Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6170
Gene name
LocationContig_610:5849..7691
Strand+
Gene length (bp)1842
Transcript length (bp)1842
Coding sequence length (bp)1842
Protein length (aa) 614

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01375 Enterotoxin_a Heat-labile enterotoxin alpha chain 5.2E-19 60 268

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P13810|E2AA_ECOLX Heat-labile enterotoxin IIA, A chain OS=Escherichia coli PE=3 SV=1 62 228 6.0E-11
sp|A2PU44|CHELT_VIBCL NAD(+)--arginine ADP-ribosyltransferase Chelt OS=Vibrio cholerae GN=A51_B1772 PE=1 SV=1 61 195 3.0E-10
sp|P43528|E2BA_ECOLX Heat-labile enterotoxin IIB, A chain OS=Escherichia coli PE=1 SV=2 63 181 9.0E-09
sp|P43530|ELAH_ECOH1 Heat-labile enterotoxin A chain OS=Escherichia coli O78:H11 (strain H10407 / ETEC) GN=eltA PE=3 SV=1 62 230 9.0E-06

GO

GO Term Description Terminal node
GO:0005615 extracellular space Yes
GO:0090729 toxin activity Yes
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 33 0.45

Transmembrane Domains

Domain # Start End Length
1 13 35 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6170
MLLFGQGATQNRFAPPLLLWTALYMLLGLAQAFPSQEAALLAKRQKPHRQARFLPPSEITTLYRGERRSPEEIEK
AGGFFTKQVLEKLTPEQEEASSSLWSHVTQKTNQYTKYISTTADPSVAYNFAAKGPQGGWVYVISPDKQIVDATG
TLGDYIELKFRNEFEYSAVGSIPFSQVKGWYPSQSIPERDIQRLRNGETLDGFVQNPSYDARFDSTRASGVRYEL
AGFGPQVKEAFADKNFKKLKGKSTYQALQQFVTDVVCDGKTACTAEFWKSSYPQSPPAQGGAPDEPQPGPSTPGD
DPEANPSKPKDPKPDPFKSKDPKPRPSKSKKIPGSGTDRNELQNRKPKGIKSPCVIAKKAKRAVDCDVTERAKYQ
AAGEFEVEYEKVGKRAPFTFQAREIEALEVEGRAPAGSAAQIESPEILERIVPAKAEFLTMNLINQLNKNNTPFW
QELVDGLKKSEFTIADCQIGFKKALSNTLNRRYTEFDNVDHALGSIFNIAMDMADVFTLRPPPGFYMDLIAEIPR
ECKAVAAAKTPEDKLKVASEDVDTLVQVWSDYTPVGIETQTWAERLAKNPNVTPVKAVETTIYDFWSFTPIGWLF
NQAFPSVREQIEN*
Coding >OphauG2|6170
ATGCTGCTCTTTGGTCAAGGCGCCACTCAAAACAGATTTGCGCCACCACTCCTTCTATGGACGGCACTATACATG
CTTCTCGGGCTTGCACAAGCCTTTCCCAGCCAAGAGGCCGCTCTCCTAGCCAAACGCCAAAAGCCCCATCGACAA
GCCAGATTCCTACCCCCTAGCGAAATCACCACTCTTTACCGCGGAGAAAGACGGTCCCCGGAAGAAATCGAAAAG
GCTGGCGGCTTCTTCACCAAGCAGGTCCTAGAAAAGCTGACGCCCGAACAAGAGGAAGCCAGCAGCAGCTTGTGG
TCCCACGTCACCCAAAAGACCAACCAGTACACCAAATACATTTCCACCACTGCTGATCCGTCCGTGGCGTACAAC
TTTGCCGCCAAAGGCCCACAGGGCGGCTGGGTATACGTGATTAGTCCTGATAAGCAAATTGTTGATGCTACCGGC
ACACTTGGAGACTACATTGAACTCAAGTTCCGCAACGAGTTTGAATACTCGGCGGTGGGGAGCATTCCCTTTTCC
CAAGTCAAGGGCTGGTACCCTTCGCAATCTATTCCCGAGCGAGACATTCAGAGACTGAGAAATGGAGAGACGCTG
GACGGCTTTGTCCAGAATCCCAGCTACGACGCCAGGTTTGACTCGACTCGGGCTTCAGGCGTGCGCTACGAGCTG
GCTGGATTCGGCCCCCAAGTCAAGGAAGCGTTTGCGGACAAAAACTTTAAGAAACTCAAGGGCAAGAGCACATAT
CAAGCCTTGCAACAATTCGTCACGGATGTTGTCTGCGACGGCAAGACGGCGTGTACTGCCGAGTTTTGGAAGTCG
TCGTATCCCCAGTCACCACCGGCACAGGGCGGCGCGCCAGACGAGCCTCAGCCTGGCCCGTCGACGCCCGGCGAT
GATCCCGAAGCCAACCCTTCCAAGCCCAAGGATCCCAAGCCAGACCCTTTCAAATCCAAAGACCCCAAGCCTCGG
CCTTCCAAATCCAAAAAGATTCCAGGCTCCGGCACTGATCGAAACGAGCTTCAAAACAGAAAGCCAAAGGGCATC
AAGAGCCCTTGCGTCATTGCCAAAAAGGCCAAGCGGGCTGTCGACTGCGACGTGACGGAGCGAGCAAAGTACCAG
GCGGCGGGCGAGTTTGAAGTCGAGTATGAAAAAGTAGGCAAACGGGCGCCGTTTACGTTCCAGGCGCGCGAAATC
GAGGCCCTCGAGGTCGAGGGACGCGCTCCCGCAGGATCAGCGGCCCAAATCGAGTCTCCCGAGATTCTGGAAAGA
ATTGTGCCTGCCAAAGCCGAGTTTTTAACAATGAATCTCATCAACCAGCTCAACAAGAACAACACTCCCTTTTGG
CAAGAGCTGGTCGACGGGCTCAAGAAGAGTGAATTCACCATTGCAGACTGCCAAATCGGCTTCAAAAAGGCCTTG
TCAAACACGCTCAACAGGCGATATACCGAATTCGACAATGTCGACCATGCCTTGGGCTCCATCTTCAACATTGCC
ATGGACATGGCGGATGTCTTTACCCTGCGGCCGCCTCCGGGCTTCTACATGGATCTGATTGCCGAGATTCCCCGG
GAGTGCAAGGCCGTTGCTGCTGCCAAGACGCCCGAGGACAAGCTCAAGGTGGCTAGCGAGGACGTGGACACCTTG
GTCCAAGTCTGGTCCGACTACACCCCCGTGGGAATCGAGACCCAGACCTGGGCTGAGCGCCTGGCCAAGAATCCT
AATGTCACGCCCGTCAAGGCTGTGGAAACTACGATTTACGATTTCTGGTCATTTACACCGATTGGCTGGCTGTTT
AACCAGGCTTTCCCTTCGGTGCGGGAGCAAATCGAGAACTGA
Transcript >OphauG2|6170
ATGCTGCTCTTTGGTCAAGGCGCCACTCAAAACAGATTTGCGCCACCACTCCTTCTATGGACGGCACTATACATG
CTTCTCGGGCTTGCACAAGCCTTTCCCAGCCAAGAGGCCGCTCTCCTAGCCAAACGCCAAAAGCCCCATCGACAA
GCCAGATTCCTACCCCCTAGCGAAATCACCACTCTTTACCGCGGAGAAAGACGGTCCCCGGAAGAAATCGAAAAG
GCTGGCGGCTTCTTCACCAAGCAGGTCCTAGAAAAGCTGACGCCCGAACAAGAGGAAGCCAGCAGCAGCTTGTGG
TCCCACGTCACCCAAAAGACCAACCAGTACACCAAATACATTTCCACCACTGCTGATCCGTCCGTGGCGTACAAC
TTTGCCGCCAAAGGCCCACAGGGCGGCTGGGTATACGTGATTAGTCCTGATAAGCAAATTGTTGATGCTACCGGC
ACACTTGGAGACTACATTGAACTCAAGTTCCGCAACGAGTTTGAATACTCGGCGGTGGGGAGCATTCCCTTTTCC
CAAGTCAAGGGCTGGTACCCTTCGCAATCTATTCCCGAGCGAGACATTCAGAGACTGAGAAATGGAGAGACGCTG
GACGGCTTTGTCCAGAATCCCAGCTACGACGCCAGGTTTGACTCGACTCGGGCTTCAGGCGTGCGCTACGAGCTG
GCTGGATTCGGCCCCCAAGTCAAGGAAGCGTTTGCGGACAAAAACTTTAAGAAACTCAAGGGCAAGAGCACATAT
CAAGCCTTGCAACAATTCGTCACGGATGTTGTCTGCGACGGCAAGACGGCGTGTACTGCCGAGTTTTGGAAGTCG
TCGTATCCCCAGTCACCACCGGCACAGGGCGGCGCGCCAGACGAGCCTCAGCCTGGCCCGTCGACGCCCGGCGAT
GATCCCGAAGCCAACCCTTCCAAGCCCAAGGATCCCAAGCCAGACCCTTTCAAATCCAAAGACCCCAAGCCTCGG
CCTTCCAAATCCAAAAAGATTCCAGGCTCCGGCACTGATCGAAACGAGCTTCAAAACAGAAAGCCAAAGGGCATC
AAGAGCCCTTGCGTCATTGCCAAAAAGGCCAAGCGGGCTGTCGACTGCGACGTGACGGAGCGAGCAAAGTACCAG
GCGGCGGGCGAGTTTGAAGTCGAGTATGAAAAAGTAGGCAAACGGGCGCCGTTTACGTTCCAGGCGCGCGAAATC
GAGGCCCTCGAGGTCGAGGGACGCGCTCCCGCAGGATCAGCGGCCCAAATCGAGTCTCCCGAGATTCTGGAAAGA
ATTGTGCCTGCCAAAGCCGAGTTTTTAACAATGAATCTCATCAACCAGCTCAACAAGAACAACACTCCCTTTTGG
CAAGAGCTGGTCGACGGGCTCAAGAAGAGTGAATTCACCATTGCAGACTGCCAAATCGGCTTCAAAAAGGCCTTG
TCAAACACGCTCAACAGGCGATATACCGAATTCGACAATGTCGACCATGCCTTGGGCTCCATCTTCAACATTGCC
ATGGACATGGCGGATGTCTTTACCCTGCGGCCGCCTCCGGGCTTCTACATGGATCTGATTGCCGAGATTCCCCGG
GAGTGCAAGGCCGTTGCTGCTGCCAAGACGCCCGAGGACAAGCTCAAGGTGGCTAGCGAGGACGTGGACACCTTG
GTCCAAGTCTGGTCCGACTACACCCCCGTGGGAATCGAGACCCAGACCTGGGCTGAGCGCCTGGCCAAGAATCCT
AATGTCACGCCCGTCAAGGCTGTGGAAACTACGATTTACGATTTCTGGTCATTTACACCGATTGGCTGGCTGTTT
AACCAGGCTTTCCCTTCGGTGCGGGAGCAAATCGAGAACTGA
Gene >OphauG2|6170
ATGCTGCTCTTTGGTCAAGGCGCCACTCAAAACAGATTTGCGCCACCACTCCTTCTATGGACGGCACTATACATG
CTTCTCGGGCTTGCACAAGCCTTTCCCAGCCAAGAGGCCGCTCTCCTAGCCAAACGCCAAAAGCCCCATCGACAA
GCCAGATTCCTACCCCCTAGCGAAATCACCACTCTTTACCGCGGAGAAAGACGGTCCCCGGAAGAAATCGAAAAG
GCTGGCGGCTTCTTCACCAAGCAGGTCCTAGAAAAGCTGACGCCCGAACAAGAGGAAGCCAGCAGCAGCTTGTGG
TCCCACGTCACCCAAAAGACCAACCAGTACACCAAATACATTTCCACCACTGCTGATCCGTCCGTGGCGTACAAC
TTTGCCGCCAAAGGCCCACAGGGCGGCTGGGTATACGTGATTAGTCCTGATAAGCAAATTGTTGATGCTACCGGC
ACACTTGGAGACTACATTGAACTCAAGTTCCGCAACGAGTTTGAATACTCGGCGGTGGGGAGCATTCCCTTTTCC
CAAGTCAAGGGCTGGTACCCTTCGCAATCTATTCCCGAGCGAGACATTCAGAGACTGAGAAATGGAGAGACGCTG
GACGGCTTTGTCCAGAATCCCAGCTACGACGCCAGGTTTGACTCGACTCGGGCTTCAGGCGTGCGCTACGAGCTG
GCTGGATTCGGCCCCCAAGTCAAGGAAGCGTTTGCGGACAAAAACTTTAAGAAACTCAAGGGCAAGAGCACATAT
CAAGCCTTGCAACAATTCGTCACGGATGTTGTCTGCGACGGCAAGACGGCGTGTACTGCCGAGTTTTGGAAGTCG
TCGTATCCCCAGTCACCACCGGCACAGGGCGGCGCGCCAGACGAGCCTCAGCCTGGCCCGTCGACGCCCGGCGAT
GATCCCGAAGCCAACCCTTCCAAGCCCAAGGATCCCAAGCCAGACCCTTTCAAATCCAAAGACCCCAAGCCTCGG
CCTTCCAAATCCAAAAAGATTCCAGGCTCCGGCACTGATCGAAACGAGCTTCAAAACAGAAAGCCAAAGGGCATC
AAGAGCCCTTGCGTCATTGCCAAAAAGGCCAAGCGGGCTGTCGACTGCGACGTGACGGAGCGAGCAAAGTACCAG
GCGGCGGGCGAGTTTGAAGTCGAGTATGAAAAAGTAGGCAAACGGGCGCCGTTTACGTTCCAGGCGCGCGAAATC
GAGGCCCTCGAGGTCGAGGGACGCGCTCCCGCAGGATCAGCGGCCCAAATCGAGTCTCCCGAGATTCTGGAAAGA
ATTGTGCCTGCCAAAGCCGAGTTTTTAACAATGAATCTCATCAACCAGCTCAACAAGAACAACACTCCCTTTTGG
CAAGAGCTGGTCGACGGGCTCAAGAAGAGTGAATTCACCATTGCAGACTGCCAAATCGGCTTCAAAAAGGCCTTG
TCAAACACGCTCAACAGGCGATATACCGAATTCGACAATGTCGACCATGCCTTGGGCTCCATCTTCAACATTGCC
ATGGACATGGCGGATGTCTTTACCCTGCGGCCGCCTCCGGGCTTCTACATGGATCTGATTGCCGAGATTCCCCGG
GAGTGCAAGGCCGTTGCTGCTGCCAAGACGCCCGAGGACAAGCTCAAGGTGGCTAGCGAGGACGTGGACACCTTG
GTCCAAGTCTGGTCCGACTACACCCCCGTGGGAATCGAGACCCAGACCTGGGCTGAGCGCCTGGCCAAGAATCCT
AATGTCACGCCCGTCAAGGCTGTGGAAACTACGATTTACGATTTCTGGTCATTTACACCGATTGGCTGGCTGTTT
AACCAGGCTTTCCCTTCGGTGCGGGAGCAAATCGAGAACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail