Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6167
Gene name
LocationContig_61:38405..39414
Strand-
Gene length (bp)1009
Transcript length (bp)720
Coding sequence length (bp)720
Protein length (aa) 240

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01997 Translin Translin family 1.3E-47 27 233

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7V3|TSN1_SCHPO Translin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tsn1 PE=1 SV=2 9 235 4.0E-41
sp|P79769|TSN_CHICK Translin OS=Gallus gallus GN=TSN PE=1 SV=1 12 234 7.0E-37
sp|Q15631|TSN_HUMAN Translin OS=Homo sapiens GN=TSN PE=1 SV=1 12 234 2.0E-35
sp|Q08DM8|TSN_BOVIN Translin OS=Bos taurus GN=TSN PE=2 SV=1 13 234 3.0E-35
sp|Q62348|TSN_MOUSE Translin OS=Mus musculus GN=Tsn PE=1 SV=1 13 234 5.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7V3|TSN1_SCHPO Translin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tsn1 PE=1 SV=2 9 235 4.0E-41
sp|P79769|TSN_CHICK Translin OS=Gallus gallus GN=TSN PE=1 SV=1 12 234 7.0E-37
sp|Q15631|TSN_HUMAN Translin OS=Homo sapiens GN=TSN PE=1 SV=1 12 234 2.0E-35
sp|Q08DM8|TSN_BOVIN Translin OS=Bos taurus GN=TSN PE=2 SV=1 13 234 3.0E-35
sp|Q62348|TSN_MOUSE Translin OS=Mus musculus GN=Tsn PE=1 SV=1 13 234 5.0E-35
sp|Q5R7P2|TSN_PONAB Translin OS=Pongo abelii GN=TSN PE=2 SV=1 12 234 6.0E-35
sp|P97891|TSN_CRIGR Translin OS=Cricetulus griseus GN=TSN PE=2 SV=1 13 234 7.0E-35
[Show less]

GO

GO Term Description Terminal node
GO:0043565 sequence-specific DNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0003677 DNA binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6167
MASNASSFLDPSIFATLEAQLEQEAQVRDAIGQIVQRLDRAVASAQGLLSRVHSTRPAQYDQLAAQVEEAVRQQI
PIIHELDALASQHPYYKYNNKWSRAVQNAMCTAIYCAWLGGFANGQPSHVGHLLTLDQVGSIFAIPINLTDRDAF
HLTIEQYLLTLPDLTQDLARLASNAVTLGDFSLPLTIADFIKHIFAAFQLLNLKNDALRRRADGLKYDVKRVEDV
VYDLSLRGLISRPE*
Coding >OphauG2|6167
ATGGCTAGCAATGCCTCGTCGTTTCTGGATCCGTCCATCTTTGCGACGCTCGAAGCGCAACTAGAACAAGAAGCA
CAGGTCCGCGACGCCATTGGGCAAATCGTGCAGCGCCTCGATCGCGCCGTTGCCTCTGCCCAGGGCCTCTTGTCT
CGCGTCCATTCGACTCGGCCTGCACAATATGACCAACTCGCCGCACAGGTTGAAGAGGCAGTCCGCCAGCAAATA
CCCATAATACACGAGCTCGATGCCCTCGCTTCTCAGCATCCATACTACAAATACAATAATAAGTGGTCCCGCGCT
GTCCAAAATGCAATGTGTACTGCCATTTACTGTGCCTGGCTTGGTGGCTTTGCAAACGGCCAGCCGTCACATGTC
GGCCACCTGCTTACTCTTGATCAAGTCGGCTCTATATTTGCGATCCCTATTAACCTCACCGACCGTGATGCTTTT
CACCTTACAATCGAGCAATATCTTCTCACTCTCCCCGACCTGACGCAGGACCTCGCTCGCCTCGCCTCCAACGCC
GTTACCCTTGGCGACTTTTCTCTCCCCCTCACCATTGCCGACTTTATCAAGCACATCTTTGCTGCCTTTCAGCTT
CTCAATCTCAAGAACGATGCTCTACGCCGTCGTGCCGATGGCCTCAAGTACGACGTCAAGCGTGTGGAAGATGTT
GTATACGATCTGAGCTTGCGTGGCTTGATATCTCGCCCAGAGTAG
Transcript >OphauG2|6167
ATGGCTAGCAATGCCTCGTCGTTTCTGGATCCGTCCATCTTTGCGACGCTCGAAGCGCAACTAGAACAAGAAGCA
CAGGTCCGCGACGCCATTGGGCAAATCGTGCAGCGCCTCGATCGCGCCGTTGCCTCTGCCCAGGGCCTCTTGTCT
CGCGTCCATTCGACTCGGCCTGCACAATATGACCAACTCGCCGCACAGGTTGAAGAGGCAGTCCGCCAGCAAATA
CCCATAATACACGAGCTCGATGCCCTCGCTTCTCAGCATCCATACTACAAATACAATAATAAGTGGTCCCGCGCT
GTCCAAAATGCAATGTGTACTGCCATTTACTGTGCCTGGCTTGGTGGCTTTGCAAACGGCCAGCCGTCACATGTC
GGCCACCTGCTTACTCTTGATCAAGTCGGCTCTATATTTGCGATCCCTATTAACCTCACCGACCGTGATGCTTTT
CACCTTACAATCGAGCAATATCTTCTCACTCTCCCCGACCTGACGCAGGACCTCGCTCGCCTCGCCTCCAACGCC
GTTACCCTTGGCGACTTTTCTCTCCCCCTCACCATTGCCGACTTTATCAAGCACATCTTTGCTGCCTTTCAGCTT
CTCAATCTCAAGAACGATGCTCTACGCCGTCGTGCCGATGGCCTCAAGTACGACGTCAAGCGTGTGGAAGATGTT
GTATACGATCTGAGCTTGCGTGGCTTGATATCTCGCCCAGAGTAG
Gene >OphauG2|6167
ATGGCTAGCAATGCCTCGTCGTTTCTGGATCCGTCCATCTTTGCGACGCTCGAAGCGCAACTAGAACAAGAAGCA
CAGGTCCGCGACGCCATTGGGCAAATCGTGCAGCGCCTCGATCGCGCCGTTGCCTCTGCCCAGGGCCTCTTGTCT
CGCGTCCATTCGACTCGGCCTGCACAATGTGCGTATGTCTTGACACTCGATGGATCTGCTCTTGTCTTGCAGAGA
GCTATCTAGATGCAGTGAGGAGACATATATAGGTAGTGCTAACGAGTCTAGATGACCAACTCGCCGCACAGGTTG
AAGAGGCAGTCCGCCAGCAAATACCCATAATACACGAGCTCGATGCCCTCGCTTCTCAGCATCCATACTACAAGT
GCGTCTCGCTTGACTCGAGCATACCGGCCCCCGTCCACGTATAATATAGCTCACGGCCCACAAGATACAATAATA
AGTGGTCCCGCGCTGTCCAAAATGCAATGTGTACTGCCATTTACTGTGCCTGGCTTGGTGGCTTTGCAAACGGCC
AGCCGTCACATGTCGGCCACCTGCTTACTCTTGATCAAGTCGGCTCTATATTTGCGAGTAAGCATCGTCTCGCTC
GGTCTGTCTTTTGTTACGCTCTCTTGAATTTCCCTAGTCTTGCCTGTTACAAATATGATGCAGCAAACAAGAAAT
ATTTAAAAGGACAAAACTAACAACACGACTAGTCCCTATTAACCTCACCGACCGTGATGCTTTTCACCTTACAAT
CGAGCAATATCTTCTCACTCTCCCCGACCTGACGCAGGACCTCGCTCGCCTCGCCTCCAACGCCGTTACCCTTGG
CGACTTTTCTCTCCCCCTCACCATTGCCGACTTTATCAAGCACATCTTTGCTGCCTTTCAGCTTCTCAATCTCAA
GAACGATGCTCTACGCCGTCGTGCCGATGGCCTCAAGTACGACGTCAAGCGTGTGGAAGATGTTGTATACGATCT
GAGCTTGCGTGGCTTGATATCTCGCCCAGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail