Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6168
Gene name
LocationContig_610:319..1243
Strand-
Gene length (bp)924
Transcript length (bp)807
Coding sequence length (bp)807
Protein length (aa) 269

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13023 HD_3 HD domain 2.0E-50 60 206
PF12917 YfbR-like 5'-deoxynucleotidase YfbR-like 7.7E-07 55 196

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87242|YC0H_SCHPO HD domain-containing protein C4G3.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4G3.17 PE=3 SV=1 49 242 6.0E-42
sp|P38331|YB92_YEAST HD domain-containing protein YBR242W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR242W PE=1 SV=1 53 238 1.0E-41
sp|P53144|YGK1_YEAST HD domain-containing protein YGL101W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGL101W PE=1 SV=1 53 237 5.0E-38
sp|Q66L17|HDDC2_XENLA HD domain-containing protein 2 OS=Xenopus laevis GN=hddc2 PE=2 SV=1 44 210 2.0E-33
sp|Q54FK1|HDDC2_DICDI HD domain-containing protein 2 homolog OS=Dictyostelium discoideum GN=hddc2 PE=3 SV=1 50 203 3.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87242|YC0H_SCHPO HD domain-containing protein C4G3.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4G3.17 PE=3 SV=1 49 242 6.0E-42
sp|P38331|YB92_YEAST HD domain-containing protein YBR242W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR242W PE=1 SV=1 53 238 1.0E-41
sp|P53144|YGK1_YEAST HD domain-containing protein YGL101W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGL101W PE=1 SV=1 53 237 5.0E-38
sp|Q66L17|HDDC2_XENLA HD domain-containing protein 2 OS=Xenopus laevis GN=hddc2 PE=2 SV=1 44 210 2.0E-33
sp|Q54FK1|HDDC2_DICDI HD domain-containing protein 2 homolog OS=Dictyostelium discoideum GN=hddc2 PE=3 SV=1 50 203 3.0E-31
sp|Q1LUI2|HDDC2_DANRE HD domain-containing protein 2 OS=Danio rerio GN=hddc2 PE=2 SV=1 53 210 9.0E-30
sp|Q3SXD3|HDDC2_MOUSE HD domain-containing protein 2 OS=Mus musculus GN=Hddc2 PE=1 SV=1 53 198 3.0E-22
sp|Q0P565|HDDC2_BOVIN HD domain-containing protein 2 OS=Bos taurus GN=HDDC2 PE=2 SV=1 53 198 9.0E-22
sp|Q7Z4H3|HDDC2_HUMAN HD domain-containing protein 2 OS=Homo sapiens GN=HDDC2 PE=1 SV=1 51 198 9.0E-22
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6168
MKSGSEEKTGSKPDLANIGYTPAAKVSEPWTVEKVLAEIPGDLSLKQTSSSPLVFFHLLERLKTTKREGWRRFGI
SHGESIADHMYRMSIISMLAPPSLAARLDLGKCIKMCLVHDMAELIVGDITPVDGVPKPEKSRRETNTMEYLTSL
LNDGNQCAAAGAELGAIWQEYEDAETLESRFVHDVDKMELLLQMMEYERRAQQTLDLGEFAYVARKMGLAETRVW
AEELLGERREFWGIRERVDGDLGTNGGVAEERNEQQEAYYSQS*
Coding >OphauG2|6168
ATGAAGTCTGGGAGCGAGGAAAAGACAGGCTCCAAGCCAGACCTTGCCAATATTGGATACACGCCTGCGGCCAAA
GTGTCGGAGCCATGGACGGTGGAAAAAGTCTTGGCGGAAATCCCTGGCGACTTGTCGCTGAAACAAACGTCGTCG
TCGCCGCTTGTTTTCTTCCACTTGCTGGAGCGGCTCAAGACGACCAAGCGTGAGGGATGGAGGAGATTTGGCATT
TCCCATGGCGAATCCATTGCCGACCACATGTATCGCATGTCCATCATCTCGATGCTCGCGCCCCCGTCGCTCGCG
GCGCGGCTCGACCTGGGCAAATGCATCAAGATGTGTTTGGTGCACGACATGGCGGAACTGATTGTTGGAGACATC
ACCCCCGTGGACGGGGTTCCCAAGCCGGAAAAGAGCCGGCGCGAAACAAACACCATGGAGTATCTAACAAGCCTG
CTCAACGATGGCAATCAATGTGCAGCAGCTGGGGCGGAATTGGGAGCCATTTGGCAAGAGTACGAGGACGCAGAG
ACGTTGGAGAGCAGATTTGTGCACGACGTGGATAAAATGGAACTCTTGTTGCAAATGATGGAGTATGAGCGGCGC
GCGCAGCAGACGCTGGACTTGGGCGAATTTGCCTATGTTGCGCGCAAAATGGGCTTGGCTGAGACGCGGGTCTGG
GCTGAGGAGCTGCTGGGCGAGCGACGCGAGTTTTGGGGCATTCGGGAGCGTGTTGATGGCGACTTGGGGACGAAT
GGCGGCGTGGCCGAGGAACGAAACGAGCAGCAAGAGGCCTACTATTCGCAGAGCTAA
Transcript >OphauG2|6168
ATGAAGTCTGGGAGCGAGGAAAAGACAGGCTCCAAGCCAGACCTTGCCAATATTGGATACACGCCTGCGGCCAAA
GTGTCGGAGCCATGGACGGTGGAAAAAGTCTTGGCGGAAATCCCTGGCGACTTGTCGCTGAAACAAACGTCGTCG
TCGCCGCTTGTTTTCTTCCACTTGCTGGAGCGGCTCAAGACGACCAAGCGTGAGGGATGGAGGAGATTTGGCATT
TCCCATGGCGAATCCATTGCCGACCACATGTATCGCATGTCCATCATCTCGATGCTCGCGCCCCCGTCGCTCGCG
GCGCGGCTCGACCTGGGCAAATGCATCAAGATGTGTTTGGTGCACGACATGGCGGAACTGATTGTTGGAGACATC
ACCCCCGTGGACGGGGTTCCCAAGCCGGAAAAGAGCCGGCGCGAAACAAACACCATGGAGTATCTAACAAGCCTG
CTCAACGATGGCAATCAATGTGCAGCAGCTGGGGCGGAATTGGGAGCCATTTGGCAAGAGTACGAGGACGCAGAG
ACGTTGGAGAGCAGATTTGTGCACGACGTGGATAAAATGGAACTCTTGTTGCAAATGATGGAGTATGAGCGGCGC
GCGCAGCAGACGCTGGACTTGGGCGAATTTGCCTATGTTGCGCGCAAAATGGGCTTGGCTGAGACGCGGGTCTGG
GCTGAGGAGCTGCTGGGCGAGCGACGCGAGTTTTGGGGCATTCGGGAGCGTGTTGATGGCGACTTGGGGACGAAT
GGCGGCGTGGCCGAGGAACGAAACGAGCAGCAAGAGGCCTACTATTCGCAGAGCTAA
Gene >OphauG2|6168
ATGAAGTCTGGGAGCGAGGAAAAGACAGGCTCCAAGCCAGACCTTGCCAGTAGGACGCTTGTGAGGCGGCGAGAT
GGCCAAGGCTAACTCTTGCCATGGCAGATATTGGATACACGCCTGCGGCCAAAGTGTCGGAGCCATGGACGGTGG
AAAAAGTCTTGGCGGAAATCCCTGGCGACTTGTCGCTGAAACAAACGTCGTCGTCGCCGCTTGTTTTCTTCCACT
TGCTGGAGCGGCTCAAGACGACCAAGCGTGAGGGATGGAGGAGATTTGGCATTTCCCAGTGAGGCAATCTTGGAA
CAAGACAAGAAAAAGAGGAAGCGTCATGAAGCCGCTGACAAGTCTAGTGGCGAATCCATTGCCGACCACATGTAT
CGCATGTCCATCATCTCGATGCTCGCGCCCCCGTCGCTCGCGGCGCGGCTCGACCTGGGCAAATGCATCAAGATG
TGTTTGGTGCACGACATGGCGGAACTGATTGTTGGAGACATCACCCCCGTGGACGGGGTTCCCAAGCCGGAAAAG
AGCCGGCGCGAAACAAACACCATGGAGTATCTAACAAGCCTGCTCAACGATGGCAATCAATGTGCAGCAGCTGGG
GCGGAATTGGGAGCCATTTGGCAAGAGTACGAGGACGCAGAGACGTTGGAGAGCAGATTTGTGCACGACGTGGAT
AAAATGGAACTCTTGTTGCAAATGATGGAGTATGAGCGGCGCGCGCAGCAGACGCTGGACTTGGGCGAATTTGCC
TATGTTGCGCGCAAAATGGGCTTGGCTGAGACGCGGGTCTGGGCTGAGGAGCTGCTGGGCGAGCGACGCGAGTTT
TGGGGCATTCGGGAGCGTGTTGATGGCGACTTGGGGACGAATGGCGGCGTGGCCGAGGAACGAAACGAGCAGCAA
GAGGCCTACTATTCGCAGAGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail