Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6158
Gene name
LocationContig_61:15158..15569
Strand+
Gene length (bp)411
Transcript length (bp)411
Coding sequence length (bp)411
Protein length (aa) 137

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 25 0.999664

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4838
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|158
Ophiocordyceps australis 1348a (Ghana) OphauG2|2970
Ophiocordyceps australis 1348a (Ghana) OphauG2|6158 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2583
Ophiocordyceps subramaniannii Hirsu2|10799
Ophiocordyceps subramaniannii Hirsu2|5805

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6158
MKGAHITLPTLQLAASAFFIAAAQAEEVNHDPKVTYCVDEGRQVVESENCDGSQPQGRFFYIRGLYDEDKPAGTN
LTEAPHYFIDSSDIEARLAHGLDKRGAITRSGFGKRDMSNELYRRACASGEGIPARFGRGG*
Coding >OphauG2|6158
ATGAAGGGCGCACACATCACTCTCCCAACTCTGCAGCTTGCCGCCTCGGCCTTTTTCATTGCAGCGGCCCAGGCC
GAAGAGGTTAATCATGATCCCAAAGTGACCTACTGCGTCGACGAGGGGAGACAGGTTGTGGAATCGGAAAATTGC
GATGGAAGCCAGCCCCAGGGACGCTTCTTCTACATCAGAGGCCTTTACGACGAGGATAAGCCTGCCGGAACCAAC
CTTACAGAGGCGCCCCACTACTTTATTGACAGCTCAGACATTGAAGCGCGTCTGGCACATGGACTGGATAAACGT
GGTGCTATTACGAGGAGTGGCTTTGGAAAGAGGGACATGTCGAATGAACTTTATCGCCGAGCGTGCGCTTCTGGT
GAGGGTATCCCGGCTCGATTCGGCAGGGGTGGTTAG
Transcript >OphauG2|6158
ATGAAGGGCGCACACATCACTCTCCCAACTCTGCAGCTTGCCGCCTCGGCCTTTTTCATTGCAGCGGCCCAGGCC
GAAGAGGTTAATCATGATCCCAAAGTGACCTACTGCGTCGACGAGGGGAGACAGGTTGTGGAATCGGAAAATTGC
GATGGAAGCCAGCCCCAGGGACGCTTCTTCTACATCAGAGGCCTTTACGACGAGGATAAGCCTGCCGGAACCAAC
CTTACAGAGGCGCCCCACTACTTTATTGACAGCTCAGACATTGAAGCGCGTCTGGCACATGGACTGGATAAACGT
GGTGCTATTACGAGGAGTGGCTTTGGAAAGAGGGACATGTCGAATGAACTTTATCGCCGAGCGTGCGCTTCTGGT
GAGGGTATCCCGGCTCGATTCGGCAGGGGTGGTTAG
Gene >OphauG2|6158
ATGAAGGGCGCACACATCACTCTCCCAACTCTGCAGCTTGCCGCCTCGGCCTTTTTCATTGCAGCGGCCCAGGCC
GAAGAGGTTAATCATGATCCCAAAGTGACCTACTGCGTCGACGAGGGGAGACAGGTTGTGGAATCGGAAAATTGC
GATGGAAGCCAGCCCCAGGGACGCTTCTTCTACATCAGAGGCCTTTACGACGAGGATAAGCCTGCCGGAACCAAC
CTTACAGAGGCGCCCCACTACTTTATTGACAGCTCAGACATTGAAGCGCGTCTGGCACATGGACTGGATAAACGT
GGTGCTATTACGAGGAGTGGCTTTGGAAAGAGGGACATGTCGAATGAACTTTATCGCCGAGCGTGCGCTTCTGGT
GAGGGTATCCCGGCTCGATTCGGCAGGGGTGGTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail