT Zinc finger protein 394 OS=Rattus norvegicus GN=Znf394 PE=2 SV=1 241 292 3.0E-07
sp|Q5MYW4|ZN667_RAT Zinc finger protein 667 OS=Rattus norvegicus GN=Znf667 PE=2 SV=1 243 295 3.0E-07
sp|Q3SXZ3|ZN718_HUMAN Zinc finger protein 718 OS=Homo sapiens GN=ZNF718 PE=2 SV=1 243 322 3.0E-07
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 243 295 3.0E-07
sp|O73692|EGR1_COTJA Early growth response protein 1 (Fragment) OS=Coturnix coturnix japonica GN=EGR1 PE=3 SV=1 243 292 3.0E-07
sp|Q96SL8|FIZ1_HUMAN Flt3-interacting zinc finger protein 1 OS=Homo sapiens GN=FIZ1 PE=1 SV=2 241 300 3.0E-07
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 242 295 3.0E-07
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 243 295 3.0E-07
sp|Q9JHX2|SP5_MOUSE Transcription factor Sp5 OS=Mus musculus GN=Sp5 PE=2 SV=1 227 301 3.0E-07
sp|P70338|GFI1_MOUSE Zinc finger protein Gfi-1 OS=Mus musculus GN=Gfi1 PE=1 SV=2 243 293 3.0E-07
sp|P0CG00|ZSA5D_HUMAN Putative zinc finger and SCAN domain-containing protein 5D OS=Homo sapiens GN=ZSCAN5D PE=5 SV=1 243 293 3.0E-07
sp|Q19A41|KLF14_MOUSE Krueppel-like factor 14 OS=Mus musculus GN=Klf14 PE=2 SV=1 243 292 3.0E-07
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 243 295 3.0E-07
sp|Q5VV52|ZN691_HUMAN Zinc finger protein 691 OS=Homo sapiens GN=ZNF691 PE=1 SV=1 242 295 3.0E-07
sp|Q2TL60|ZN667_MOUSE Zinc finger protein 667 OS=Mus musculus GN=Znf667 PE=2 SV=1 243 295 3.0E-07
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 243 289 3.0E-07
sp|Q9VI93|RN_DROME Zinc finger protein rotund OS=Drosophila melanogaster GN=rn PE=1 SV=2 244 292 3.0E-07
sp|Q5VTD9|GFI1B_HUMAN Zinc finger protein Gfi-1b OS=Homo sapiens GN=GFI1B PE=1 SV=1 243 293 3.0E-07
sp|Q6BEB4|SP5_HUMAN Transcription factor Sp5 OS=Homo sapiens GN=SP5 PE=2 SV=1 227 301 3.0E-07
sp|Q9BRR0|ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens GN=ZKSCAN3 PE=1 SV=2 243 295 3.0E-07
sp|Q49A33|Z876P_HUMAN Putative zinc finger protein 876 OS=Homo sapiens GN=ZNF876P PE=5 SV=3 230 295 3.0E-07
sp|P18718|ZG3_XENLA Gastrula zinc finger protein xLCGF3.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 243 295 4.0E-07
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 226 295 4.0E-07
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 243 295 4.0E-07
sp|O95125|ZN202_HUMAN Zinc finger protein 202 OS=Homo sapiens GN=ZNF202 PE=1 SV=4 242 292 4.0E-07
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 243 292 4.0E-07
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 243 311 4.0E-07
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 243 292 4.0E-07
sp|Q6ZNG1|ZN600_HUMAN Zinc finger protein 600 OS=Homo sapiens GN=ZNF600 PE=1 SV=2 243 295 4.0E-07
sp|Q6ZNG1|ZN600_HUMAN Zinc finger protein 600 OS=Homo sapiens GN=ZNF600 PE=1 SV=2 242 295 4.0E-07
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 243 303 4.0E-07
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 243 295 4.0E-07
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 244 295 4.0E-07
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 226 295 4.0E-07
sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens GN=ZNF233 PE=2 SV=3 243 295 4.0E-07
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 243 295 4.0E-07
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 243 292 4.0E-07
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 243 295 4.0E-07
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 243 295 4.0E-07
sp|O42410|IKZF1_CHICK DNA-binding protein Ikaros OS=Gallus gallus GN=IKZF1 PE=2 SV=1 243 292 4.0E-07
sp|Q9UK13|ZN221_HUMAN Zinc finger protein 221 OS=Homo sapiens GN=ZNF221 PE=2 SV=3 243 315 4.0E-07
sp|Q6DCW1|GFI1B_XENLA Zinc finger protein Gfi-1b OS=Xenopus laevis GN=gfi1b PE=2 SV=1 243 293 4.0E-07
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 243 295 4.0E-07
sp|Q99684|GFI1_HUMAN Zinc finger protein Gfi-1 OS=Homo sapiens GN=GFI1 PE=1 SV=2 243 293 4.0E-07
sp|Q3B725|ZBT24_RAT Zinc finger and BTB domain-containing protein 24 OS=Rattus norvegicus GN=Zbtb24 PE=2 SV=1 243 292 4.0E-07
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 243 295 4.0E-07
sp|P07247|KRUP_DROME Protein krueppel OS=Drosophila melanogaster GN=Kr PE=1 SV=2 243 295 4.0E-07
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 243 295 4.0E-07
sp|Q17QR7|ZN691_BOVIN Zinc finger protein 691 OS=Bos taurus GN=ZNF691 PE=2 SV=1 242 295 4.0E-07
sp|Q96LW1|Z354B_HUMAN Zinc finger protein 354B OS=Homo sapiens GN=ZNF354B PE=2 SV=1 243 295 4.0E-07
sp|Q9H707|ZN552_HUMAN Zinc finger protein 552 OS=Homo sapiens GN=ZNF552 PE=1 SV=2 243 295 4.0E-07
sp|Q8TF39|ZN483_HUMAN Zinc finger protein 483 OS=Homo sapiens GN=ZNF483 PE=1 SV=3 243 292 4.0E-07
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 243 292 4.0E-07
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 243 295 4.0E-07
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 243 295 4.0E-07
sp|Q8N7M2|ZN283_HUMAN Zinc finger protein 283 OS=Homo sapiens GN=ZNF283 PE=2 SV=4 243 295 4.0E-07
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 210 295 4.0E-07
sp|C7EMF5|KLF17_PIG Krueppel-like factor 17 OS=Sus scrofa GN=KLF17 PE=2 SV=1 243 293 4.0E-07
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 243 295 4.0E-07
sp|Q8NCN2|ZBT34_HUMAN Zinc finger and BTB domain-containing protein 34 OS=Homo sapiens GN=ZBTB34 PE=2 SV=4 248 292 4.0E-07
sp|Q9UTS5|ZAS1_SCHPO Zinc finger protein zas1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zas1 PE=2 SV=1 246 292 4.0E-07
sp|A2RRD8|ZN320_HUMAN Zinc finger protein 320 OS=Homo sapiens GN=ZNF320 PE=1 SV=1 242 295 4.0E-07
sp|Q6ZR52|ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens GN=ZNF493 PE=2 SV=3 243 295 4.0E-07
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 243 306 4.0E-07
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 243 295 5.0E-07
sp|Q5A4H5|CRZ1_CANAL Transcriptional regulator CRZ1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRZ1 PE=1 SV=1 246 306 5.0E-07
sp|Q9Y2X9|ZN281_HUMAN Zinc finger protein 281 OS=Homo sapiens GN=ZNF281 PE=1 SV=1 243 293 5.0E-07
sp|Q99LI5|ZN281_MOUSE Zinc finger protein 281 OS=Mus musculus GN=Znf281 PE=1 SV=1 243 293 5.0E-07
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 243 295 5.0E-07
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 243 292 5.0E-07
sp|Q3U288|ZN710_MOUSE Zinc finger protein 710 OS=Mus musculus GN=Znf710 PE=2 SV=1 241 295 5.0E-07
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 243 303 5.0E-07
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 243 295 5.0E-07
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 243 292 5.0E-07
sp|Q8N1W2|ZN710_HUMAN Zinc finger protein 710 OS=Homo sapiens GN=ZNF710 PE=2 SV=2 241 295 5.0E-07
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 176 295 5.0E-07
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 243 295 5.0E-07
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 243 295 5.0E-07
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 243 295 5.0E-07
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 243 295 5.0E-07
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 243 295 5.0E-07
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 243 303 5.0E-07
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 161 297 5.0E-07
sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens GN=ZNF311 PE=2 SV=2 243 295 5.0E-07
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 243 295 5.0E-07
sp|Q9GL32|EGR4_BOVIN Early growth response protein 4 OS=Bos taurus GN=EGR4 PE=2 SV=1 244 295 5.0E-07
sp|Q96NG5|ZN558_HUMAN Zinc finger protein 558 OS=Homo sapiens GN=ZNF558 PE=2 SV=1 243 292 5.0E-07
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 243 293 5.0E-07
sp|Q7Z7K2|ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens GN=ZNF467 PE=2 SV=1 244 297 5.0E-07
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 243 295 5.0E-07
sp|Q9UPG8|PLAL2_HUMAN Zinc finger protein PLAGL2 OS=Homo sapiens GN=PLAGL2 PE=2 SV=1 233 292 5.0E-07
sp|Q8IYX0|ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens GN=ZNF679 PE=1 SV=2 243 295 5.0E-07
sp|Q8BIQ3|ZNF2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Znf2 PE=2 SV=1 243 295 5.0E-07
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 242 295 5.0E-07
sp|P33748|MSN2_YEAST Zinc finger protein MSN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSN2 PE=1 SV=1 236 292 5.0E-07
sp|Q9WUF2|EGR4_MOUSE Early growth response protein 4 OS=Mus musculus GN=Egr4 PE=3 SV=1 244 295 5.0E-07
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 226 295 5.0E-07
sp|Q4R3I5|ZN668_MACFA Zinc finger protein 668 OS=Macaca fascicularis GN=ZNF668 PE=2 SV=1 243 295 5.0E-07
sp|Q00911|EGR4_RAT Early growth response protein 4 OS=Rattus norvegicus GN=Egr4 PE=2 SV=1 244 295 5.0E-07
sp|P17019|ZN708_HUMAN Zinc finger protein 708 OS=Homo sapiens GN=ZNF708 PE=1 SV=5 243 295 5.0E-07
sp|A2VDW9|IKZF3_BOVIN Zinc finger protein Aiolos OS=Bos taurus GN=IKZF3 PE=2 SV=1 243 292 5.0E-07
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 243 295 5.0E-07
sp|O13089|IKZF1_ONCMY DNA-binding protein Ikaros OS=Oncorhynchus mykiss GN=ikzf1 PE=2 SV=1 243 292 5.0E-07
sp|O73691|EGR1_CHICK Early growth response protein 1 (Fragment) OS=Gallus gallus GN=EGR1 PE=3 SV=1 243 292 5.0E-07
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 243 295 5.0E-07
sp|P0CB33|ZN735_HUMAN Putative zinc finger protein 735 OS=Homo sapiens GN=ZNF735 PE=5 SV=1 243 295 5.0E-07
sp|P23803|ODD_DROME Protein odd-skipped OS=Drosophila melanogaster GN=odd PE=2 SV=3 226 294 5.0E-07
sp|E7ETH6|Z587B_HUMAN Zinc finger protein 587B OS=Homo sapiens GN=ZNF587B PE=1 SV=1 245 292 5.0E-07
sp|Q6AZW8|ZN660_HUMAN Zinc finger protein 660 OS=Homo sapiens GN=ZNF660 PE=1 SV=1 243 292 5.0E-07
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 243 295 5.0E-07
sp|Q9BUG6|ZSA5A_HUMAN Zinc finger and SCAN domain-containing protein 5A OS=Homo sapiens GN=ZSCAN5A PE=2 SV=1 243 292 5.0E-07
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 243 295 5.0E-07
sp|Q9UKT9|IKZF3_HUMAN Zinc finger protein Aiolos OS=Homo sapiens GN=IKZF3 PE=1 SV=2 243 292 5.0E-07
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 243 295 6.0E-07
sp|Q8TD17|ZN398_HUMAN Zinc finger protein 398 OS=Homo sapiens GN=ZNF398 PE=1 SV=1 243 295 6.0E-07
sp|Q06889|EGR3_HUMAN Early growth response protein 3 OS=Homo sapiens GN=EGR3 PE=2 SV=1 243 292 6.0E-07
sp|P43301|EGR3_RAT Early growth response protein 3 OS=Rattus norvegicus GN=Egr3 PE=2 SV=1 243 292 6.0E-07
sp|P43300|EGR3_MOUSE Early growth response protein 3 OS=Mus musculus GN=Egr3 PE=2 SV=2 243 292 6.0E-07
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 243 311 6.0E-07
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 243 293 6.0E-07
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 242 292 6.0E-07
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 243 295 6.0E-07
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 226 303 6.0E-07
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 243 311 6.0E-07
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 243 295 6.0E-07
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 244 295 6.0E-07
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 243 295 6.0E-07
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 243 295 6.0E-07
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 243 295 6.0E-07
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 243 292 6.0E-07
sp|Q6ZMY9|ZN517_HUMAN Zinc finger protein 517 OS=Homo sapiens GN=ZNF517 PE=2 SV=2 243 292 6.0E-07
sp|P11161|EGR2_HUMAN E3 SUMO-protein ligase EGR2 OS=Homo sapiens GN=EGR2 PE=1 SV=3 243 292 6.0E-07
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 243 295 6.0E-07
sp|Q9BSG1|ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens GN=ZNF2 PE=1 SV=4 235 292 6.0E-07
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 244 295 6.0E-07
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 243 295 6.0E-07
sp|A2RRD8|ZN320_HUMAN Zinc finger protein 320 OS=Homo sapiens GN=ZNF320 PE=1 SV=1 243 295 6.0E-07
sp|Q6ZR52|ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens GN=ZNF493 PE=2 SV=3 226 295 6.0E-07
sp|P49910|ZN165_HUMAN Zinc finger protein 165 OS=Homo sapiens GN=ZNF165 PE=1 SV=1 228 295 6.0E-07
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 243 295 6.0E-07
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 243 295 6.0E-07
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 243 295 6.0E-07
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 243 295 6.0E-07
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 244 295 6.0E-07
sp|Q91VN1|ZNF24_MOUSE Zinc finger protein 24 OS=Mus musculus GN=Znf24 PE=1 SV=1 243 292 6.0E-07
sp|Q2TA17|ZN668_BOVIN Zinc finger protein 668 OS=Bos taurus GN=ZNF668 PE=2 SV=2 243 295 6.0E-07
sp|Q6ZMV8|ZN730_HUMAN Putative zinc finger protein 730 OS=Homo sapiens GN=ZNF730 PE=2 SV=1 243 295 6.0E-07
sp|Q9W747|DRL_DANRE Zinc finger protein draculin OS=Danio rerio GN=drl PE=2 SV=2 244 295 6.0E-07
sp|Q9Y2P7|ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens GN=ZNF256 PE=1 SV=2 243 311 6.0E-07
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 243 295 6.0E-07
sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 243 295 6.0E-07
sp|Q5R782|ZN148_PONAB Zinc finger protein 148 OS=Pongo abelii GN=ZNF148 PE=2 SV=1 243 293 7.0E-07
sp|Q9UQR1|ZN148_HUMAN Zinc finger protein 148 OS=Homo sapiens GN=ZNF148 PE=1 SV=2 243 293 7.0E-07
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 243 295 7.0E-07
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 243 295 7.0E-07
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 243 295 7.0E-07
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 243 303 7.0E-07
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 243 293 7.0E-07
sp|P18744|ZO20_XENLA Oocyte zinc finger protein XlCOF20 (Fragment) OS=Xenopus laevis PE=3 SV=1 243 295 7.0E-07
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 243 292 7.0E-07
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 243 311 7.0E-07
sp|Q3SY52|ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens GN=ZIK1 PE=2 SV=1 243 311 7.0E-07
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 223 292 7.0E-07
sp|Q08427|EGR2_XENLA Early growth response protein 2 OS=Xenopus laevis GN=egr2 PE=2 SV=1 243 292 7.0E-07
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 243 295 7.0E-07
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 245 293 7.0E-07
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 243 295 7.0E-07
sp|Q8N7M2|ZN283_HUMAN Zinc finger protein 283 OS=Homo sapiens GN=ZNF283 PE=2 SV=4 243 295 7.0E-07
sp|Q8N7M2|ZN283_HUMAN Zinc finger protein 283 OS=Homo sapiens GN=ZNF283 PE=2 SV=4 243 295 7.0E-07
sp|Q8IYX0|ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens GN=ZNF679 PE=1 SV=2 243 295 7.0E-07
sp|P17019|ZN708_HUMAN Zinc finger protein 708 OS=Homo sapiens GN=ZNF708 PE=1 SV=5 219 295 7.0E-07
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 243 295 7.0E-07
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 242 292 7.0E-07
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 243 292 7.0E-07
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 243 295 7.0E-07
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 243 295 7.0E-07
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 243 295 7.0E-07
sp|Q96K58|ZN668_HUMAN Zinc finger protein 668 OS=Homo sapiens GN=ZNF668 PE=1 SV=3 243 295 7.0E-07
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 243 292 7.0E-07
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 243 295 7.0E-07
sp|Q92010|ZBT14_CHICK Zinc finger and BTB domain-containing protein 14 OS=Gallus gallus GN=ZBTB14 PE=2 SV=1 242 295 7.0E-07
sp|P18750|ZO61_XENLA Oocyte zinc finger protein XlCOF6.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 243 293 7.0E-07
sp|Q02975|Z354A_RAT Zinc finger protein 354A OS=Rattus norvegicus GN=Znf354a PE=2 SV=1 243 295 7.0E-07
sp|Q02975|Z354A_RAT Zinc finger protein 354A OS=Rattus norvegicus GN=Znf354a PE=2 SV=1 243 311 7.0E-07
sp|Q08376|ZBT14_MOUSE Zinc finger and BTB domain-containing protein 14 OS=Mus musculus GN=Zbtb14 PE=2 SV=1 242 295 7.0E-07
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 243 295 7.0E-07
sp|P21192|ACE2_YEAST Metallothionein expression activator OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACE2 PE=1 SV=1 243 298 7.0E-07
sp|A1YGJ4|ZNF24_PANPA Zinc finger protein 24 OS=Pan paniscus GN=ZNF24 PE=3 SV=1 243 292 7.0E-07
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 243 324 7.0E-07
sp|O43829|ZBT14_HUMAN Zinc finger and BTB domain-containing protein 14 OS=Homo sapiens GN=ZBTB14 PE=1 SV=2 242 295 7.0E-07
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 243 295 7.0E-07
sp|Q9NQX1|PRDM5_HUMAN PR domain zinc finger protein 5 OS=Homo sapiens GN=PRDM5 PE=1 SV=2 243 294 7.0E-07
sp|P27705|MIG1_YEAST Regulatory protein MIG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIG1 PE=1 SV=1 237 309 7.0E-07
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 243 295 7.0E-07
sp|O08900|IKZF3_MOUSE Zinc finger protein Aiolos OS=Mus musculus GN=Ikzf3 PE=1 SV=2 243 292 7.0E-07
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 243 295 8.0E-07
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 215 295 8.0E-07
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 243 297 8.0E-07
sp|Q3Y4E1|ZN148_BOVIN Zinc finger protein 148 OS=Bos taurus GN=ZNF148 PE=2 SV=1 243 293 8.0E-07
sp|Q61624|ZN148_MOUSE Zinc finger protein 148 OS=Mus musculus GN=Znf148 PE=1 SV=2 243 293 8.0E-07
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 243 293 8.0E-07
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 243 295 8.0E-07
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 243 295 8.0E-07
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 243 295 8.0E-07
sp|Q05159|EGR2B_DANRE Early growth response protein 2b OS=Danio rerio GN=egr2b PE=2 SV=1 243 292 8.0E-07
sp|Q96HQ0|ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens GN=ZNF419 PE=1 SV=2 243 295 8.0E-07
sp|Q13106|ZN154_HUMAN Zinc finger protein 154 OS=Homo sapiens GN=ZNF154 PE=2 SV=3 243 295 8.0E-07
sp|O43167|ZBT24_HUMAN Zinc finger and BTB domain-containing protein 24 OS=Homo sapiens GN=ZBTB24 PE=1 SV=2 243 295 8.0E-07
sp|Q8N823|ZN611_HUMAN Zinc finger protein 611 OS=Homo sapiens GN=ZNF611 PE=2 SV=2 207 295 8.0E-07
sp|Q2TL60|ZN667_MOUSE Zinc finger protein 667 OS=Mus musculus GN=Znf667 PE=2 SV=1 243 295 8.0E-07
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 243 295 8.0E-07
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 243 295 8.0E-07
sp|Q7Z7K2|ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens GN=ZNF467 PE=2 SV=1 243 295 8.0E-07
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 243 295 8.0E-07
sp|Q9N658|GFI1_DROME Zinc finger protein sens OS=Drosophila melanogaster GN=sens PE=1 SV=1 243 293 8.0E-07
sp|Q9Y2Q1|ZN257_HUMAN Zinc finger protein 257 OS=Homo sapiens GN=ZNF257 PE=2 SV=2 243 295 8.0E-07
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 243 295 8.0E-07
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 243 295 8.0E-07
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 243 295 8.0E-07
sp|Q7TNK3|ZNF24_RAT Zinc finger protein 24 OS=Rattus norvegicus GN=Znf24 PE=2 SV=1 243 292 8.0E-07
sp|Q13398|ZN211_HUMAN Zinc finger protein 211 OS=Homo sapiens GN=ZNF211 PE=2 SV=2 243 295 8.0E-07
sp|Q13398|ZN211_HUMAN Zinc finger protein 211 OS=Homo sapiens GN=ZNF211 PE=2 SV=2 243 295 8.0E-07
sp|Q05215|EGR4_HUMAN Early growth response protein 4 OS=Homo sapiens GN=EGR4 PE=2 SV=3 244 295 8.0E-07
sp|A6NJL1|ZSA5B_HUMAN Zinc finger and SCAN domain-containing protein 5B OS=Homo sapiens GN=ZSCAN5B PE=3 SV=1 243 292 8.0E-07
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 243 292 8.0E-07
sp|A2T7D7|ZNF24_PANTR Zinc finger protein 24 OS=Pan troglodytes GN=ZNF24 PE=3 SV=1 243 292 8.0E-07
sp|P18724|ZG49_XENLA Gastrula zinc finger protein XlCGF49.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 243 295 8.0E-07
sp|P17028|ZNF24_HUMAN Zinc finger protein 24 OS=Homo sapiens GN=ZNF24 PE=1 SV=4 243 292 8.0E-07
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 209 292 8.0E-07
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 226 295 8.0E-07
sp|Q5RAE6|ZNF24_PONAB Zinc finger protein 24 OS=Pongo abelii GN=ZNF24 PE=2 SV=1 243 292 8.0E-07
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 243 295 8.0E-07
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 242 295 8.0E-07
sp|Q8IXZ3|SP8_HUMAN Transcription factor Sp8 OS=Homo sapiens GN=SP8 PE=2 SV=3 227 292 8.0E-07
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 243 295 9.0E-07
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 244 292 9.0E-07
sp|Q62806|ZN148_RAT Zinc finger protein 148 OS=Rattus norvegicus GN=Znf148 PE=1 SV=1 243 293 9.0E-07
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 243 295 9.0E-07
sp|P18744|ZO20_XENLA Oocyte zinc finger protein XlCOF20 (Fragment) OS=Xenopus laevis PE=3 SV=1 243 295 9.0E-07
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 243 295 9.0E-07
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 243 305 9.0E-07
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 243 295 9.0E-07
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 243 293 9.0E-07
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 243 295 9.0E-07
sp|Q8K2R5|ZN668_MOUSE Zinc finger protein 668 OS=Mus musculus GN=Znf668 PE=2 SV=1 243 292 9.0E-07
sp|Q80X44|ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 OS=Mus musculus GN=Zbtb24 PE=1 SV=1 243 295 9.0E-07
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 244 295 9.0E-07
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 243 295 9.0E-07
sp|Q6ZMV8|ZN730_HUMAN Putative zinc finger protein 730 OS=Homo sapiens GN=ZNF730 PE=2 SV=1 243 295 9.0E-07
sp|Q9Y2P7|ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens GN=ZNF256 PE=1 SV=2 243 295 9.0E-07
sp|Q9UNY5|ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens GN=ZNF232 PE=1 SV=1 243 295 9.0E-07
sp|Q95K52|ZN283_MACFA Zinc finger protein 283 OS=Macaca fascicularis GN=ZNF283 PE=2 SV=1 243 295 9.0E-07
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 243 297 9.0E-07
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 239 292 9.0E-07
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 243 295 9.0E-07
sp|P78871|RST2_SCHPO Zinc finger protein rst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rst2 PE=2 SV=2 241 293 9.0E-07
sp|P52738|ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens GN=ZNF140 PE=2 SV=2 243 294 9.0E-07
sp|Q9NXT0|ZN586_HUMAN Zinc finger protein 586 OS=Homo sapiens GN=ZNF586 PE=2 SV=2 243 295 9.0E-07
sp|Q12901|ZN155_HUMAN Zinc finger protein 155 OS=Homo sapiens GN=ZNF155 PE=1 SV=4 243 295 9.0E-07
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 226 295 9.0E-07
sp|Q96BR6|ZN669_HUMAN Zinc finger protein 669 OS=Homo sapiens GN=ZNF669 PE=2 SV=2 243 313 9.0E-07
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 243 295 9.0E-07
sp|Q3TDE8|ZN691_MOUSE Zinc finger protein 691 OS=Mus musculus GN=Znf691 PE=2 SV=1 243 292 9.0E-07
sp|Q9Z0Z7|KLF5_MOUSE Krueppel-like factor 5 OS=Mus musculus GN=Klf5 PE=2 SV=2 243 292 9.0E-07
sp|Q9EPW2|KLF15_MOUSE Krueppel-like factor 15 OS=Mus musculus GN=Klf15 PE=1 SV=1 243 295 9.0E-07
sp|Q9UIH9|KLF15_HUMAN Krueppel-like factor 15 OS=Homo sapiens GN=KLF15 PE=1 SV=1 243 295 9.0E-07
sp|Q8BMJ8|SP8_MOUSE Transcription factor Sp8 OS=Mus musculus GN=Sp8 PE=2 SV=1 227 292 9.0E-07
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 243 295 1.0E-06
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 243 295 1.0E-06
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 243 293 1.0E-06
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 243 293 1.0E-06
sp|Q80YP6|ZIK1_MOUSE Zinc finger protein interacting with ribonucleoprotein K OS=Mus musculus GN=Zik1 PE=1 SV=1 244 295 1.0E-06
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 244 292 1.0E-06
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 243 295 1.0E-06
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 226 295 1.0E-06
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 242 292 1.0E-06
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 243 295 1.0E-06
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 243 295 1.0E-06
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 242 292 1.0E-06
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 243 295 1.0E-06
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 243 295 1.0E-06
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 242 292 1.0E-06
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 243 295 1.0E-06
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 243 295 1.0E-06
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 243 295 1.0E-06
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 242 292 1.0E-06
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 243 295 1.0E-06
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 243 303 1.0E-06
sp|Q9BYN7|ZN341_HUMAN Zinc finger protein 341 OS=Homo sapiens GN=ZNF341 PE=1 SV=2 243 294 1.0E-06
sp|A0MS83|ZN148_DANRE Zinc finger protein 148 OS=Danio rerio GN=znf148 PE=2 SV=2 243 293 1.0E-06
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 243 311 1.0E-06
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 243 293 1.0E-06
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 243 295 1.0E-06
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 243 311 1.0E-06
sp|Q68DI1|ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens GN=ZNF776 PE=1 SV=2 243 295 1.0E-06
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 243 295 1.0E-06
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 243 295 1.0E-06
sp|P85977|ZNFP_CHLAE Zinc finger protein (Fragment) OS=Chlorocebus aethiops PE=1 SV=1 243 292 1.0E-06
sp|Q8N7Q3|ZN676_HUMAN Zinc finger protein 676 OS=Homo sapiens GN=ZNF676 PE=2 SV=2 243 295 1.0E-06
sp|Q3U288|ZN710_MOUSE Zinc finger protein 710 OS=Mus musculus GN=Znf710 PE=2 SV=1 244 295 1.0E-06
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 243 295 1.0E-06
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 243 303 1.0E-06
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 243 295 1.0E-06
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 243 295 1.0E-06
sp|Q29RZ4|ZNF2_BOVIN Zinc finger protein 2 OS=Bos taurus GN=ZNF2 PE=2 SV=1 235 292 1.0E-06
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 243 295 1.0E-06
sp|Q9Z1D9|ZN394_MOUSE Zinc finger protein 394 OS=Mus musculus GN=Znf394 PE=2 SV=3 243 292 1.0E-06
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 243 295 1.0E-06
sp|Q8N1W2|ZN710_HUMAN Zinc finger protein 710 OS=Homo sapiens GN=ZNF710 PE=2 SV=2 244 295 1.0E-06
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 243 295 1.0E-06
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 243 295 1.0E-06
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 243 295 1.0E-06
sp|P18749|ZO6_XENLA Oocyte zinc finger protein XlCOF6 (Fragment) OS=Xenopus laevis PE=3 SV=1 220 292 1.0E-06
sp|Q14593|ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens GN=ZNF273 PE=1 SV=3 243 311 1.0E-06
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 234 293 1.0E-06
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 243 293 1.0E-06
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 243 295 1.0E-06
sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=1 SV=1 243 295 1.0E-06
sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=1 SV=1 243 295 1.0E-06
sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=1 SV=1 243 293 1.0E-06
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 243 307 1.0E-06
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 243 295 1.0E-06
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 243 295 1.0E-06
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 243 295 1.0E-06
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 243 327 1.0E-06
sp|O60765|Z354A_HUMAN Zinc finger protein 354A OS=Homo sapiens GN=ZNF354A PE=2 SV=2 243 311 1.0E-06
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 243 303 1.0E-06
sp|Q5RBY9|ZNF2_PONAB Zinc finger protein 2 OS=Pongo abelii GN=ZNF2 PE=2 SV=1 235 292 1.0E-06
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 242 295 1.0E-06
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 243 295 1.0E-06
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 243 292 1.0E-06
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 242 295 1.0E-06
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 243 293 1.0E-06
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 243 295 1.0E-06
sp|Q3B725|ZBT24_RAT Zinc finger and BTB domain-containing protein 24 OS=Rattus norvegicus GN=Zbtb24 PE=2 SV=1 243 295 1.0E-06
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 243 295 1.0E-06
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 243 292 1.0E-06
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 243 292 1.0E-06
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 243 295 1.0E-06
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 243 295 1.0E-06
sp|Q8BIQ3|ZNF2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Znf2 PE=2 SV=1 235 292 1.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 243 293 1.0E-06
sp|P17019|ZN708_HUMAN Zinc finger protein 708 OS=Homo sapiens GN=ZNF708 PE=1 SV=5 206 295 1.0E-06
sp|P17019|ZN708_HUMAN Zinc finger protein 708 OS=Homo sapiens GN=ZNF708 PE=1 SV=5 243 295 1.0E-06
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 243 307 1.0E-06
sp|P23803|ODD_DROME Protein odd-skipped OS=Drosophila melanogaster GN=odd PE=2 SV=3 199 295 1.0E-06
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 243 295 1.0E-06
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 234 295 1.0E-06
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 243 295 1.0E-06
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 243 292 1.0E-06
sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 243 295 1.0E-06
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 243 292 1.0E-06
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 243 295 1.0E-06
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 243 295 1.0E-06
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 243 295 1.0E-06
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 243 295 1.0E-06
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 243 295 1.0E-06
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 243 295 1.0E-06
sp|Q9N658|GFI1_DROME Zinc finger protein sens OS=Drosophila melanogaster GN=sens PE=1 SV=1 238 295 1.0E-06
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 243 295 1.0E-06
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 243 295 1.0E-06
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 243 311 1.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 243 293 1.0E-06
sp|Q95K52|ZN283_MACFA Zinc finger protein 283 OS=Macaca fascicularis GN=ZNF283 PE=2 SV=1 243 295 1.0E-06
sp|Q95K52|ZN283_MACFA Zinc finger protein 283 OS=Macaca fascicularis GN=ZNF283 PE=2 SV=1 243 295 1.0E-06
sp|Q12901|ZN155_HUMAN Zinc finger protein 155 OS=Homo sapiens GN=ZNF155 PE=1 SV=4 243 295 1.0E-06
sp|Q12901|ZN155_HUMAN Zinc finger protein 155 OS=Homo sapiens GN=ZNF155 PE=1 SV=4 243 293 1.0E-06
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 243 295 1.0E-06
sp|Q6P0J3|SP8_DANRE Transcription factor Sp8 OS=Danio rerio GN=sp8b PE=2 SV=1 227 292 1.0E-06
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 243 295 1.0E-06
sp|Q08875|SUHW_DROAN Protein suppressor of hairy wing OS=Drosophila ananassae GN=su(Hw) PE=2 SV=1 243 292 1.0E-06
sp|Q8IVC4|ZN584_HUMAN Zinc finger protein 584 OS=Homo sapiens GN=ZNF584 PE=2 SV=1 248 295 1.0E-06
sp|Q8IVC4|ZN584_HUMAN Zinc finger protein 584 OS=Homo sapiens GN=ZNF584 PE=2 SV=1 244 295 1.0E-06
sp|Q9HFS2|CREA_COCCA DNA-binding protein creA OS=Cochliobolus carbonum GN=CREA PE=2 SV=1 244 295 1.0E-06
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 243 295 1.0E-06
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 243 295 1.0E-06
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 243 295 1.0E-06
sp|Q3SY56|SP6_HUMAN Transcription factor Sp6 OS=Homo sapiens GN=SP6 PE=2 SV=1 243 292 1.0E-06
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 243 295 1.0E-06
sp|Q96N20|ZN75A_HUMAN Zinc finger protein 75A OS=Homo sapiens GN=ZNF75A PE=2 SV=1 243 292 1.0E-06
sp|Q6P2A1|PRDM9_DANRE Histone-lysine N-methyltransferase PRDM9 OS=Danio rerio GN=prdm9 PE=2 SV=1 243 293 1.0E-06
sp|Q6P2A1|PRDM9_DANRE Histone-lysine N-methyltransferase PRDM9 OS=Danio rerio GN=prdm9 PE=2 SV=1 244 292 1.0E-06
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 243 295 1.0E-06
sp|P17031|ZNF26_HUMAN Zinc finger protein 26 OS=Homo sapiens GN=ZNF26 PE=1 SV=3 243 293 1.0E-06
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 243 295 1.0E-06
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 243 293 1.0E-06
sp|P53968|CRZ1_YEAST Transcriptional regulator CRZ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRZ1 PE=1 SV=1 242 292 1.0E-06
sp|P53968|CRZ1_YEAST Transcriptional regulator CRZ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRZ1 PE=1 SV=1 246 305 1.0E-06
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 211 295 1.0E-06
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 243 295 1.0E-06
sp|A8K8V0|ZN785_HUMAN Zinc finger protein 785 OS=Homo sapiens GN=ZNF785 PE=1 SV=1 243 301 1.0E-06
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 243 295 1.0E-06
sp|Q9JLZ6|HIC2_MOUSE Hypermethylated in cancer 2 protein OS=Mus musculus GN=Hic2 PE=2 SV=4 237 292 1.0E-06
sp|Q03924|ZN117_HUMAN Zinc finger protein 117 OS=Homo sapiens GN=ZNF117 PE=2 SV=5 234 295 1.0E-06
sp|Q64HY5|SP8_CHICK Transcription factor Sp8 OS=Gallus gallus GN=SP8 PE=2 SV=1 227 292 1.0E-06
sp|O95780|ZN682_HUMAN Zinc finger protein 682 OS=Homo sapiens GN=ZNF682 PE=2 SV=1 243 295 1.0E-06
sp|Q96CX3|ZN501_HUMAN Zinc finger protein 501 OS=Homo sapiens GN=ZNF501 PE=2 SV=2 243 292 1.0E-06
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 243 295 1.0E-06
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 243 295 1.0E-06
sp|Q9HBT8|Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens GN=ZNF286A PE=1 SV=1 243 292 1.0E-06
sp|Q4X0Z3|CREA_ASPFU Probable DNA-binding protein creA OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=creA PE=3 SV=1 244 305 1.0E-06
sp|Q5R5S6|ZN540_PONAB Zinc finger protein 540 OS=Pongo abelii GN=ZNF540 PE=2 SV=1 243 295 1.0E-06
sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 243 295 1.0E-06
sp|Q5XGT8|SP8_XENLA Transcription factor Sp8 OS=Xenopus laevis GN=sp8 PE=2 SV=1 227 292 1.0E-06
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 243 295 1.0E-06
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 243 295 1.0E-06
sp|Q9NU63|ZFP57_HUMAN Zinc finger protein 57 homolog OS=Homo sapiens GN=ZFP57 PE=1 SV=2 243 326 1.0E-06
sp|Q13887|KLF5_HUMAN Krueppel-like factor 5 OS=Homo sapiens GN=KLF5 PE=1 SV=2 243 292 1.0E-06
sp|Q6NW96|SP9_DANRE Transcription factor Sp9 OS=Danio rerio GN=sp9 PE=2 SV=1 227 292 1.0E-06
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 243 292 1.0E-06
sp|Q58NQ5|PLAG1_CHICK Zinc finger protein PLAG1 OS=Gallus gallus GN=PLAG1 PE=2 SV=1 205 292 1.0E-06
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 243 295 1.0E-06
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 243 295 1.0E-06
sp|Q3KNS6|ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens GN=ZNF829 PE=2 SV=1 242 292 1.0E-06
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 243 295 2.0E-06
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 243 295 2.0E-06
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 243 295 2.0E-06
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 243 292 2.0E-06
sp|A6NP11|ZN716_HUMAN Zinc finger protein 716 OS=Homo sapiens GN=ZNF716 PE=2 SV=4 243 295 2.0E-06
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 243 295 2.0E-06
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 243 295 2.0E-06
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 243 303 2.0E-06
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 243 303 2.0E-06
sp|Q9BYN7|ZN341_HUMAN Zinc finger protein 341 OS=Homo sapiens GN=ZNF341 PE=1 SV=2 217 292 2.0E-06
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 226 295 2.0E-06
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 207 293 2.0E-06
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 243 295 2.0E-06
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 244 295 2.0E-06
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 243 295 2.0E-06
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 243 298 2.0E-06
sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 243 295 2.0E-06
sp|Q8N7Q3|ZN676_HUMAN Zinc finger protein 676 OS=Homo sapiens GN=ZNF676 PE=2 SV=2 243 295 2.0E-06
sp|Q8N7Q3|ZN676_HUMAN Zinc finger protein 676 OS=Homo sapiens GN=ZNF676 PE=2 SV=2 243 295 2.0E-06
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 244 295 2.0E-06
sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 243 292 2.0E-06
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 243 303 2.0E-06
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 243 289 2.0E-06
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 243 295 2.0E-06
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 243 295 2.0E-06
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 243 295 2.0E-06
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 214 295 2.0E-06
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 243 295 2.0E-06
sp|Q5R7I8|ZNF19_PONAB Zinc finger protein 19 OS=Pongo abelii GN=ZNF19 PE=2 SV=1 243 295 2.0E-06
sp|Q9H7X3|ZN696_HUMAN Zinc finger protein 696 OS=Homo sapiens GN=ZNF696 PE=2 SV=2 243 293 2.0E-06
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 227 295 2.0E-06
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 243 295 2.0E-06
sp|Q2M3X9|ZN674_HUMAN Zinc finger protein 674 OS=Homo sapiens GN=ZNF674 PE=2 SV=1 243 292 2.0E-06
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 243 295 2.0E-06
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 243 295 2.0E-06
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 243 295 2.0E-06
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 243 295 2.0E-06
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 243 292 2.0E-06
sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=1 SV=1 243 295 2.0E-06
sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=1 SV=1 243 295 2.0E-06
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 243 327 2.0E-06
sp|A3KN36|ZNF19_BOVIN Zinc finger protein 19 OS=Bos taurus GN=ZNF19 PE=2 SV=1 243 295 2.0E-06
sp|A3KN36|ZNF19_BOVIN Zinc finger protein 19 OS=Bos taurus GN=ZNF19 PE=2 SV=1 243 295 2.0E-06
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 243 295 2.0E-06
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 243 295 2.0E-06
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 243 295 2.0E-06
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 243 295 2.0E-06
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 243 295 2.0E-06
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 243 295 2.0E-06
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 243 295 2.0E-06
sp|Q8NEM1|ZN680_HUMAN Zinc finger protein 680 OS=Homo sapiens GN=ZNF680 PE=2 SV=2 243 295 2.0E-06
sp|O70237|GFI1B_MOUSE Zinc finger protein Gfi-1b OS=Mus musculus GN=Gfi1b PE=1 SV=1 243 295 2.0E-06
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 243 292 2.0E-06
sp|P17032|ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens GN=ZNF37A PE=2 SV=3 244 293 2.0E-06
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 243 295 2.0E-06
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 241 293 2.0E-06
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 243 295 2.0E-06
sp|P24399|ZN239_MOUSE Zinc finger protein 239 OS=Mus musculus GN=Znf239 PE=2 SV=2 242 295 2.0E-06
sp|Q969J2|ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens GN=ZKSCAN4 PE=1 SV=1 246 292 2.0E-06
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 243 295 2.0E-06
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 241 293 2.0E-06
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 243 295 2.0E-06
sp|Q8N9Z0|ZN610_HUMAN Zinc finger protein 610 OS=Homo sapiens GN=ZNF610 PE=2 SV=2 243 303 2.0E-06
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 243 295 2.0E-06
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 243 295 2.0E-06
sp|Q5MYW4|ZN667_RAT Zinc finger protein 667 OS=Rattus norvegicus GN=Znf667 PE=2 SV=1 243 295 2.0E-06
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 243 295 2.0E-06
sp|Q5VV52|ZN691_HUMAN Zinc finger protein 691 OS=Homo sapiens GN=ZNF691 PE=1 SV=1 243 292 2.0E-06
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 243 292 2.0E-06
sp|Q49A33|Z876P_HUMAN Putative zinc finger protein 876 OS=Homo sapiens GN=ZNF876P PE=5 SV=3 243 311 2.0E-06
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 243 295 2.0E-06
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 243 295 2.0E-06
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 243 295 2.0E-06
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 243 295 2.0E-06
sp|A2RRD8|ZN320_HUMAN Zinc finger protein 320 OS=Homo sapiens GN=ZNF320 PE=1 SV=1 243 295 2.0E-06
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 243 295 2.0E-06
sp|Q8IYX0|ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens GN=ZNF679 PE=1 SV=2 243 295 2.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 243 311 2.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 243 295 2.0E-06
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 243 315 2.0E-06
sp|Q9BUG6|ZSA5A_HUMAN Zinc finger and SCAN domain-containing protein 5A OS=Homo sapiens GN=ZSCAN5A PE=2 SV=1 243 295 2.0E-06
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 243 295 2.0E-06
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 243 295 2.0E-06
sp|Q96K58|ZN668_HUMAN Zinc finger protein 668 OS=Homo sapiens GN=ZNF668 PE=1 SV=3 246 292 2.0E-06
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 243 295 2.0E-06
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 243 295 2.0E-06
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 243 295 2.0E-06
sp|Q13398|ZN211_HUMAN Zinc finger protein 211 OS=Homo sapiens GN=ZNF211 PE=2 SV=2 243 295 2.0E-06
sp|Q13398|ZN211_HUMAN Zinc finger protein 211 OS=Homo sapiens GN=ZNF211 PE=2 SV=2 243 295 2.0E-06
sp|P18724|ZG49_XENLA Gastrula zinc finger protein XlCGF49.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 243 292 2.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 243 311 2.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 243 295 2.0E-06
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 242 293 2.0E-06
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 242 292 2.0E-06
sp|Q9UNY5|ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens GN=ZNF232 PE=1 SV=1 243 295 2.0E-06
sp|Q95K52|ZN283_MACFA Zinc finger protein 283 OS=Macaca fascicularis GN=ZNF283 PE=2 SV=1 243 295 2.0E-06
sp|Q12901|ZN155_HUMAN Zinc finger protein 155 OS=Homo sapiens GN=ZNF155 PE=1 SV=4 243 295 2.0E-06
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 226 293 2.0E-06
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 243 295 2.0E-06
sp|Q3TDE8|ZN691_MOUSE Zinc finger protein 691 OS=Mus musculus GN=Znf691 PE=2 SV=1 222 295 2.0E-06
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 243 293 2.0E-06
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 243 295 2.0E-06
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 243 292 2.0E-06
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 242 293 2.0E-06
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 243 292 2.0E-06
sp|P20385|CF2_DROME Chorion transcription factor Cf2 OS=Drosophila melanogaster GN=Cf2 PE=2 SV=3 243 292 3.0E-06
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 243 295 3.0E-06
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 243 295 3.0E-06
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 243 292 3.0E-06
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 243 292 3.0E-06
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 243 295 3.0E-06
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 243 295 3.0E-06
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 243 292 3.0E-06
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 243 295 3.0E-06
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 243 295 3.0E-06
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 243 315 3.0E-06
sp|Q8IYN0|ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens GN=ZNF100 PE=2 SV=2 243 295 3.0E-06
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 243 295 3.0E-06
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 242 292 3.0E-06
sp|Q68DI1|ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens GN=ZNF776 PE=1 SV=2 243 295 3.0E-06
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 242 295 3.0E-06
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 241 295 3.0E-06
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 243 295 3.0E-06
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 243 292 3.0E-06
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 243 297 3.0E-06
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 243 297 3.0E-06
sp|Q96HQ0|ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens GN=ZNF419 PE=1 SV=2 243 292 3.0E-06
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 243 295 3.0E-06
sp|P18749|ZO6_XENLA Oocyte zinc finger protein XlCOF6 (Fragment) OS=Xenopus laevis PE=3 SV=1 243 292 3.0E-06
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 243 295 3.0E-06
sp|P17023|ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens GN=ZNF19 PE=2 SV=4 86 295 3.0E-06
sp|Q13106|ZN154_HUMAN Zinc finger protein 154 OS=Homo sapiens GN=ZNF154 PE=2 SV=3 243 295 3.0E-06
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 243 315 3.0E-06
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 243 295 3.0E-06
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 243 315 3.0E-06
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 243 295 3.0E-06
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 243 315 3.0E-06
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 243 295 3.0E-06
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 243 295 3.0E-06
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 243 295 3.0E-06
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 243 295 3.0E-06
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 243 295 3.0E-06
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 243 295 3.0E-06
sp|P18722|ZG46_XENLA Gastrula zinc finger protein XlCGF46.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 244 295 3.0E-06
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 244 295 3.0E-06
sp|Q2VY69|ZN284_HUMAN Zinc finger protein 284 OS=Homo sapiens GN=ZNF284 PE=2 SV=1 243 316 3.0E-06
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 243 292 3.0E-06
sp|Q9Z2K3|ZN394_RAT Zinc finger protein 394 OS=Rattus norvegicus GN=Znf394 PE=2 SV=1 241 292 3.0E-06
sp|Q5VTD9|GFI1B_HUMAN Zinc finger protein Gfi-1b OS=Homo sapiens GN=GFI1B PE=1 SV=1 243 295 3.0E-06
sp|Q9BRR0|ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens GN=ZKSCAN3 PE=1 SV=2 243 292 3.0E-06
sp|Q6DCW1|GFI1B_XENLA Zinc finger protein Gfi-1b OS=Xenopus laevis GN=gfi1b PE=2 SV=1 243 295 3.0E-06
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 243 295 3.0E-06
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 243 295 3.0E-06
sp|Q8N7M2|ZN283_HUMAN Zinc finger protein 283 OS=Homo sapiens GN=ZNF283 PE=2 SV=4 243 295 3.0E-06
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 243 295 3.0E-06
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 243 292 3.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 243 295 3.0E-06
sp|P0CB33|ZN735_HUMAN Putative zinc finger protein 735 OS=Homo sapiens GN=ZNF735 PE=5 SV=1 243 295 3.0E-06
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 242 295 3.0E-06
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 243 295 3.0E-06
sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 243 295 3.0E-06
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 243 292 3.0E-06
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 225 292 3.0E-06
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 242 292 3.0E-06
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 243 311 3.0E-06
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 243 295 3.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 243 295 3.0E-06
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 243 295 3.0E-06
sp|Q9NXT0|ZN586_HUMAN Zinc finger protein 586 OS=Homo sapiens GN=ZNF586 PE=2 SV=2 243 295 3.0E-06
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 243 292 3.0E-06
sp|Q03924|ZN117_HUMAN Zinc finger protein 117 OS=Homo sapiens GN=ZNF117 PE=2 SV=5 243 295 3.0E-06
sp|O95780|ZN682_HUMAN Zinc finger protein 682 OS=Homo sapiens GN=ZNF682 PE=2 SV=1 243 295 3.0E-06
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 243 295 3.0E-06
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 243 295 3.0E-06
sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 243 295 3.0E-06
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 228 292 3.0E-06
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 243 295 3.0E-06
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 243 292 3.0E-06
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 243 295 3.0E-06
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 243 295 3.0E-06
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 243 295 4.0E-06
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 243 295 4.0E-06
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 243 295 4.0E-06
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 243 295 4.0E-06
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 243 295 4.0E-06
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 243 295 4.0E-06
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 166 295 4.0E-06
sp|Q9UL36|ZN236_HUMAN Zinc finger protein 236 OS=Homo sapiens GN=ZNF236 PE=2 SV=2 243 292 4.0E-06
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 241 295 4.0E-06
sp|Q5T619|ZN648_HUMAN Zinc finger protein 648 OS=Homo sapiens GN=ZNF648 PE=2 SV=1 243 292 4.0E-06
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 243 295 4.0E-06
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 244 295 4.0E-06
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 231 295 4.0E-06
sp|Q6ZS27|ZN662_HUMAN Zinc finger protein 662 OS=Homo sapiens GN=ZNF662 PE=1 SV=1 243 295 4.0E-06
sp|Q6ZS27|ZN662_HUMAN Zinc finger protein 662 OS=Homo sapiens GN=ZNF662 PE=1 SV=1 244 295 4.0E-06
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 243 292 4.0E-06
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 243 295 4.0E-06
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 243 292 4.0E-06
sp|Q6ZNG1|ZN600_HUMAN Zinc finger protein 600 OS=Homo sapiens GN=ZNF600 PE=1 SV=2 243 311 4.0E-06
sp|Q6ZNG1|ZN600_HUMAN Zinc finger protein 600 OS=Homo sapiens GN=ZNF600 PE=1 SV=2 229 292 4.0E-06
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 243 293 4.0E-06
sp|Q3SY52|ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens GN=ZIK1 PE=2 SV=1 244 295 4.0E-06
sp|Q3SY52|ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens GN=ZIK1 PE=2 SV=1 244 295 4.0E-06
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 243 295 4.0E-06
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 243 293 4.0E-06
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 243 295 4.0E-06
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 243 284 4.0E-06
sp|P18749|ZO6_XENLA Oocyte zinc finger protein XlCOF6 (Fragment) OS=Xenopus laevis PE=3 SV=1 243 292 4.0E-06
sp|P17023|ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens GN=ZNF19 PE=2 SV=4 243 295 4.0E-06
sp|Q6PDB4|ZN880_HUMAN Zinc finger protein 880 OS=Homo sapiens GN=ZNF880 PE=2 SV=2 243 295 4.0E-06
sp|Q14593|ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens GN=ZNF273 PE=1 SV=3 245 311 4.0E-06
sp|Q6PK81|ZN773_HUMAN Zinc finger protein 773 OS=Homo sapiens GN=ZNF773 PE=2 SV=1 243 295 4.0E-06
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 243 295 4.0E-06
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 243 295 4.0E-06
sp|Q9NSD4|ZN275_HUMAN Zinc finger protein 275 OS=Homo sapiens GN=ZNF275 PE=2 SV=2 244 292 4.0E-06
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 243 295 4.0E-06
sp|Q8N823|ZN611_HUMAN Zinc finger protein 611 OS=Homo sapiens GN=ZNF611 PE=2 SV=2 243 292 4.0E-06
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 243 295 4.0E-06
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 243 303 4.0E-06
sp|Q8BI67|ZN473_MOUSE Zinc finger protein 473 homolog OS=Mus musculus GN=Znf473 PE=2 SV=1 243 294 4.0E-06
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 227 295 4.0E-06
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 241 292 4.0E-06
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 228 295 4.0E-06
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 227 295 4.0E-06
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 241 292 4.0E-06
sp|Q07120|GFI1_RAT Zinc finger protein Gfi-1 OS=Rattus norvegicus GN=Gfi1 PE=1 SV=1 243 295 4.0E-06
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 242 295 4.0E-06
sp|Q8N9Z0|ZN610_HUMAN Zinc finger protein 610 OS=Homo sapiens GN=ZNF610 PE=2 SV=2 243 295 4.0E-06
sp|Q5DWN0|GFI1_CANLF Zinc finger protein Gfi-1 OS=Canis lupus familiaris GN=GFI1 PE=2 SV=1 243 295 4.0E-06
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 243 295 4.0E-06
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 243 295 4.0E-06
sp|P07247|KRUP_DROME Protein krueppel OS=Drosophila melanogaster GN=Kr PE=1 SV=2 243 295 4.0E-06
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 226 292 4.0E-06
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 243 295 4.0E-06
sp|Q6ZR52|ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens GN=ZNF493 PE=2 SV=3 243 295 4.0E-06
sp|Q7Z7K2|ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens GN=ZNF467 PE=2 SV=1 241 292 4.0E-06
sp|Q9WUF2|EGR4_MOUSE Early growth response protein 4 OS=Mus musculus GN=Egr4 PE=3 SV=1 244 292 4.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 243 293 4.0E-06
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 243 295 4.0E-06
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 243 295 4.0E-06
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 243 292 4.0E-06
sp|P49910|ZN165_HUMAN Zinc finger protein 165 OS=Homo sapiens GN=ZNF165 PE=1 SV=1 243 292 4.0E-06
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 243 295 4.0E-06
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 244 295 4.0E-06
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 242 295 4.0E-06
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 243 292 4.0E-06
sp|Q9Y2Q1|ZN257_HUMAN Zinc finger protein 257 OS=Homo sapiens GN=ZNF257 PE=2 SV=2 243 295 4.0E-06
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 243 295 4.0E-06
sp|Q13398|ZN211_HUMAN Zinc finger protein 211 OS=Homo sapiens GN=ZNF211 PE=2 SV=2 243 295 4.0E-06
sp|Q13398|ZN211_HUMAN Zinc finger protein 211 OS=Homo sapiens GN=ZNF211 PE=2 SV=2 243 295 4.0E-06
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 244 292 4.0E-06
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 243 292 4.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 243 293 4.0E-06
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 243 295 4.0E-06
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 243 295 4.0E-06
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 243 295 4.0E-06
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 243 295 4.0E-06
sp|P18718|ZG3_XENLA Gastrula zinc finger protein xLCGF3.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 243 295 5.0E-06
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 229 292 5.0E-06
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 243 295 5.0E-06
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 243 292 5.0E-06
sp|Q80YP6|ZIK1_MOUSE Zinc finger protein interacting with ribonucleoprotein K OS=Mus musculus GN=Zik1 PE=1 SV=1 243 295 5.0E-06
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 243 295 5.0E-06
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 226 303 5.0E-06
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 243 295 5.0E-06
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 244 295 5.0E-06
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 243 295 5.0E-06
sp|P51815|ZN75D_HUMAN Zinc finger protein 75D OS=Homo sapiens GN=ZNF75D PE=2 SV=2 243 295 5.0E-06
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 243 295 5.0E-06
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 242 295 5.0E-06
sp|Q8N7Q3|ZN676_HUMAN Zinc finger protein 676 OS=Homo sapiens GN=ZNF676 PE=2 SV=2 243 295 5.0E-06
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 243 295 5.0E-06
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 243 303 5.0E-06
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 243 292 5.0E-06
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 244 295 5.0E-06
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 243 293 5.0E-06
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 243 295 5.0E-06
sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens GN=ZSCAN30 PE=1 SV=1 224 295 5.0E-06
sp|Q5R7I8|ZNF19_PONAB Zinc finger protein 19 OS=Pongo abelii GN=ZNF19 PE=2 SV=1 242 295 5.0E-06
sp|Q5R7I8|ZNF19_PONAB Zinc finger protein 19 OS=Pongo abelii GN=ZNF19 PE=2 SV=1 243 295 5.0E-06
sp|Q5R7I8|ZNF19_PONAB Zinc finger protein 19 OS=Pongo abelii GN=ZNF19 PE=2 SV=1 243 295 5.0E-06
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 243 326 5.0E-06
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 243 295 5.0E-06
sp|Q6PDB4|ZN880_HUMAN Zinc finger protein 880 OS=Homo sapiens GN=ZNF880 PE=2 SV=2 225 292 5.0E-06
sp|Q61751|Z354A_MOUSE Zinc finger protein 354A OS=Mus musculus GN=Znf354a PE=2 SV=2 243 311 5.0E-06
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 243 294 5.0E-06
sp|Q13106|ZN154_HUMAN Zinc finger protein 154 OS=Homo sapiens GN=ZNF154 PE=2 SV=3 242 295 5.0E-06
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 244 295 5.0E-06
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 243 295 5.0E-06
sp|P70338|GFI1_MOUSE Zinc finger protein Gfi-1 OS=Mus musculus GN=Gfi1 PE=1 SV=2 243 295 5.0E-06
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 243 292 5.0E-06
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 243 295 5.0E-06
sp|Q9UK13|ZN221_HUMAN Zinc finger protein 221 OS=Homo sapiens GN=ZNF221 PE=2 SV=3 243 295 5.0E-06
sp|Q99684|GFI1_HUMAN Zinc finger protein Gfi-1 OS=Homo sapiens GN=GFI1 PE=1 SV=2 243 295 5.0E-06
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 243 312 5.0E-06
sp|Q9GL32|EGR4_BOVIN Early growth response protein 4 OS=Bos taurus GN=EGR4 PE=2 SV=1 244 292 5.0E-06
sp|Q7Z7K2|ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens GN=ZNF467 PE=2 SV=1 227 295 5.0E-06
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 242 292 5.0E-06
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 243 295 5.0E-06
sp|Q2TA17|ZN668_BOVIN Zinc finger protein 668 OS=Bos taurus GN=ZNF668 PE=2 SV=2 244 295 5.0E-06
sp|Q9Y2P7|ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens GN=ZNF256 PE=1 SV=2 244 295 5.0E-06
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 243 295 5.0E-06
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 243 295 5.0E-06
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 246 295 5.0E-06
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 243 311 5.0E-06
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 243 295 5.0E-06
sp|A6NJL1|ZSA5B_HUMAN Zinc finger and SCAN domain-containing protein 5B OS=Homo sapiens GN=ZSCAN5B PE=3 SV=1 243 295 5.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 228 293 5.0E-06
sp|Q3TDE8|ZN691_MOUSE Zinc finger protein 691 OS=Mus musculus GN=Znf691 PE=2 SV=1 243 292 5.0E-06
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 243 295 5.0E-06
sp|Q03924|ZN117_HUMAN Zinc finger protein 117 OS=Homo sapiens GN=ZNF117 PE=2 SV=5 243 295 5.0E-06
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 243 295 5.0E-06
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 243 292 6.0E-06
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 243 295 6.0E-06
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 242 295 6.0E-06
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 243 295 6.0E-06
sp|Q68DI1|ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens GN=ZNF776 PE=1 SV=2 243 295 6.0E-06
sp|Q9ERR8|ZN319_MOUSE Zinc finger protein 319 OS=Mus musculus GN=Znf319 PE=2 SV=1 243 303 6.0E-06
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 243 295 6.0E-06
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 243 295 6.0E-06
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 243 295 6.0E-06
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 243 295 6.0E-06
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 243 284 6.0E-06
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 243 292 6.0E-06
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 243 295 6.0E-06
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 226 295 6.0E-06
sp|P17023|ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens GN=ZNF19 PE=2 SV=4 243 295 6.0E-06
sp|P17023|ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens GN=ZNF19 PE=2 SV=4 243 295 6.0E-06
sp|Q6PK81|ZN773_HUMAN Zinc finger protein 773 OS=Homo sapiens GN=ZNF773 PE=2 SV=1 243 295 6.0E-06
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 243 295 6.0E-06
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 243 295 6.0E-06
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 243 295 6.0E-06
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 243 295 6.0E-06
sp|Q9NSD4|ZN275_HUMAN Zinc finger protein 275 OS=Homo sapiens GN=ZNF275 PE=2 SV=2 243 294 6.0E-06
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 226 292 6.0E-06
sp|Q96LW9|ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens GN=ZSCAN31 PE=1 SV=2 243 295 6.0E-06
sp|Q8K2R5|ZN668_MOUSE Zinc finger protein 668 OS=Mus musculus GN=Znf668 PE=2 SV=1 244 295 6.0E-06
sp|Q6ZSB9|ZBT49_HUMAN Zinc finger and BTB domain-containing protein 49 OS=Homo sapiens GN=ZBTB49 PE=1 SV=3 243 294 6.0E-06
sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens GN=ZNF233 PE=2 SV=3 243 295 6.0E-06
sp|Q6GQR8|ZN329_MOUSE Zinc finger protein 329 OS=Mus musculus GN=Znf329 PE=1 SV=2 243 295 6.0E-06
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 226 295 6.0E-06
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 243 295 6.0E-06
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 243 295 6.0E-06
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 243 295 6.0E-06
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 243 293 6.0E-06
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 243 293 6.0E-06
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 243 295 6.0E-06
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 242 293 6.0E-06
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 243 295 6.0E-06
sp|Q4R3I5|ZN668_MACFA Zinc finger protein 668 OS=Macaca fascicularis GN=ZNF668 PE=2 SV=1 243 292 6.0E-06
sp|P17019|ZN708_HUMAN Zinc finger protein 708 OS=Homo sapiens GN=ZNF708 PE=1 SV=5 243 295 6.0E-06
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 243 295 6.0E-06
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 243 295 6.0E-06
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 243 295 6.0E-06
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 243 295 6.0E-06
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 243 295 6.0E-06
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 242 293 6.0E-06
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 226 293 6.0E-06
sp|Q96N20|ZN75A_HUMAN Zinc finger protein 75A OS=Homo sapiens GN=ZNF75A PE=2 SV=1 242 292 6.0E-06
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 243 295 6.0E-06
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 243 295 6.0E-06
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 243 295 6.0E-06
sp|P18718|ZG3_XENLA Gastrula zinc finger protein xLCGF3.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 243 295 7.0E-06
sp|P18718|ZG3_XENLA Gastrula zinc finger protein xLCGF3.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 243 293 7.0E-06
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 243 295 7.0E-06
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 243 295 7.0E-06
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 243 292 7.0E-06
sp|Q9UL36|ZN236_HUMAN Zinc finger protein 236 OS=Homo sapiens GN=ZNF236 PE=2 SV=2 243 310 7.0E-06
sp|Q80YP6|ZIK1_MOUSE Zinc finger protein interacting with ribonucleoprotein K OS=Mus musculus GN=Zik1 PE=1 SV=1 244 295 7.0E-06
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 243 295 7.0E-06
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 243 295 7.0E-06
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 243 293 7.0E-06
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 243 295 7.0E-06
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 243 295 7.0E-06
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 226 293 7.0E-06
sp|Q9ERR8|ZN319_MOUSE Zinc finger protein 319 OS=Mus musculus GN=Znf319 PE=2 SV=1 240 315 7.0E-06
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 243 303 7.0E-06
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 243 295 7.0E-06
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 243 295 7.0E-06
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 243 295 7.0E-06
sp|P18749|ZO6_XENLA Oocyte zinc finger protein XlCOF6 (Fragment) OS=Xenopus laevis PE=3 SV=1 243 292 7.0E-06
sp|P18749|ZO6_XENLA Oocyte zinc finger protein XlCOF6 (Fragment) OS=Xenopus laevis PE=3 SV=1 243 295 7.0E-06
sp|Q6PDB4|ZN880_HUMAN Zinc finger protein 880 OS=Homo sapiens GN=ZNF880 PE=2 SV=2 243 295 7.0E-06
sp|O42409|GFI1B_CHICK Zinc finger protein Gfi-1b OS=Gallus gallus GN=GFI1B PE=2 SV=1 233 295 7.0E-06
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 243 295 7.0E-06
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 243 295 7.0E-06
sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=1 SV=1 243 295 7.0E-06
sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=1 SV=1 243 295 7.0E-06
sp|Q8N823|ZN611_HUMAN Zinc finger protein 611 OS=Homo sapiens GN=ZNF611 PE=2 SV=2 243 295 7.0E-06
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 243 295 7.0E-06
sp|Q17QR7|ZN691_BOVIN Zinc finger protein 691 OS=Bos taurus GN=ZNF691 PE=2 SV=1 242 292 7.0E-06
sp|Q8TF39|ZN483_HUMAN Zinc finger protein 483 OS=Homo sapiens GN=ZNF483 PE=1 SV=3 244 292 7.0E-06
sp|P0CB33|ZN735_HUMAN Putative zinc finger protein 735 OS=Homo sapiens GN=ZNF735 PE=5 SV=1 243 295 7.0E-06
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 243 295 7.0E-06
sp|Q2TA17|ZN668_BOVIN Zinc finger protein 668 OS=Bos taurus GN=ZNF668 PE=2 SV=2 243 292 7.0E-06
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 243 295 7.0E-06
sp|Q9Y2Q1|ZN257_HUMAN Zinc finger protein 257 OS=Homo sapiens GN=ZNF257 PE=2 SV=2 243 295 7.0E-06
sp|Q05215|EGR4_HUMAN Early growth response protein 4 OS=Homo sapiens GN=EGR4 PE=2 SV=3 246 292 7.0E-06
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 243 295 7.0E-06
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 243 292 7.0E-06
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 243 295 7.0E-06
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 242 295 8.0E-06
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 243 292 8.0E-06
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 244 311 8.0E-06
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 243 295 8.0E-06
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 243 292 8.0E-06
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 243 295 8.0E-06
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 226 292 8.0E-06
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 243 292 8.0E-06
sp|Q9P2F9|ZN319_HUMAN Zinc finger protein 319 OS=Homo sapiens GN=ZNF319 PE=1 SV=2 243 303 8.0E-06
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 243 295 8.0E-06
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 243 295 8.0E-06
sp|P18749|ZO6_XENLA Oocyte zinc finger protein XlCOF6 (Fragment) OS=Xenopus laevis PE=3 SV=1 242 292 8.0E-06
sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=1 SV=1 243 295 8.0E-06
sp|Q9QXT9|Z354B_MOUSE Zinc finger protein 354B OS=Mus musculus GN=Znf354b PE=2 SV=1 243 292 8.0E-06
sp|Q6GQR8|ZN329_MOUSE Zinc finger protein 329 OS=Mus musculus GN=Znf329 PE=1 SV=2 242 295 8.0E-06
sp|Q8BI67|ZN473_MOUSE Zinc finger protein 473 homolog OS=Mus musculus GN=Znf473 PE=2 SV=1 242 311 8.0E-06
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 243 295 8.0E-06
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 243 292 8.0E-06
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 243 295 8.0E-06
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 243 295 8.0E-06
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 243 292 8.0E-06
sp|Q9VI93|RN_DROME Zinc finger protein rotund OS=Drosophila melanogaster GN=rn PE=1 SV=2 216 295 8.0E-06
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 243 286 8.0E-06
sp|Q4R3I5|ZN668_MACFA Zinc finger protein 668 OS=Macaca fascicularis GN=ZNF668 PE=2 SV=1 244 295 8.0E-06
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 243 295 8.0E-06
sp|Q91VN1|ZNF24_MOUSE Zinc finger protein 24 OS=Mus musculus GN=Znf24 PE=1 SV=1 243 295 8.0E-06
sp|Q9Y2P7|ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens GN=ZNF256 PE=1 SV=2 243 295 8.0E-06
sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 243 295 8.0E-06
sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 242 295 8.0E-06
sp|Q96K58|ZN668_HUMAN Zinc finger protein 668 OS=Homo sapiens GN=ZNF668 PE=1 SV=3 243 292 8.0E-06
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 243 295 8.0E-06
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 244 295 8.0E-06
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 243 295 8.0E-06
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 243 295 8.0E-06
sp|O95780|ZN682_HUMAN Zinc finger protein 682 OS=Homo sapiens GN=ZNF682 PE=2 SV=1 243 295 8.0E-06
sp|Q9HBT8|Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens GN=ZNF286A PE=1 SV=1 243 295 8.0E-06
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 243 295 8.0E-06
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 243 295 9.0E-06
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 243 297 9.0E-06
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 243 295 9.0E-06
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 243 295 9.0E-06
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 243 295 9.0E-06
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 226 295 9.0E-06
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 226 292 9.0E-06
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 243 284 9.0E-06
sp|Q9P2F9|ZN319_HUMAN Zinc finger protein 319 OS=Homo sapiens GN=ZNF319 PE=1 SV=2 240 315 9.0E-06
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 243 295 9.0E-06
sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens GN=ZSCAN30 PE=1 SV=1 243 295 9.0E-06
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 243 295 9.0E-06
sp|Q8N782|ZN525_HUMAN Zinc finger protein 525 OS=Homo sapiens GN=ZNF525 PE=2 SV=2 243 295 9.0E-06
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 243 295 9.0E-06
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 243 295 9.0E-06
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 243 303 9.0E-06
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 243 303 9.0E-06
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 243 295 9.0E-06
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 243 295 9.0E-06
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 243 295 9.0E-06
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 243 292 9.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 243 295 9.0E-06
sp|Q00911|EGR4_RAT Early growth response protein 4 OS=Rattus norvegicus GN=Egr4 PE=2 SV=1 244 292 9.0E-06
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 243 295 9.0E-06
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 243 295 9.0E-06
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 243 295 9.0E-06
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 226 295 9.0E-06
sp|Q2TA17|ZN668_BOVIN Zinc finger protein 668 OS=Bos taurus GN=ZNF668 PE=2 SV=2 191 292 9.0E-06
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 238 295 9.0E-06
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 243 292 9.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 243 295 9.0E-06
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 243 295 9.0E-06
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 243 295 1.0E-05
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 243 295 1.0E-05
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 243 295 1.0E-05
sp|Q6ZNG1|ZN600_HUMAN Zinc finger protein 600 OS=Homo sapiens GN=ZNF600 PE=1 SV=2 243 311 1.0E-05
sp|P51815|ZN75D_HUMAN Zinc finger protein 75D OS=Homo sapiens GN=ZNF75D PE=2 SV=2 243 292 1.0E-05
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 243 293 1.0E-05
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 243 293 1.0E-05
sp|P18749|ZO6_XENLA Oocyte zinc finger protein XlCOF6 (Fragment) OS=Xenopus laevis PE=3 SV=1 243 293 1.0E-05
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 243 295 1.0E-05
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 243 295 1.0E-05
sp|P17023|ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens GN=ZNF19 PE=2 SV=4 243 295 1.0E-05
sp|Q24732|GLAS_DROVI Protein glass OS=Drosophila virilis GN=gl PE=3 SV=1 243 292 1.0E-05
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 243 293 1.0E-05
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 243 295 1.0E-05
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 243 292 1.0E-05
sp|Q2TA17|ZN668_BOVIN Zinc finger protein 668 OS=Bos taurus GN=ZNF668 PE=2 SV=2 244 295 1.0E-05
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 242 305 1.0E-05
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 243 292 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
C2H2 zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6172
MYTYGAPVQSAWASTSSYSIANPHHHSTYSSQQQGLPALPHLQPSHHQAHHTPQLQHSQLHHHNSAQHNQHHAPQ
QQQHHSPLYGARQHSMYSQPSSALNYTASQRSSQSPPQQPGYHQFMSHSGPIQPVPTTSGPPVGSGPGPGSMAMP
LRPIASMAPHPSAQPTTEPPHQTMGPTAIPYRSFATYHSSMPPSLGGTGMAGMHHAGNSMSVIPNISIYTQGGPG
SYGLAAHHTDRASQSQSERPFKCDQCTQSFSRNHDLKRHKRIHLAVKPFPCTFCAKSFSRKDALKRHRLVKGCEN
KVKNGTINSTLDGRTPHPPSDIKQPLV*
Coding >OphauG2|6172
ATGTACACGTACGGTGCTCCCGTCCAGAGCGCTTGGGCTTCGACTTCTTCATACAGCATCGCCAATCCCCATCAT
CATAGCACCTACTCATCGCAACAGCAAGGCCTCCCCGCCCTGCCGCATCTTCAGCCCTCTCACCACCAAGCCCAT
CATACGCCACAGCTCCAACACTCGCAGCTCCATCATCACAACTCGGCGCAGCACAATCAGCACCACGCACCGCAG
CAGCAGCAACATCACTCCCCCTTGTATGGGGCGCGCCAGCATTCCATGTACTCGCAGCCTTCCTCGGCTCTAAAC
TACACTGCGAGCCAGCGTAGCTCGCAGTCGCCCCCGCAGCAGCCCGGTTACCACCAATTCATGTCTCACAGCGGT
CCCATACAGCCTGTACCAACTACTAGCGGTCCCCCAGTTGGCTCAGGGCCCGGTCCCGGGTCCATGGCGATGCCT
CTCCGTCCCATTGCCAGCATGGCGCCCCATCCGTCTGCCCAGCCCACCACCGAGCCGCCCCATCAGACCATGGGC
CCGACTGCCATACCATATAGGAGCTTTGCCACATACCATTCCTCGATGCCACCAAGTCTTGGTGGGACTGGCATG
GCCGGAATGCATCATGCTGGCAACTCCATGTCTGTCATTCCCAACATAAGTATTTACACGCAAGGAGGCCCGGGC
TCGTATGGACTTGCTGCACATCACACAGACCGTGCCTCTCAGTCACAATCGGAGCGTCCATTCAAGTGCGACCAG
TGTACCCAGTCCTTTAGTCGAAATCACGACCTCAAGCGCCACAAAAGAATTCATCTCGCCGTCAAGCCCTTTCCC
TGCACCTTCTGCGCCAAGAGCTTTTCACGCAAGGATGCTCTCAAGAGGCACCGGCTGGTCAAAGGATGCGAGAAC
AAGGTCAAGAATGGAACCATCAACAGTACCTTGGACGGACGAACTCCTCACCCTCCGTCCGACATTAAGCAGCCT
CTAGTGTAG
Transcript >OphauG2|6172
ATGTACACGTACGGTGCTCCCGTCCAGAGCGCTTGGGCTTCGACTTCTTCATACAGCATCGCCAATCCCCATCAT
CATAGCACCTACTCATCGCAACAGCAAGGCCTCCCCGCCCTGCCGCATCTTCAGCCCTCTCACCACCAAGCCCAT
CATACGCCACAGCTCCAACACTCGCAGCTCCATCATCACAACTCGGCGCAGCACAATCAGCACCACGCACCGCAG
CAGCAGCAACATCACTCCCCCTTGTATGGGGCGCGCCAGCATTCCATGTACTCGCAGCCTTCCTCGGCTCTAAAC
TACACTGCGAGCCAGCGTAGCTCGCAGTCGCCCCCGCAGCAGCCCGGTTACCACCAATTCATGTCTCACAGCGGT
CCCATACAGCCTGTACCAACTACTAGCGGTCCCCCAGTTGGCTCAGGGCCCGGTCCCGGGTCCATGGCGATGCCT
CTCCGTCCCATTGCCAGCATGGCGCCCCATCCGTCTGCCCAGCCCACCACCGAGCCGCCCCATCAGACCATGGGC
CCGACTGCCATACCATATAGGAGCTTTGCCACATACCATTCCTCGATGCCACCAAGTCTTGGTGGGACTGGCATG
GCCGGAATGCATCATGCTGGCAACTCCATGTCTGTCATTCCCAACATAAGTATTTACACGCAAGGAGGCCCGGGC
TCGTATGGACTTGCTGCACATCACACAGACCGTGCCTCTCAGTCACAATCGGAGCGTCCATTCAAGTGCGACCAG
TGTACCCAGTCCTTTAGTCGAAATCACGACCTCAAGCGCCACAAAAGAATTCATCTCGCCGTCAAGCCCTTTCCC
TGCACCTTCTGCGCCAAGAGCTTTTCACGCAAGGATGCTCTCAAGAGGCACCGGCTGGTCAAAGGATGCGAGAAC
AAGGTCAAGAATGGAACCATCAACAGTACCTTGGACGGACGAACTCCTCACCCTCCGTCCGACATTAAGCAGCCT
CTAGTGTAG
Gene >OphauG2|6172
ATGTACACGTACGGTGCTCCCGTCCAGAGCGCTTGGGCTTCGACTTCTTCATACAGCATCGCCAATCCCCATCAT
CATAGCACCTACTCATCGCAACAGCAAGGCCTCCCCGCCCTGCCGCATCTTCAGCCCTCTCACCACCAAGCCCAT
CATACGCCACAGCTCCAACACTCGCAGCTCCATCATCACAACTCGGCGCAGCACAATCAGCACCACGCACCGCAG
CAGCAGCAACATCACTCCCCCTTGTATGGGGCGCGCCAGCATTCCATGTACTCGCAGCCTTCCTCGGCTCTAAAC
TACACTGCGAGCCAGCGTAGCTCGCAGTCGCCCCCGCAGCAGCCCGGTTACCACCAATTCATGTCTCACAGCGGT
CCCATACAGCCTGTACCAACTACTAGCGGTCCCCCAGTTGGCTCAGGGCCCGGTCCCGGGTCCATGGCGATGCCT
CTCCGTCCCATTGCCAGCATGGCGCCCCATCCGTCTGCCCAGCCCACCACCGAGCCGCCCCATCAGACCATGGGC
CCGACTGCCATACCATATAGGAGCTTTGCCACATACCATTCCTCGATGCCACCAAGTCTTGGTGGGACTGGCATG
GCCGGAATGCATCATGCTGGCAACTCCATGTCTGTCATTCCCAACATAAGTATTTACACGCAAGGAGGCCCGGGC
TCGTATGGACTTGCTGCACATCACACAGACCGTGCCTCTCAGTCACAATCGGAGCGTCCATTCAAGTGCGACCAG
TGTACCCAGTCCTTTAGTCGAAATCACGACCTCAAGCGCCACAAAAGAATTCATCTCGCCGTCAAGCCCTTTCCC
TGCACCTTCTGCGCCAAGAGCTTTTCACGCAAGGATGCTCTCAAGGTAATTTGTTCCCTGTTGTTTTGCCACTCT
TGATTCTCACTAACAATTGGCTGCAGAGGCACCGGCTGGTCAAAGGATGCGAGAACAAGGTCAAGAATGGAACCA
TCAACAGTACCTTGGACGGACGAACTCCTCACCCTCCGTCCGACATTAAGCAGCCTCTAGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail