Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6150
Gene name
LocationContig_609:665..4051
Strand+
Gene length (bp)3386
Transcript length (bp)3171
Coding sequence length (bp)3171
Protein length (aa) 1057

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 2.9E-34 465 675
PF11987 IF-2 Translation-initiation factor 2 3.3E-22 790 901
PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2 8.1E-08 702 778
PF01926 MMR_HSR1 50S ribosome-binding GTPase 3.0E-05 466 589

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10251|IF2P_SCHPO Eukaryotic translation initiation factor 5B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC56F8.03 PE=1 SV=1 179 1055 0.0E+00
sp|Q05D44|IF2P_MOUSE Eukaryotic translation initiation factor 5B OS=Mus musculus GN=Eif5b PE=1 SV=2 457 1055 0.0E+00
sp|B2GUV7|IF2P_RAT Eukaryotic translation initiation factor 5B OS=Rattus norvegicus GN=Eif5b PE=1 SV=1 457 1055 0.0E+00
sp|O60841|IF2P_HUMAN Eukaryotic translation initiation factor 5B OS=Homo sapiens GN=EIF5B PE=1 SV=4 439 1055 0.0E+00
sp|Q5RDE1|IF2P_PONAB Eukaryotic translation initiation factor 5B OS=Pongo abelii GN=EIF5B PE=2 SV=2 457 1055 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10251|IF2P_SCHPO Eukaryotic translation initiation factor 5B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC56F8.03 PE=1 SV=1 179 1055 0.0E+00
sp|Q05D44|IF2P_MOUSE Eukaryotic translation initiation factor 5B OS=Mus musculus GN=Eif5b PE=1 SV=2 457 1055 0.0E+00
sp|B2GUV7|IF2P_RAT Eukaryotic translation initiation factor 5B OS=Rattus norvegicus GN=Eif5b PE=1 SV=1 457 1055 0.0E+00
sp|O60841|IF2P_HUMAN Eukaryotic translation initiation factor 5B OS=Homo sapiens GN=EIF5B PE=1 SV=4 439 1055 0.0E+00
sp|Q5RDE1|IF2P_PONAB Eukaryotic translation initiation factor 5B OS=Pongo abelii GN=EIF5B PE=2 SV=2 457 1055 0.0E+00
sp|Q54XP6|IF2P_DICDI Eukaryotic translation initiation factor 5B OS=Dictyostelium discoideum GN=eif5b PE=3 SV=1 460 1055 0.0E+00
sp|A8A8D3|IF2P_IGNH4 Probable translation initiation factor IF-2 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=infB PE=3 SV=1 453 1050 2.0E-125
sp|A1RXH6|IF2P_THEPD Probable translation initiation factor IF-2 OS=Thermofilum pendens (strain Hrk 5) GN=infB PE=3 SV=1 461 1052 5.0E-123
sp|A3DMS0|IF2P_STAMF Probable translation initiation factor IF-2 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=infB PE=3 SV=1 461 1042 2.0E-120
sp|Q9Y9B3|IF2P_AERPE Probable translation initiation factor IF-2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=infB PE=3 SV=1 460 1046 7.0E-118
sp|A2BJZ8|IF2P_HYPBU Probable translation initiation factor IF-2 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=infB PE=3 SV=1 457 1050 2.0E-116
sp|A4YCQ5|IF2P_METS5 Probable translation initiation factor IF-2 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=infB PE=3 SV=1 461 1050 6.0E-116
sp|A0B8Q6|IF2P_METTP Probable translation initiation factor IF-2 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=infB PE=3 SV=1 445 1045 7.0E-116
sp|Q9HNQ2|IF2P_HALSA Probable translation initiation factor IF-2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=infB PE=3 SV=1 460 1055 1.0E-115
sp|B0R6U5|IF2P_HALS3 Probable translation initiation factor IF-2 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=infB PE=3 SV=1 460 1055 1.0E-115
sp|P95691|IF2P_SULAC Probable translation initiation factor IF-2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=infB PE=3 SV=2 461 1046 5.0E-115
sp|A3CSP4|IF2P_METMJ Probable translation initiation factor IF-2 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=infB PE=3 SV=1 460 1038 2.0E-112
sp|Q976A1|IF2P_SULTO Probable translation initiation factor IF-2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=infB PE=3 SV=1 461 1048 2.0E-112
sp|B6YWH3|IF2P_THEON Probable translation initiation factor IF-2 OS=Thermococcus onnurineus (strain NA1) GN=infB PE=3 SV=1 461 1030 3.0E-112
sp|Q466D5|IF2P_METBF Probable translation initiation factor IF-2 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=infB PE=3 SV=1 460 1042 6.0E-112
sp|Q8PU78|IF2P_METMA Probable translation initiation factor IF-2 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=infB PE=3 SV=1 460 1042 8.0E-112
sp|A2STM8|IF2P_METLZ Probable translation initiation factor IF-2 OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=infB PE=3 SV=1 459 1030 2.0E-111
sp|Q2FU48|IF2P_METHJ Probable translation initiation factor IF-2 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=infB PE=3 SV=1 460 956 3.0E-111
sp|C6A1V3|IF2P_THESM Probable translation initiation factor IF-2 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=infB PE=3 SV=1 461 1024 5.0E-111
sp|A8MBV9|IF2P_CALMQ Probable translation initiation factor IF-2 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=infB PE=3 SV=1 458 1046 2.0E-110
sp|Q8TQL5|IF2P_METAC Probable translation initiation factor IF-2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=infB PE=3 SV=1 460 1042 6.0E-110
sp|Q0W8X2|IF2P_METAR Probable translation initiation factor IF-2 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=infB PE=3 SV=1 452 1049 2.0E-109
sp|B9LQL7|IF2P_HALLT Probable translation initiation factor IF-2 OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=infB PE=3 SV=1 457 1042 1.0E-108
sp|Q12Z93|IF2P_METBU Probable translation initiation factor IF-2 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=infB PE=3 SV=1 459 1055 1.0E-107
sp|O26359|IF2P_METTH Probable translation initiation factor IF-2 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=infB PE=1 SV=1 461 1049 5.0E-107
sp|Q2NGM6|IF2P_METST Probable translation initiation factor IF-2 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=infB PE=3 SV=1 462 1042 2.0E-106
sp|Q18FT0|IF2P_HALWD Probable translation initiation factor IF-2 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=infB PE=3 SV=3 458 1019 3.0E-106
sp|O29490|IF2P_ARCFU Probable translation initiation factor IF-2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=infB PE=3 SV=1 458 1019 2.0E-103
sp|A1RUX2|IF2P_PYRIL Probable translation initiation factor IF-2 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=infB PE=3 SV=1 460 1042 2.0E-102
sp|A6UVG0|IF2P_META3 Probable translation initiation factor IF-2 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=infB PE=3 SV=1 461 1042 2.0E-102
sp|Q5UXU6|IF2P_HALMA Probable translation initiation factor IF-2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=infB PE=3 SV=1 461 1042 5.0E-102
sp|Q980Q8|IF2P_SULSO Probable translation initiation factor IF-2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=infB PE=3 SV=1 455 1046 1.0E-101
sp|A3MTU7|IF2P_PYRCJ Probable translation initiation factor IF-2 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=infB PE=3 SV=1 461 1037 1.0E-101
sp|Q8ZX20|IF2P_PYRAE Probable translation initiation factor IF-2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=infB PE=3 SV=1 460 1037 3.0E-101
sp|A4WIK2|IF2P_PYRAR Probable translation initiation factor IF-2 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=infB PE=3 SV=1 460 1037 8.0E-101
sp|B1YCQ7|IF2P_PYRNV Probable translation initiation factor IF-2 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=infB PE=3 SV=1 461 1037 1.0E-100
sp|A9A813|IF2P_METM6 Probable translation initiation factor IF-2 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=infB PE=3 SV=1 461 1042 1.0E-100
sp|A5UJM9|IF2P_METS3 Probable translation initiation factor IF-2 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=infB PE=3 SV=1 461 1049 4.0E-100
sp|A7IAP7|IF2P_METB6 Probable translation initiation factor IF-2 OS=Methanoregula boonei (strain 6A8) GN=infB PE=3 SV=1 461 956 5.0E-99
sp|A4FZQ3|IF2P_METM5 Probable translation initiation factor IF-2 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=infB PE=3 SV=1 461 1019 7.0E-99
sp|A6VIS4|IF2P_METM7 Probable translation initiation factor IF-2 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=infB PE=3 SV=1 461 955 3.0E-98
sp|Q8TV06|IF2P_METKA Probable translation initiation factor IF-2 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=infB PE=3 SV=1 455 1044 4.0E-98
sp|Q5JGR9|IF2P_THEKO Probable translation initiation factor IF-2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=infB PE=3 SV=1 477 1030 6.0E-98
sp|A6URS1|IF2P_METVS Probable translation initiation factor IF-2 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=infB PE=3 SV=1 461 1048 6.0E-97
sp|Q9UZK7|IF2P_PYRAB Probable translation initiation factor IF-2 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=infB PE=3 SV=1 477 1024 1.0E-96
sp|Q8U1R8|IF2P_PYRFU Probable translation initiation factor IF-2 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=infB PE=3 SV=1 477 1041 5.0E-96
sp|Q6M0I6|IF2P_METMP Probable translation initiation factor IF-2 OS=Methanococcus maripaludis (strain S2 / LL) GN=infB PE=3 SV=1 461 1019 9.0E-96
sp|Q3IMS5|IF2P_NATPD Probable translation initiation factor IF-2 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=infB PE=3 SV=1 461 1054 2.0E-94
sp|O58822|IF2P_PYRHO Probable translation initiation factor IF-2 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=infB PE=3 SV=1 477 1041 2.0E-93
sp|Q57710|IF2P_METJA Probable translation initiation factor IF-2 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=infB PE=3 SV=1 477 1042 4.0E-86
sp|Q9HJ60|IF2P_THEAC Probable translation initiation factor IF-2 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=infB PE=3 SV=1 454 951 2.0E-76
sp|Q97BK4|IF2P_THEVO Probable translation initiation factor IF-2 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=infB PE=3 SV=1 458 951 7.0E-73
sp|A1AV99|IF2_RUTMC Translation initiation factor IF-2 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=infB PE=3 SV=1 462 909 3.0E-40
sp|Q0AYI8|IF2_SYNWW Translation initiation factor IF-2 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=infB PE=3 SV=1 462 974 4.0E-40
sp|A5WBS5|IF2_PSYWF Translation initiation factor IF-2 OS=Psychrobacter sp. (strain PRwf-1) GN=infB PE=3 SV=1 456 909 5.0E-40
sp|A6QBQ5|IF2_SULNB Translation initiation factor IF-2 OS=Sulfurovum sp. (strain NBC37-1) GN=infB PE=3 SV=1 462 988 2.0E-39
sp|Q4FVL5|IF2_PSYA2 Translation initiation factor IF-2 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=infB PE=3 SV=1 462 991 5.0E-38
sp|Q1QEP5|IF2_PSYCK Translation initiation factor IF-2 OS=Psychrobacter cryohalolentis (strain K5) GN=infB PE=3 SV=1 450 991 5.0E-38
sp|A5CXX6|IF2_VESOH Translation initiation factor IF-2 OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=infB PE=3 SV=1 462 909 1.0E-37
sp|Q6FF40|IF2_ACIAD Translation initiation factor IF-2 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=infB PE=3 SV=1 450 974 2.0E-37
sp|A6Q226|IF2_NITSB Translation initiation factor IF-2 OS=Nitratiruptor sp. (strain SB155-2) GN=infB PE=3 SV=1 462 909 3.0E-37
sp|B1KWK7|IF2_CLOBM Translation initiation factor IF-2 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=infB PE=3 SV=1 462 910 1.0E-36
sp|Q9ZF28|IF2_KLEOX Translation initiation factor IF-2 OS=Klebsiella oxytoca GN=infB PE=3 SV=1 462 974 2.0E-36
sp|B1L7T1|IF2_THESQ Translation initiation factor IF-2 OS=Thermotoga sp. (strain RQ2) GN=infB PE=3 SV=1 443 910 3.0E-36
sp|B0VLU2|IF2_ACIBS Translation initiation factor IF-2 OS=Acinetobacter baumannii (strain SDF) GN=infB PE=3 SV=1 450 974 3.0E-36
sp|C3L0B6|IF2_CLOB6 Translation initiation factor IF-2 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=infB PE=3 SV=1 462 910 4.0E-36
sp|Q2A1G8|IF2_FRATH Translation initiation factor IF-2 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=infB PE=3 SV=1 462 938 4.0E-36
sp|B0VE81|IF2_ACIBY Translation initiation factor IF-2 OS=Acinetobacter baumannii (strain AYE) GN=infB PE=3 SV=1 450 974 4.0E-36
sp|B2I2M7|IF2_ACIBC Translation initiation factor IF-2 OS=Acinetobacter baumannii (strain ACICU) GN=infB PE=3 SV=1 450 974 4.0E-36
sp|B7I3R9|IF2_ACIB5 Translation initiation factor IF-2 OS=Acinetobacter baumannii (strain AB0057) GN=infB PE=3 SV=1 450 974 4.0E-36
sp|B7H115|IF2_ACIB3 Translation initiation factor IF-2 OS=Acinetobacter baumannii (strain AB307-0294) GN=infB PE=3 SV=1 450 974 4.0E-36
sp|Q0BK70|IF2_FRATO Translation initiation factor IF-2 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=infB PE=3 SV=1 462 938 4.0E-36
sp|A7NEI8|IF2_FRATF Translation initiation factor IF-2 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=infB PE=3 SV=1 462 938 4.0E-36
sp|A5IJ09|IF2_THEP1 Translation initiation factor IF-2 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=infB PE=3 SV=1 443 910 6.0E-36
sp|A4IW10|IF2_FRATW Translation initiation factor IF-2 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=infB PE=3 SV=1 462 938 6.0E-36
sp|A5I4J3|IF2_CLOBH Translation initiation factor IF-2 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=infB PE=3 SV=1 462 910 6.0E-36
sp|A7FVZ3|IF2_CLOB1 Translation initiation factor IF-2 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=infB PE=3 SV=1 462 910 6.0E-36
sp|B7IF03|IF2_THEAB Translation initiation factor IF-2 OS=Thermosipho africanus (strain TCF52B) GN=infB PE=3 SV=1 456 910 7.0E-36
sp|A0Q8F3|IF2_FRATN Translation initiation factor IF-2 OS=Francisella tularensis subsp. novicida (strain U112) GN=infB PE=3 SV=1 462 938 7.0E-36
sp|C1FS59|IF2_CLOBJ Translation initiation factor IF-2 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=infB PE=3 SV=1 462 910 9.0E-36
sp|B1II49|IF2_CLOBK Translation initiation factor IF-2 OS=Clostridium botulinum (strain Okra / Type B1) GN=infB PE=3 SV=1 462 910 9.0E-36
sp|B2SEW7|IF2_FRATM Translation initiation factor IF-2 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=infB PE=3 SV=1 462 938 9.0E-36
sp|A4J5X2|IF2_DESRM Translation initiation factor IF-2 OS=Desulfotomaculum reducens (strain MI-1) GN=infB PE=3 SV=1 461 909 1.0E-35
sp|A7GZZ3|IF2_CAMC5 Translation initiation factor IF-2 OS=Campylobacter curvus (strain 525.92) GN=infB PE=3 SV=1 455 901 1.0E-35
sp|Q5NIL7|IF2_FRATT Translation initiation factor IF-2 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=infB PE=3 SV=1 462 938 1.0E-35
sp|Q14K20|IF2_FRAT1 Translation initiation factor IF-2 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=infB PE=3 SV=1 462 938 1.0E-35
sp|Q9ZF25|IF2_ENTCL Translation initiation factor IF-2 OS=Enterobacter cloacae GN=infB PE=3 SV=1 462 974 1.0E-35
sp|Q9WZN3|IF2_THEMA Translation initiation factor IF-2 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=infB PE=3 SV=1 443 910 2.0E-35
sp|B0JU67|IF2_MICAN Translation initiation factor IF-2 OS=Microcystis aeruginosa (strain NIES-843) GN=infB PE=3 SV=1 462 980 3.0E-35
sp|A1U600|IF2_MARHV Translation initiation factor IF-2 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=infB PE=3 SV=1 462 974 3.0E-35
sp|A9BJ54|IF2_PETMO Translation initiation factor IF-2 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=infB PE=3 SV=1 462 910 3.0E-35
sp|A7MZI5|IF2_VIBCB Translation initiation factor IF-2 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=infB PE=3 SV=1 462 974 6.0E-35
sp|Q7MI09|IF2_VIBVY Translation initiation factor IF-2 OS=Vibrio vulnificus (strain YJ016) GN=infB PE=3 SV=1 462 974 6.0E-35
sp|B8HUA9|IF2_CYAP4 Translation initiation factor IF-2 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=infB PE=3 SV=1 453 975 7.0E-35
sp|Q8DBW0|IF2_VIBVU Translation initiation factor IF-2 OS=Vibrio vulnificus (strain CMCP6) GN=infB PE=3 SV=1 462 974 9.0E-35
sp|A6LP48|IF2_THEM4 Translation initiation factor IF-2 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=infB PE=3 SV=1 462 910 9.0E-35
sp|B7KIU2|IF2_CYAP7 Translation initiation factor IF-2 OS=Cyanothece sp. (strain PCC 7424) GN=infB PE=3 SV=1 453 924 1.0E-34
sp|P72689|IF2_SYNY3 Translation initiation factor IF-2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=infB PE=3 SV=1 459 924 1.0E-34
sp|Q5QTY8|IF2_IDILO Translation initiation factor IF-2 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=infB PE=3 SV=1 462 974 1.0E-34
sp|A8FYS0|IF2_SHESH Translation initiation factor IF-2 OS=Shewanella sediminis (strain HAW-EB3) GN=infB PE=3 SV=1 449 974 2.0E-34
sp|Q0VSS1|IF2_ALCBS Translation initiation factor IF-2 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=infB PE=3 SV=1 462 998 2.0E-34
sp|A5N842|IF2_CLOK5 Translation initiation factor IF-2 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=infB PE=3 SV=1 462 910 2.0E-34
sp|A9M9Z4|IF2_BRUC2 Translation initiation factor IF-2 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=infB PE=3 SV=1 457 992 2.0E-34
sp|C5BFB7|IF2_EDWI9 Translation initiation factor IF-2 OS=Edwardsiella ictaluri (strain 93-146) GN=infB PE=3 SV=1 462 974 2.0E-34
sp|A8YVQ7|IF2_LACH4 Translation initiation factor IF-2 OS=Lactobacillus helveticus (strain DPC 4571) GN=infB PE=3 SV=1 462 910 2.0E-34
sp|A8F5A0|IF2_PSELT Translation initiation factor IF-2 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=infB PE=3 SV=1 443 910 2.0E-34
sp|Q5E7L5|IF2_VIBF1 Translation initiation factor IF-2 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=infB PE=3 SV=1 462 974 2.0E-34
sp|C4L8X4|IF2_TOLAT Translation initiation factor IF-2 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=infB PE=3 SV=1 462 998 3.0E-34
sp|A8MFA8|IF2_ALKOO Translation initiation factor IF-2 OS=Alkaliphilus oremlandii (strain OhILAs) GN=infB PE=3 SV=1 462 909 3.0E-34
sp|A6WWW5|IF2_OCHA4 Translation initiation factor IF-2 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=infB PE=3 SV=1 462 992 4.0E-34
sp|A5VTB2|IF2_BRUO2 Translation initiation factor IF-2 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=infB PE=3 SV=2 457 992 5.0E-34
sp|Q0K9B9|IF2_CUPNH Translation initiation factor IF-2 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=infB PE=3 SV=1 462 974 5.0E-34
sp|Q3AB98|IF2_CARHZ Translation initiation factor IF-2 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=infB PE=3 SV=1 462 918 6.0E-34
sp|A1S462|IF2_SHEAM Translation initiation factor IF-2 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=infB PE=3 SV=1 462 974 6.0E-34
sp|B0CK11|IF2_BRUSI Translation initiation factor IF-2 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=infB PE=3 SV=1 457 992 6.0E-34
sp|Q57AA0|IF2_BRUAB Translation initiation factor IF-2 OS=Brucella abortus biovar 1 (strain 9-941) GN=infB PE=3 SV=1 457 992 6.0E-34
sp|Q2YQR7|IF2_BRUA2 Translation initiation factor IF-2 OS=Brucella abortus (strain 2308) GN=infB PE=3 SV=1 457 992 6.0E-34
sp|Q30SS6|IF2_SULDN Translation initiation factor IF-2 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=infB PE=3 SV=1 462 974 7.0E-34
sp|C3LSP8|IF2_VIBCM Translation initiation factor IF-2 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=infB PE=3 SV=1 462 974 7.0E-34
sp|Q9KU80|IF2_VIBCH Translation initiation factor IF-2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=infB PE=3 SV=1 462 974 7.0E-34
sp|A5F926|IF2_VIBC3 Translation initiation factor IF-2 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=infB PE=3 SV=1 462 974 7.0E-34
sp|Q8YEB3|IF2_BRUME Translation initiation factor IF-2 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=infB PE=3 SV=2 457 992 7.0E-34
sp|B7VJH7|IF2_VIBTL Translation initiation factor IF-2 OS=Vibrio tasmaniensis (strain LGP32) GN=infB PE=3 SV=1 450 974 7.0E-34
sp|A8FDD1|IF2_BACP2 Translation initiation factor IF-2 OS=Bacillus pumilus (strain SAFR-032) GN=infB PE=3 SV=1 461 909 7.0E-34
sp|Q8FXT2|IF2_BRUSU Translation initiation factor IF-2 OS=Brucella suis biovar 1 (strain 1330) GN=infB PE=3 SV=1 457 992 7.0E-34
sp|Q01W31|IF2_SOLUE Translation initiation factor IF-2 OS=Solibacter usitatus (strain Ellin6076) GN=infB PE=3 SV=1 462 909 8.0E-34
sp|A7GG06|IF2_CLOBL Translation initiation factor IF-2 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=infB PE=3 SV=1 462 910 9.0E-34
sp|Q2SML3|IF2_HAHCH Translation initiation factor IF-2 OS=Hahella chejuensis (strain KCTC 2396) GN=infB PE=3 SV=1 462 974 9.0E-34
sp|Q74IS8|IF2_LACJO Translation initiation factor IF-2 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=infB PE=3 SV=1 462 910 1.0E-33
sp|A7ZC69|IF2_CAMC1 Translation initiation factor IF-2 OS=Campylobacter concisus (strain 13826) GN=infB PE=3 SV=1 462 900 1.0E-33
sp|C0QTL9|IF2_PERMH Translation initiation factor IF-2 OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=infB PE=3 SV=1 462 974 1.0E-33
sp|Q7M7X5|IF2_WOLSU Translation initiation factor IF-2 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=infB PE=3 SV=1 462 909 1.0E-33
sp|Q044B7|IF2_LACGA Translation initiation factor IF-2 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=infB PE=3 SV=1 462 910 1.0E-33
sp|A5CSZ4|IF2_CLAM3 Translation initiation factor IF-2 OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=infB PE=3 SV=1 461 910 1.0E-33
sp|B0RDY9|IF2_CLAMS Translation initiation factor IF-2 OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=infB PE=3 SV=1 461 910 1.0E-33
sp|A1ST45|IF2_PSYIN Translation initiation factor IF-2 OS=Psychromonas ingrahamii (strain 37) GN=infB PE=3 SV=1 462 963 1.0E-33
sp|B6ENE2|IF2_ALISL Translation initiation factor IF-2 OS=Aliivibrio salmonicida (strain LFI1238) GN=infB PE=3 SV=1 462 991 2.0E-33
sp|A1RGX5|IF2_SHESW Translation initiation factor IF-2 OS=Shewanella sp. (strain W3-18-1) GN=infB PE=3 SV=1 462 974 2.0E-33
sp|A4Y9C0|IF2_SHEPC Translation initiation factor IF-2 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=infB PE=3 SV=1 462 974 2.0E-33
sp|Q3IJ53|IF2_PSEHT Translation initiation factor IF-2 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=infB PE=3 SV=1 462 974 2.0E-33
sp|Q1LLR6|IF2_CUPMC Translation initiation factor IF-2 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=infB PE=3 SV=1 462 974 2.0E-33
sp|Q65JI1|IF2_BACLD Translation initiation factor IF-2 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=infB PE=3 SV=1 461 909 2.0E-33
sp|Q89AF5|IF2_BUCBP Translation initiation factor IF-2 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=infB PE=3 SV=1 462 974 2.0E-33
sp|Q5FJN6|IF2_LACAC Translation initiation factor IF-2 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=infB PE=3 SV=1 462 910 2.0E-33
sp|Q1QSZ0|IF2_CHRSD Translation initiation factor IF-2 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=infB PE=3 SV=1 462 909 2.0E-33
sp|Q1AW55|IF2_RUBXD Translation initiation factor IF-2 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=infB PE=3 SV=1 462 909 3.0E-33
sp|A9IMT5|IF2_BART1 Translation initiation factor IF-2 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=infB PE=3 SV=1 462 992 3.0E-33
sp|A7HN01|IF2_FERNB Translation initiation factor IF-2 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=infB PE=3 SV=1 462 910 3.0E-33
sp|A0Q0Q7|IF2_CLONN Translation initiation factor IF-2 OS=Clostridium novyi (strain NT) GN=infB PE=3 SV=1 462 974 3.0E-33
sp|Q03FS3|IF2_PEDPA Translation initiation factor IF-2 OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=infB PE=3 SV=1 462 910 3.0E-33
sp|Q049V5|IF2_LACDB Translation initiation factor IF-2 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=infB PE=3 SV=1 461 910 3.0E-33
sp|Q1G9P9|IF2_LACDA Translation initiation factor IF-2 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=infB PE=3 SV=1 461 910 4.0E-33
sp|A9KZX1|IF2_SHEB9 Translation initiation factor IF-2 OS=Shewanella baltica (strain OS195) GN=infB PE=3 SV=1 462 974 4.0E-33
sp|A6WRG8|IF2_SHEB8 Translation initiation factor IF-2 OS=Shewanella baltica (strain OS185) GN=infB PE=3 SV=1 462 974 4.0E-33
sp|A3D7K6|IF2_SHEB5 Translation initiation factor IF-2 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=infB PE=3 SV=1 462 974 4.0E-33
sp|B8E6N2|IF2_SHEB2 Translation initiation factor IF-2 OS=Shewanella baltica (strain OS223) GN=infB PE=3 SV=1 462 974 4.0E-33
sp|B3H163|IF2_ACTP7 Translation initiation factor IF-2 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=infB PE=3 SV=1 462 974 4.0E-33
sp|A3N005|IF2_ACTP2 Translation initiation factor IF-2 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=infB PE=3 SV=1 462 974 4.0E-33
sp|Q88VK7|IF2_LACPL Translation initiation factor IF-2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=infB PE=3 SV=1 457 910 4.0E-33
sp|A7I3V0|IF2_CAMHC Translation initiation factor IF-2 OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=infB PE=3 SV=1 462 901 5.0E-33
sp|A6VU29|IF2_MARMS Translation initiation factor IF-2 OS=Marinomonas sp. (strain MWYL1) GN=infB PE=3 SV=1 462 909 5.0E-33
sp|Q0HXR5|IF2_SHESR Translation initiation factor IF-2 OS=Shewanella sp. (strain MR-7) GN=infB PE=3 SV=1 462 974 5.0E-33
sp|Q0HLG1|IF2_SHESM Translation initiation factor IF-2 OS=Shewanella sp. (strain MR-4) GN=infB PE=3 SV=1 462 974 5.0E-33
sp|B3R1E4|IF2_CUPTR Translation initiation factor IF-2 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=infB PE=3 SV=1 462 974 6.0E-33
sp|Q4QK37|IF2_HAEI8 Translation initiation factor IF-2 OS=Haemophilus influenzae (strain 86-028NP) GN=infB PE=3 SV=1 462 974 6.0E-33
sp|A4WEY3|IF2_ENT38 Translation initiation factor IF-2 OS=Enterobacter sp. (strain 638) GN=infB PE=3 SV=1 462 974 6.0E-33
sp|Q2RJM5|IF2_MOOTA Translation initiation factor IF-2 OS=Moorella thermoacetica (strain ATCC 39073) GN=infB PE=3 SV=1 462 910 7.0E-33
sp|P44323|IF2_HAEIN Translation initiation factor IF-2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=infB PE=3 SV=1 462 974 7.0E-33
sp|A5UF34|IF2_HAEIG Translation initiation factor IF-2 OS=Haemophilus influenzae (strain PittGG) GN=infB PE=3 SV=1 462 974 7.0E-33
sp|Q04GN0|IF2_OENOB Translation initiation factor IF-2 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=infB PE=3 SV=1 462 895 7.0E-33
sp|Q6G0P2|IF2_BARQU Translation initiation factor IF-2 OS=Bartonella quintana (strain Toulouse) GN=infB PE=3 SV=1 462 992 7.0E-33
sp|A7H9F3|IF2_ANADF Translation initiation factor IF-2 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=infB PE=3 SV=1 461 910 8.0E-33
sp|B0TWR3|IF2_FRAP2 Translation initiation factor IF-2 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=infB PE=3 SV=1 462 938 8.0E-33
sp|A0KTZ6|IF2_SHESA Translation initiation factor IF-2 OS=Shewanella sp. (strain ANA-3) GN=infB PE=3 SV=1 462 974 8.0E-33
sp|A0LHL8|IF2_SYNFM Translation initiation factor IF-2 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=infB PE=3 SV=1 462 910 9.0E-33
sp|C5CDZ4|IF2_KOSOT Translation initiation factor IF-2 OS=Kosmotoga olearia (strain TBF 19.5.1) GN=infB PE=3 SV=1 462 910 9.0E-33
sp|A5UBT6|IF2_HAEIE Translation initiation factor IF-2 OS=Haemophilus influenzae (strain PittEE) GN=infB PE=3 SV=1 462 974 9.0E-33
sp|A5E866|IF2_BRASB Translation initiation factor IF-2 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=infB PE=3 SV=1 462 909 9.0E-33
sp|Q87M02|IF2_VIBPA Translation initiation factor IF-2 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=infB PE=3 SV=1 462 974 9.0E-33
sp|B5FA79|IF2_VIBFM Translation initiation factor IF-2 OS=Vibrio fischeri (strain MJ11) GN=infB PE=3 SV=1 462 974 1.0E-32
sp|B9JYK6|IF2_AGRVS Translation initiation factor IF-2 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=infB PE=3 SV=1 462 974 1.0E-32
sp|Q46ZP1|IF2_CUPPJ Translation initiation factor IF-2 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=infB PE=3 SV=1 462 918 1.0E-32
sp|Q0A797|IF2_ALKEH Translation initiation factor IF-2 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=infB PE=3 SV=1 462 938 1.0E-32
sp|Q2SVG8|IF2_BURTA Translation initiation factor IF-2 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=infB PE=3 SV=1 462 974 1.0E-32
sp|Q83GT8|IF2_TROWT Translation initiation factor IF-2 OS=Tropheryma whipplei (strain Twist) GN=infB PE=3 SV=1 461 918 1.0E-32
sp|B0UU13|IF2_HISS2 Translation initiation factor IF-2 OS=Histophilus somni (strain 2336) GN=infB PE=3 SV=1 462 974 1.0E-32
sp|Q83HG7|IF2_TROW8 Translation initiation factor IF-2 OS=Tropheryma whipplei (strain TW08/27) GN=infB PE=3 SV=1 461 918 1.0E-32
sp|Q0I3P5|IF2_HAES1 Translation initiation factor IF-2 OS=Haemophilus somnus (strain 129Pt) GN=infB PE=3 SV=1 462 974 1.0E-32
sp|Q12QI1|IF2_SHEDO Translation initiation factor IF-2 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=infB PE=3 SV=1 462 974 2.0E-32
sp|A5D2S0|IF2_PELTS Translation initiation factor IF-2 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=infB PE=3 SV=1 462 910 2.0E-32
sp|A4YJE9|IF2_BRASO Translation initiation factor IF-2 OS=Bradyrhizobium sp. (strain ORS278) GN=infB PE=3 SV=1 462 909 2.0E-32
sp|Q8UJ51|IF2_AGRFC Translation initiation factor IF-2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=infB PE=3 SV=1 462 974 2.0E-32
sp|Q8EHL5|IF2_SHEON Translation initiation factor IF-2 OS=Shewanella oneidensis (strain MR-1) GN=infB PE=3 SV=1 462 974 2.0E-32
sp|B9KEV0|IF2_CAMLR Translation initiation factor IF-2 OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=infB PE=3 SV=1 462 909 2.0E-32
sp|B7GG75|IF2_ANOFW Translation initiation factor IF-2 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=infB PE=3 SV=1 462 909 3.0E-32
sp|A1WXV1|IF2_HALHL Translation initiation factor IF-2 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=infB PE=3 SV=1 462 950 3.0E-32
sp|A4G7S7|IF2_HERAR Translation initiation factor IF-2 OS=Herminiimonas arsenicoxydans GN=infB PE=3 SV=1 462 974 3.0E-32
sp|P17889|IF2_BACSU Translation initiation factor IF-2 OS=Bacillus subtilis (strain 168) GN=infB PE=3 SV=1 461 909 3.0E-32
sp|B0BNR5|IF2_ACTPJ Translation initiation factor IF-2 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=infB PE=3 SV=1 462 974 3.0E-32
sp|Q63TP8|IF2_BURPS Translation initiation factor IF-2 OS=Burkholderia pseudomallei (strain K96243) GN=infB PE=3 SV=1 462 974 3.0E-32
sp|A3N8V8|IF2_BURP6 Translation initiation factor IF-2 OS=Burkholderia pseudomallei (strain 668) GN=infB PE=3 SV=1 462 974 3.0E-32
sp|Q3JSY9|IF2_BURP1 Translation initiation factor IF-2 OS=Burkholderia pseudomallei (strain 1710b) GN=infB PE=3 SV=1 462 974 3.0E-32
sp|A3NUL0|IF2_BURP0 Translation initiation factor IF-2 OS=Burkholderia pseudomallei (strain 1106a) GN=infB PE=3 SV=1 462 974 3.0E-32
sp|A4SJR5|IF2_AERS4 Translation initiation factor IF-2 OS=Aeromonas salmonicida (strain A449) GN=infB PE=3 SV=1 462 949 3.0E-32
sp|A6TRK7|IF2_ALKMQ Translation initiation factor IF-2 OS=Alkaliphilus metalliredigens (strain QYMF) GN=infB PE=3 SV=1 462 909 3.0E-32
sp|B9DPF5|IF2_STACT Translation initiation factor IF-2 OS=Staphylococcus carnosus (strain TM300) GN=infB PE=3 SV=1 462 949 3.0E-32
sp|B1KRR0|IF2_SHEWM Translation initiation factor IF-2 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=infB PE=3 SV=1 462 974 3.0E-32
sp|P57873|IF2_PASMU Translation initiation factor IF-2 OS=Pasteurella multocida (strain Pm70) GN=infB PE=3 SV=1 462 974 3.0E-32
sp|B8CKH3|IF2_SHEPW Translation initiation factor IF-2 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=infB PE=3 SV=1 449 974 3.0E-32
sp|A0KNE3|IF2_AERHH Translation initiation factor IF-2 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=infB PE=3 SV=1 462 949 3.0E-32
sp|Q39H30|IF2_BURL3 Translation initiation factor IF-2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=infB PE=3 SV=1 462 974 4.0E-32
sp|B8CW72|IF2_HALOH Translation initiation factor IF-2 OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=infB PE=3 SV=1 461 910 4.0E-32
sp|A1V3N4|IF2_BURMS Translation initiation factor IF-2 OS=Burkholderia mallei (strain SAVP1) GN=infB PE=3 SV=1 462 974 4.0E-32
sp|Q62KK9|IF2_BURMA Translation initiation factor IF-2 OS=Burkholderia mallei (strain ATCC 23344) GN=infB PE=3 SV=1 462 974 4.0E-32
sp|A2S2L1|IF2_BURM9 Translation initiation factor IF-2 OS=Burkholderia mallei (strain NCTC 10229) GN=infB PE=3 SV=1 462 974 4.0E-32
sp|A3MJW4|IF2_BURM7 Translation initiation factor IF-2 OS=Burkholderia mallei (strain NCTC 10247) GN=infB PE=3 SV=1 462 974 4.0E-32
sp|A0RQZ4|IF2_CAMFF Translation initiation factor IF-2 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=infB PE=3 SV=1 462 909 4.0E-32
sp|Q8RA37|IF2_CALS4 Translation initiation factor IF-2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=infB PE=3 SV=1 462 991 4.0E-32
sp|B0TQA2|IF2_SHEHH Translation initiation factor IF-2 OS=Shewanella halifaxensis (strain HAW-EB4) GN=infB PE=3 SV=1 433 974 5.0E-32
sp|Q6MD64|IF2_PARUW Translation initiation factor IF-2 OS=Protochlamydia amoebophila (strain UWE25) GN=infB PE=3 SV=1 461 991 5.0E-32
sp|Q2KDZ5|IF2_RHIEC Translation initiation factor IF-2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=infB PE=3 SV=1 462 922 5.0E-32
sp|B0K1D6|IF2_THEPX Translation initiation factor IF-2 OS=Thermoanaerobacter sp. (strain X514) GN=infB PE=3 SV=1 462 991 6.0E-32
sp|B1K0M0|IF2_BURCC Translation initiation factor IF-2 OS=Burkholderia cenocepacia (strain MC0-3) GN=infB PE=3 SV=1 462 974 7.0E-32
sp|A1A0A2|IF2_BIFAA Translation initiation factor IF-2 OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=infB PE=3 SV=1 462 982 7.0E-32
sp|A0K6X5|IF2_BURCH Translation initiation factor IF-2 OS=Burkholderia cenocepacia (strain HI2424) GN=infB PE=3 SV=1 462 974 7.0E-32
sp|Q1BWS7|IF2_BURCA Translation initiation factor IF-2 OS=Burkholderia cenocepacia (strain AU 1054) GN=infB PE=3 SV=1 462 974 7.0E-32
sp|Q31LL9|IF2_SYNE7 Translation initiation factor IF-2 OS=Synechococcus elongatus (strain PCC 7942) GN=infB PE=3 SV=1 462 922 7.0E-32
sp|B2JKT4|IF2_BURP8 Translation initiation factor IF-2 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=infB PE=3 SV=1 462 974 7.0E-32
sp|P55875|IF2_STIAU Translation initiation factor IF-2 OS=Stigmatella aurantiaca GN=infB PE=3 SV=1 462 918 7.0E-32
sp|Q609C0|IF2_METCA Translation initiation factor IF-2 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=infB PE=3 SV=1 462 974 8.0E-32
sp|Q46J13|IF2_PROMT Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain NATL2A) GN=infB PE=3 SV=1 462 952 8.0E-32
sp|B2UAA3|IF2_RALPJ Translation initiation factor IF-2 OS=Ralstonia pickettii (strain 12J) GN=infB PE=3 SV=1 462 974 8.0E-32
sp|A9ABD5|IF2_BURM1 Translation initiation factor IF-2 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=infB PE=3 SV=1 462 974 9.0E-32
sp|Q8CST4|IF2_STAES Translation initiation factor IF-2 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=infB PE=3 SV=1 462 909 9.0E-32
sp|Q5HPS2|IF2_STAEQ Translation initiation factor IF-2 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=infB PE=3 SV=1 462 909 9.0E-32
sp|Q0SSD4|IF2_CLOPS Translation initiation factor IF-2 OS=Clostridium perfringens (strain SM101 / Type A) GN=infB PE=3 SV=1 462 909 9.0E-32
sp|Q8XJR8|IF2_CLOPE Translation initiation factor IF-2 OS=Clostridium perfringens (strain 13 / Type A) GN=infB PE=3 SV=1 462 909 9.0E-32
sp|Q0TPR7|IF2_CLOP1 Translation initiation factor IF-2 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=infB PE=3 SV=1 462 909 9.0E-32
sp|Q3J9B6|IF2_NITOC Translation initiation factor IF-2 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=infB PE=3 SV=1 462 974 9.0E-32
sp|Q8XZV6|IF2_RALSO Translation initiation factor IF-2 OS=Ralstonia solanacearum (strain GMI1000) GN=infB PE=3 SV=1 462 974 9.0E-32
sp|A7Z4T4|IF2_BACMF Translation initiation factor IF-2 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=infB PE=3 SV=1 461 909 1.0E-31
sp|Q895J8|IF2_CLOTE Translation initiation factor IF-2 OS=Clostridium tetani (strain Massachusetts / E88) GN=infB PE=3 SV=1 440 910 1.0E-31
sp|Q3SKX1|IF2_THIDA Translation initiation factor IF-2 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=infB PE=3 SV=1 462 974 1.0E-31
sp|B3PI96|IF2_CELJU Translation initiation factor IF-2 OS=Cellvibrio japonicus (strain Ueda107) GN=infB PE=3 SV=1 462 974 1.0E-31
sp|A8G907|IF2_SERP5 Translation initiation factor IF-2 OS=Serratia proteamaculans (strain 568) GN=infB PE=3 SV=1 462 974 1.0E-31
sp|B4E7L1|IF2_BURCJ Translation initiation factor IF-2 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=infB PE=3 SV=1 462 974 1.0E-31
sp|Q038M5|IF2_LACC3 Translation initiation factor IF-2 OS=Lactobacillus casei (strain ATCC 334) GN=infB PE=3 SV=1 456 930 1.0E-31
sp|A8H740|IF2_SHEPA Translation initiation factor IF-2 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=infB PE=3 SV=1 449 974 1.0E-31
sp|B3WER5|IF2_LACCB Translation initiation factor IF-2 OS=Lactobacillus casei (strain BL23) GN=infB PE=3 SV=1 456 930 1.0E-31
sp|A4X4N7|IF2_SALTO Translation initiation factor IF-2 OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=infB PE=3 SV=1 462 918 1.0E-31
sp|Q49X54|IF2_STAS1 Translation initiation factor IF-2 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=infB PE=3 SV=1 462 909 1.0E-31
sp|A5EWY9|IF2_DICNV Translation initiation factor IF-2 OS=Dichelobacter nodosus (strain VCS1703A) GN=infB PE=3 SV=1 461 974 1.0E-31
sp|A8M746|IF2_SALAI Translation initiation factor IF-2 OS=Salinispora arenicola (strain CNS-205) GN=infB PE=3 SV=1 462 918 1.0E-31
sp|Q6AG49|IF2_LEIXX Translation initiation factor IF-2 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=infB PE=3 SV=1 461 910 2.0E-31
sp|A6VNE0|IF2_ACTSZ Translation initiation factor IF-2 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=infB PE=3 SV=1 462 974 2.0E-31
sp|Q1MN39|IF2_RHIL3 Translation initiation factor IF-2 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=infB PE=3 SV=1 462 922 2.0E-31
sp|O83861|IF2_TREPA Translation initiation factor IF-2 OS=Treponema pallidum (strain Nichols) GN=infB PE=3 SV=1 462 974 2.0E-31
sp|Q67P86|IF2_SYMTH Translation initiation factor IF-2 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=infB PE=3 SV=1 462 918 2.0E-31
sp|Q11BC8|IF2_CHESB Translation initiation factor IF-2 OS=Chelativorans sp. (strain BNC1) GN=infB PE=3 SV=1 462 992 2.0E-31
sp|B1HR05|IF2_LYSSC Translation initiation factor IF-2 OS=Lysinibacillus sphaericus (strain C3-41) GN=infB PE=3 SV=1 462 909 2.0E-31
sp|B0K9Q0|IF2_THEP3 Translation initiation factor IF-2 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=infB PE=3 SV=1 462 918 2.0E-31
sp|Q9XEK9|IF2C_EUGGR Translation initiation factor IF-2, chloroplastic (Fragment) OS=Euglena gracilis GN=INFB PE=2 SV=1 462 922 2.0E-31
sp|A5FV21|IF2_ACICJ Translation initiation factor IF-2 OS=Acidiphilium cryptum (strain JF-5) GN=infB PE=3 SV=1 461 901 2.0E-31
sp|B3PXE3|IF2_RHIE6 Translation initiation factor IF-2 OS=Rhizobium etli (strain CIAT 652) GN=infB PE=3 SV=1 462 922 2.0E-31
sp|A4JDX1|IF2_BURVG Translation initiation factor IF-2 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=infB PE=3 SV=1 462 974 2.0E-31
sp|A2C4P1|IF2_PROM1 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain NATL1A) GN=infB PE=3 SV=1 462 981 3.0E-31
sp|C4Z5N7|IF2_EUBE2 Translation initiation factor IF-2 OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=infB PE=3 SV=1 462 910 3.0E-31
sp|B0T167|IF2_CAUSK Translation initiation factor IF-2 OS=Caulobacter sp. (strain K31) GN=infB PE=3 SV=1 462 992 3.0E-31
sp|Q21C31|IF2_RHOPB Translation initiation factor IF-2 OS=Rhodopseudomonas palustris (strain BisB18) GN=infB PE=3 SV=1 462 992 3.0E-31
sp|Q1LSK8|IF2_BAUCH Translation initiation factor IF-2 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=infB PE=3 SV=1 457 915 3.0E-31
sp|Q24UI6|IF2_DESHY Translation initiation factor IF-2 OS=Desulfitobacterium hafniense (strain Y51) GN=infB PE=3 SV=1 462 909 3.0E-31
sp|Q7VA20|IF2_PROMA Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=infB PE=3 SV=1 462 981 4.0E-31
sp|Q5HB61|IF2_EHRRW Translation initiation factor IF-2 OS=Ehrlichia ruminantium (strain Welgevonden) GN=infB PE=3 SV=1 462 963 4.0E-31
sp|B2J955|IF2_NOSP7 Translation initiation factor IF-2 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=infB PE=3 SV=1 431 924 4.0E-31
sp|Q6LUJ2|IF2_PHOPR Translation initiation factor IF-2 OS=Photobacterium profundum GN=infB PE=3 SV=1 462 974 4.0E-31
sp|B4SCE7|IF2_PELPB Translation initiation factor IF-2 OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=infB PE=3 SV=1 462 918 4.0E-31
sp|Q0BFY3|IF2_BURCM Translation initiation factor IF-2 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=infB PE=3 SV=1 462 974 4.0E-31
sp|Q5GS99|IF2_WOLTR Translation initiation factor IF-2 OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=infB PE=3 SV=1 462 961 5.0E-31
sp|A1UU50|IF2_BARBK Translation initiation factor IF-2 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=infB PE=3 SV=1 462 974 5.0E-31
sp|Q38W81|IF2_LACSS Translation initiation factor IF-2 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=infB PE=3 SV=1 455 910 5.0E-31
sp|A5GNJ0|IF2_SYNPW Translation initiation factor IF-2 OS=Synechococcus sp. (strain WH7803) GN=infB PE=3 SV=1 462 981 5.0E-31
sp|Q1GVI9|IF2_SPHAL Translation initiation factor IF-2 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=infB PE=3 SV=1 462 924 6.0E-31
sp|Q5YSC6|IF2_NOCFA Translation initiation factor IF-2 OS=Nocardia farcinica (strain IFM 10152) GN=infB PE=3 SV=2 461 918 7.0E-31
sp|B1YP36|IF2_BURA4 Translation initiation factor IF-2 OS=Burkholderia ambifaria (strain MC40-6) GN=infB PE=3 SV=1 462 974 7.0E-31
sp|Q7VLI2|IF2_HAEDU Translation initiation factor IF-2 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=infB PE=3 SV=1 462 974 7.0E-31
sp|A6T0Y8|IF2_JANMA Translation initiation factor IF-2 OS=Janthinobacterium sp. (strain Marseille) GN=infB PE=3 SV=1 462 974 8.0E-31
sp|Q03WH4|IF2_LEUMM Translation initiation factor IF-2 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=infB PE=3 SV=1 462 974 8.0E-31
sp|Q6YR66|IF2_ONYPE Translation initiation factor IF-2 OS=Onion yellows phytoplasma (strain OY-M) GN=infB PE=3 SV=1 462 910 8.0E-31
sp|B1MZH4|IF2_LEUCK Translation initiation factor IF-2 OS=Leuconostoc citreum (strain KM20) GN=infB PE=3 SV=1 462 974 9.0E-31
sp|A9KNW4|IF2_CLOPH Translation initiation factor IF-2 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=infB PE=3 SV=1 462 909 9.0E-31
sp|Q64ZR4|IF2_BACFR Translation initiation factor IF-2 OS=Bacteroides fragilis (strain YCH46) GN=infB PE=3 SV=1 462 909 9.0E-31
sp|Q5LIN1|IF2_BACFN Translation initiation factor IF-2 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=infB PE=3 SV=1 462 909 9.0E-31
sp|A6MVX8|IF2C_RHDSA Translation initiation factor IF-2, chloroplastic OS=Rhodomonas salina GN=infB PE=3 SV=1 462 975 9.0E-31
sp|Q2KXY7|IF2_BORA1 Translation initiation factor IF-2 OS=Bordetella avium (strain 197N) GN=infB PE=3 SV=1 462 974 1.0E-30
sp|A1JIW9|IF2_YERE8 Translation initiation factor IF-2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=infB PE=3 SV=1 444 974 1.0E-30
sp|C1F697|IF2_ACIC5 Translation initiation factor IF-2 OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=infB PE=3 SV=1 448 980 1.0E-30
sp|B8GP02|IF2_THISH Translation initiation factor IF-2 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=infB PE=3 SV=1 462 974 1.0E-30
sp|A9BCI5|IF2_PROM4 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9211) GN=infB PE=3 SV=1 462 910 1.0E-30
sp|Q086H2|IF2_SHEFN Translation initiation factor IF-2 OS=Shewanella frigidimarina (strain NCIMB 400) GN=infB PE=3 SV=1 462 974 1.0E-30
sp|B4RXT8|IF2_ALTMD Translation initiation factor IF-2 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=infB PE=3 SV=1 462 974 1.0E-30
sp|Q5L0I8|IF2_GEOKA Translation initiation factor IF-2 OS=Geobacillus kaustophilus (strain HTA426) GN=infB PE=3 SV=1 462 978 1.0E-30
sp|B8DW43|IF2_BIFA0 Translation initiation factor IF-2 OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=infB PE=3 SV=1 462 974 1.0E-30
sp|Q5N0A5|IF2_SYNP6 Translation initiation factor IF-2 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=infB PE=3 SV=1 458 922 1.0E-30
sp|Q2JMD7|IF2_SYNJB Translation initiation factor IF-2 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=infB PE=3 SV=1 462 905 2.0E-30
sp|Q5FGX3|IF2_EHRRG Translation initiation factor IF-2 OS=Ehrlichia ruminantium (strain Gardel) GN=infB PE=3 SV=1 462 963 2.0E-30
sp|A4FM34|IF2_SACEN Translation initiation factor IF-2 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=infB PE=3 SV=1 462 918 2.0E-30
sp|Q5FQM3|IF2_GLUOX Translation initiation factor IF-2 OS=Gluconobacter oxydans (strain 621H) GN=infB PE=3 SV=1 457 974 2.0E-30
sp|B1ZDQ8|IF2_METPB Translation initiation factor IF-2 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=infB PE=3 SV=1 462 922 2.0E-30
sp|Q9PIZ1|IF2_CAMJE Translation initiation factor IF-2 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=infB PE=3 SV=1 462 909 2.0E-30
sp|Q3AQK7|IF2_CHLCH Translation initiation factor IF-2 OS=Chlorobium chlorochromatii (strain CaD3) GN=infB PE=3 SV=1 462 918 2.0E-30
sp|B9IVA1|IF2_BACCQ Translation initiation factor IF-2 OS=Bacillus cereus (strain Q1) GN=infB PE=3 SV=1 462 909 2.0E-30
sp|B7HLE6|IF2_BACC7 Translation initiation factor IF-2 OS=Bacillus cereus (strain AH187) GN=infB PE=3 SV=1 462 909 2.0E-30
sp|A8FJU1|IF2_CAMJ8 Translation initiation factor IF-2 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=infB PE=3 SV=1 462 909 2.0E-30
sp|B8JFY6|IF2_ANAD2 Translation initiation factor IF-2 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=infB PE=3 SV=1 461 910 2.0E-30
sp|B2GKR5|IF2_KOCRD Translation initiation factor IF-2 OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=infB PE=3 SV=1 462 918 2.0E-30
sp|Q3AHW1|IF2_SYNSC Translation initiation factor IF-2 OS=Synechococcus sp. (strain CC9605) GN=infB PE=3 SV=1 462 910 2.0E-30
sp|Q140U6|IF2_BURXL Translation initiation factor IF-2 OS=Burkholderia xenovorans (strain LB400) GN=infB PE=3 SV=1 462 974 2.0E-30
sp|A1VNU2|IF2_POLNA Translation initiation factor IF-2 OS=Polaromonas naphthalenivorans (strain CJ2) GN=infB PE=3 SV=1 462 913 2.0E-30
sp|Q732Q9|IF2_BACC1 Translation initiation factor IF-2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=infB PE=3 SV=1 462 909 2.0E-30
sp|Q73FL0|IF2_WOLPM Translation initiation factor IF-2 OS=Wolbachia pipientis wMel GN=infB PE=3 SV=1 462 965 2.0E-30
sp|A3QGU5|IF2_SHELP Translation initiation factor IF-2 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=infB PE=3 SV=1 462 974 2.0E-30
sp|Q9KA77|IF2_BACHD Translation initiation factor IF-2 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=infB PE=3 SV=1 462 909 2.0E-30
sp|Q5HX30|IF2_CAMJR Translation initiation factor IF-2 OS=Campylobacter jejuni (strain RM1221) GN=infB PE=3 SV=1 462 909 3.0E-30
sp|Q5PAJ5|IF2_ANAMM Translation initiation factor IF-2 OS=Anaplasma marginale (strain St. Maries) GN=infB PE=3 SV=1 462 901 3.0E-30
sp|Q7VQM3|IF2_BLOFL Translation initiation factor IF-2 OS=Blochmannia floridanus GN=infB PE=3 SV=1 462 900 3.0E-30
sp|A1BDF1|IF2_CHLPD Translation initiation factor IF-2 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=infB PE=3 SV=1 461 949 3.0E-30
sp|B2T381|IF2_BURPP Translation initiation factor IF-2 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=infB PE=3 SV=1 462 974 3.0E-30
sp|Q8YQJ1|IF2_NOSS1 Translation initiation factor IF-2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=infB PE=3 SV=1 462 924 3.0E-30
sp|Q482T9|IF2_COLP3 Translation initiation factor IF-2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=infB PE=3 SV=1 462 974 3.0E-30
sp|B3EUG6|IF2_AMOA5 Translation initiation factor IF-2 OS=Amoebophilus asiaticus (strain 5a2) GN=infB PE=3 SV=1 462 959 3.0E-30
sp|A7HZ93|IF2_PARL1 Translation initiation factor IF-2 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=infB PE=3 SV=1 458 992 3.0E-30
sp|Q10XM3|IF2_TRIEI Translation initiation factor IF-2 OS=Trichodesmium erythraeum (strain IMS101) GN=infB PE=3 SV=1 462 922 3.0E-30
sp|Q4L5X1|IF2_STAHJ Translation initiation factor IF-2 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=infB PE=3 SV=1 462 909 3.0E-30
sp|A7GRE3|IF2_BACCN Translation initiation factor IF-2 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=infB PE=3 SV=1 462 909 3.0E-30
sp|B9EBE9|IF2_MACCJ Translation initiation factor IF-2 OS=Macrococcus caseolyticus (strain JCSC5402) GN=infB PE=3 SV=1 462 909 3.0E-30
sp|Q73VV4|IF2_MYCPA Translation initiation factor IF-2 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=infB PE=3 SV=1 462 918 3.0E-30
sp|Q9PGR3|IF2_XYLFA Translation initiation factor IF-2 OS=Xylella fastidiosa (strain 9a5c) GN=infB PE=3 SV=1 462 974 3.0E-30
sp|Q2S1N7|IF2_SALRD Translation initiation factor IF-2 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=infB PE=3 SV=1 462 913 3.0E-30
sp|A6LSQ4|IF2_CLOB8 Translation initiation factor IF-2 OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=infB PE=3 SV=1 462 910 4.0E-30
sp|Q0AFJ3|IF2_NITEC Translation initiation factor IF-2 OS=Nitrosomonas eutropha (strain C91) GN=infB PE=3 SV=1 462 974 4.0E-30
sp|A6TEI7|IF2_KLEP7 Translation initiation factor IF-2 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=infB PE=3 SV=1 462 974 4.0E-30
sp|B5XSX4|IF2_KLEP3 Translation initiation factor IF-2 OS=Klebsiella pneumoniae (strain 342) GN=infB PE=3 SV=1 462 974 4.0E-30
sp|Q6G4W7|IF2_BARHE Translation initiation factor IF-2 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=infB PE=3 SV=1 458 992 4.0E-30
sp|A8L6F4|IF2_FRASN Translation initiation factor IF-2 OS=Frankia sp. (strain EAN1pec) GN=infB PE=3 SV=1 462 918 4.0E-30
sp|Q6A7M5|IF2_PROAC Translation initiation factor IF-2 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=infB PE=3 SV=1 462 910 4.0E-30
sp|Q6GHG6|IF2_STAAR Translation initiation factor IF-2 OS=Staphylococcus aureus (strain MRSA252) GN=infB PE=3 SV=1 462 909 4.0E-30
sp|A7H1L5|IF2_CAMJD Translation initiation factor IF-2 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=infB PE=3 SV=1 462 909 4.0E-30
sp|Q65SK9|IF2_MANSM Translation initiation factor IF-2 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=infB PE=3 SV=1 462 974 5.0E-30
sp|B4UHG0|IF2_ANASK Translation initiation factor IF-2 OS=Anaeromyxobacter sp. (strain K) GN=infB PE=3 SV=1 461 910 5.0E-30
sp|Q3A4A7|IF2_PELCD Translation initiation factor IF-2 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=infB PE=3 SV=1 462 909 5.0E-30
sp|Q1GXD6|IF2_METFK Translation initiation factor IF-2 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=infB PE=3 SV=1 462 974 5.0E-30
sp|P04766|IF2_GEOSE Translation initiation factor IF-2 OS=Geobacillus stearothermophilus GN=infB PE=1 SV=1 462 974 5.0E-30
sp|A8Z3U9|IF2_STAAT Translation initiation factor IF-2 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=infB PE=3 SV=1 462 909 6.0E-30
sp|A6QGG8|IF2_STAAE Translation initiation factor IF-2 OS=Staphylococcus aureus (strain Newman) GN=infB PE=3 SV=1 462 909 6.0E-30
sp|Q5HGG2|IF2_STAAC Translation initiation factor IF-2 OS=Staphylococcus aureus (strain COL) GN=infB PE=3 SV=1 462 909 6.0E-30
sp|Q2G2D0|IF2_STAA8 Translation initiation factor IF-2 OS=Staphylococcus aureus (strain NCTC 8325) GN=infB PE=3 SV=1 462 909 6.0E-30
sp|Q2FHG9|IF2_STAA3 Translation initiation factor IF-2 OS=Staphylococcus aureus (strain USA300) GN=infB PE=3 SV=1 462 909 6.0E-30
sp|A1VXL9|IF2_CAMJJ Translation initiation factor IF-2 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=infB PE=3 SV=1 462 909 6.0E-30
sp|A5GVG4|IF2_SYNR3 Translation initiation factor IF-2 OS=Synechococcus sp. (strain RCC307) GN=infB PE=3 SV=1 462 980 6.0E-30
sp|Q2JSB7|IF2_SYNJA Translation initiation factor IF-2 OS=Synechococcus sp. (strain JA-3-3Ab) GN=infB PE=3 SV=1 462 905 7.0E-30
sp|A7MQE1|IF2_CROS8 Translation initiation factor IF-2 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=infB PE=3 SV=1 462 974 7.0E-30
sp|P65134|IF2_STAAN Translation initiation factor IF-2 OS=Staphylococcus aureus (strain N315) GN=infB PE=1 SV=1 462 909 7.0E-30
sp|P65133|IF2_STAAM Translation initiation factor IF-2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=infB PE=3 SV=1 462 909 7.0E-30
sp|Q2YXP7|IF2_STAAB Translation initiation factor IF-2 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=infB PE=3 SV=1 462 909 7.0E-30
sp|A5ISF3|IF2_STAA9 Translation initiation factor IF-2 OS=Staphylococcus aureus (strain JH9) GN=infB PE=3 SV=1 462 909 7.0E-30
sp|A6U188|IF2_STAA2 Translation initiation factor IF-2 OS=Staphylococcus aureus (strain JH1) GN=infB PE=3 SV=1 462 909 7.0E-30
sp|A7X1Q1|IF2_STAA1 Translation initiation factor IF-2 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=infB PE=3 SV=1 462 909 7.0E-30
sp|A0LV27|IF2_ACIC1 Translation initiation factor IF-2 OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=infB PE=3 SV=1 462 918 7.0E-30
sp|B0SQH4|IF2_LEPBP Translation initiation factor IF-2 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=infB PE=3 SV=1 462 913 7.0E-30
sp|B0SH18|IF2_LEPBA Translation initiation factor IF-2 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=infB PE=3 SV=1 462 913 7.0E-30
sp|Q6HF02|IF2_BACHK Translation initiation factor IF-2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=infB PE=3 SV=1 462 909 7.0E-30
sp|Q636L3|IF2_BACCZ Translation initiation factor IF-2 OS=Bacillus cereus (strain ZK / E33L) GN=infB PE=3 SV=1 462 909 7.0E-30
sp|C1EP35|IF2_BACC3 Translation initiation factor IF-2 OS=Bacillus cereus (strain 03BB102) GN=infB PE=3 SV=1 462 909 7.0E-30
sp|A0RHI4|IF2_BACAH Translation initiation factor IF-2 OS=Bacillus thuringiensis (strain Al Hakam) GN=infB PE=3 SV=2 462 909 7.0E-30
sp|C5D9C9|IF2_GEOSW Translation initiation factor IF-2 OS=Geobacillus sp. (strain WCH70) GN=infB PE=3 SV=1 462 909 7.0E-30
sp|Q8K9H1|IF2_BUCAP Translation initiation factor IF-2 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=infB PE=3 SV=1 462 974 8.0E-30
sp|Q1IIT3|IF2_KORVE Translation initiation factor IF-2 OS=Koribacter versatilis (strain Ellin345) GN=infB PE=3 SV=1 461 980 8.0E-30
sp|B2A397|IF2_NATTJ Translation initiation factor IF-2 OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=infB PE=3 SV=1 462 909 8.0E-30
sp|B2RHM9|IF2_PORG3 Translation initiation factor IF-2 OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=infB PE=3 SV=1 462 909 8.0E-30
sp|Q7MXE4|IF2_PORGI Translation initiation factor IF-2 OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=infB PE=3 SV=1 462 909 9.0E-30
sp|C5CLW3|IF2_VARPS Translation initiation factor IF-2 OS=Variovorax paradoxus (strain S110) GN=infB PE=3 SV=1 453 975 9.0E-30
sp|B1MD87|IF2_MYCA9 Translation initiation factor IF-2 OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=infB PE=3 SV=1 462 918 9.0E-30
sp|Q1GCH2|IF2_RUEST Translation initiation factor IF-2 OS=Ruegeria sp. (strain TM1040) GN=infB PE=3 SV=1 462 901 1.0E-29
sp|B3EFB1|IF2_CHLL2 Translation initiation factor IF-2 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=infB PE=3 SV=1 461 949 1.0E-29
sp|C5BWS3|IF2_BEUC1 Translation initiation factor IF-2 OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=infB PE=3 SV=1 454 918 1.0E-29
sp|B0S1E5|IF2_FINM2 Translation initiation factor IF-2 OS=Finegoldia magna (strain ATCC 29328) GN=infB PE=3 SV=1 462 910 1.0E-29
sp|B1LFS0|IF2_ECOSM Translation initiation factor IF-2 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=infB PE=3 SV=1 462 974 1.0E-29
sp|Q2IPZ7|IF2_ANADE Translation initiation factor IF-2 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=infB PE=3 SV=1 461 910 1.0E-29
sp|Q73NP6|IF2_TREDE Translation initiation factor IF-2 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=infB PE=3 SV=1 462 909 1.0E-29
sp|Q9ZF31|IF2_SALTY Translation initiation factor IF-2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=infB PE=3 SV=2 462 974 1.0E-29
sp|C0PZ54|IF2_SALPC Translation initiation factor IF-2 OS=Salmonella paratyphi C (strain RKS4594) GN=infB PE=3 SV=1 462 974 1.0E-29
sp|A9N732|IF2_SALPB Translation initiation factor IF-2 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=infB PE=3 SV=1 462 974 1.0E-29
sp|B4T6Z8|IF2_SALNS Translation initiation factor IF-2 OS=Salmonella newport (strain SL254) GN=infB PE=3 SV=1 462 974 1.0E-29
sp|B4TJ06|IF2_SALHS Translation initiation factor IF-2 OS=Salmonella heidelberg (strain SL476) GN=infB PE=3 SV=1 462 974 1.0E-29
sp|B5QZV8|IF2_SALEP Translation initiation factor IF-2 OS=Salmonella enteritidis PT4 (strain P125109) GN=infB PE=3 SV=1 462 974 1.0E-29
sp|B5FI13|IF2_SALDC Translation initiation factor IF-2 OS=Salmonella dublin (strain CT_02021853) GN=infB PE=3 SV=1 462 974 1.0E-29
sp|Q57JH9|IF2_SALCH Translation initiation factor IF-2 OS=Salmonella choleraesuis (strain SC-B67) GN=infB PE=3 SV=1 462 974 1.0E-29
sp|B5F6T8|IF2_SALA4 Translation initiation factor IF-2 OS=Salmonella agona (strain SL483) GN=infB PE=3 SV=1 462 974 1.0E-29
sp|A4IMD7|IF2_GEOTN Translation initiation factor IF-2 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=infB PE=3 SV=1 462 974 1.0E-29
sp|Q0I7K2|IF2_SYNS3 Translation initiation factor IF-2 OS=Synechococcus sp. (strain CC9311) GN=infB PE=3 SV=1 462 981 1.0E-29
sp|Q89WA9|IF2_BRADU Translation initiation factor IF-2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=infB PE=3 SV=1 462 992 1.0E-29
sp|Q15V72|IF2_PSEA6 Translation initiation factor IF-2 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=infB PE=3 SV=1 462 974 1.0E-29
sp|Q87EV4|IF2_XYLFT Translation initiation factor IF-2 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=infB PE=3 SV=1 462 974 1.0E-29
sp|B2I726|IF2_XYLF2 Translation initiation factor IF-2 OS=Xylella fastidiosa (strain M23) GN=infB PE=3 SV=1 462 974 1.0E-29
sp|Q493T7|IF2_BLOPB Translation initiation factor IF-2 OS=Blochmannia pennsylvanicus (strain BPEN) GN=infB PE=3 SV=1 462 974 1.0E-29
sp|B4TWD8|IF2_SALSV Translation initiation factor IF-2 OS=Salmonella schwarzengrund (strain CVM19633) GN=infB PE=3 SV=1 462 974 1.0E-29
sp|B5REN6|IF2_SALG2 Translation initiation factor IF-2 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=infB PE=3 SV=1 462 974 1.0E-29
sp|Q32BG5|IF2_SHIDS Translation initiation factor IF-2 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=infB PE=3 SV=1 462 974 1.0E-29
sp|Q6NCN5|IF2_RHOPA Translation initiation factor IF-2 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=infB PE=3 SV=1 462 974 1.0E-29
sp|A8AQ58|IF2_CITK8 Translation initiation factor IF-2 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=infB PE=3 SV=1 462 974 1.0E-29
sp|B2U207|IF2_SHIB3 Translation initiation factor IF-2 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=infB PE=3 SV=1 462 974 1.0E-29
sp|Q3YX73|IF2_SHISS Translation initiation factor IF-2 OS=Shigella sonnei (strain Ss046) GN=infB PE=3 SV=1 462 974 1.0E-29
sp|Q81WM3|IF2_BACAN Translation initiation factor IF-2 OS=Bacillus anthracis GN=infB PE=3 SV=1 462 909 2.0E-29
sp|C3L7B4|IF2_BACAC Translation initiation factor IF-2 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=infB PE=3 SV=1 462 909 2.0E-29
sp|C3P5L5|IF2_BACAA Translation initiation factor IF-2 OS=Bacillus anthracis (strain A0248) GN=infB PE=3 SV=1 462 909 2.0E-29
sp|Q83JF9|IF2_SHIFL Translation initiation factor IF-2 OS=Shigella flexneri GN=infB PE=3 SV=1 462 974 2.0E-29
sp|Q31W47|IF2_SHIBS Translation initiation factor IF-2 OS=Shigella boydii serotype 4 (strain Sb227) GN=infB PE=3 SV=1 462 974 2.0E-29
sp|Q1R6H0|IF2_ECOUT Translation initiation factor IF-2 OS=Escherichia coli (strain UTI89 / UPEC) GN=infB PE=3 SV=1 462 974 2.0E-29
sp|B6I1P3|IF2_ECOSE Translation initiation factor IF-2 OS=Escherichia coli (strain SE11) GN=infB PE=3 SV=1 462 974 2.0E-29
sp|B7NDF4|IF2_ECOLU Translation initiation factor IF-2 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=infB PE=3 SV=1 462 974 2.0E-29
sp|P0A705|IF2_ECOLI Translation initiation factor IF-2 OS=Escherichia coli (strain K12) GN=infB PE=1 SV=1 462 974 2.0E-29
sp|B1IQV3|IF2_ECOLC Translation initiation factor IF-2 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=infB PE=3 SV=1 462 974 2.0E-29
sp|P59587|IF2_ECOL6 Translation initiation factor IF-2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=infB PE=3 SV=1 462 974 2.0E-29
sp|Q0TCU1|IF2_ECOL5 Translation initiation factor IF-2 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=infB PE=3 SV=1 462 974 2.0E-29
sp|A1AG73|IF2_ECOK1 Translation initiation factor IF-2 OS=Escherichia coli O1:K1 / APEC GN=infB PE=3 SV=1 462 974 2.0E-29
sp|A8A4Y4|IF2_ECOHS Translation initiation factor IF-2 OS=Escherichia coli O9:H4 (strain HS) GN=infB PE=3 SV=1 462 974 2.0E-29
sp|B1XGY0|IF2_ECODH Translation initiation factor IF-2 OS=Escherichia coli (strain K12 / DH10B) GN=infB PE=3 SV=1 462 974 2.0E-29
sp|C4ZSQ9|IF2_ECOBW Translation initiation factor IF-2 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=infB PE=3 SV=1 462 974 2.0E-29
sp|B7M076|IF2_ECO8A Translation initiation factor IF-2 OS=Escherichia coli O8 (strain IAI1) GN=infB PE=3 SV=1 462 974 2.0E-29
sp|B7NKN7|IF2_ECO7I Translation initiation factor IF-2 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=infB PE=3 SV=1 462 974 2.0E-29
sp|B5YS58|IF2_ECO5E Translation initiation factor IF-2 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=infB PE=3 SV=1 462 974 2.0E-29
sp|P0A706|IF2_ECO57 Translation initiation factor IF-2 OS=Escherichia coli O157:H7 GN=infB PE=3 SV=1 462 974 2.0E-29
sp|B7LHN3|IF2_ECO55 Translation initiation factor IF-2 OS=Escherichia coli (strain 55989 / EAEC) GN=infB PE=3 SV=1 462 974 2.0E-29
sp|B7MB89|IF2_ECO45 Translation initiation factor IF-2 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=infB PE=3 SV=1 462 974 2.0E-29
sp|B7UJ63|IF2_ECO27 Translation initiation factor IF-2 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=infB PE=3 SV=1 462 974 2.0E-29
sp|A7ZS65|IF2_ECO24 Translation initiation factor IF-2 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=infB PE=3 SV=1 462 974 2.0E-29
sp|Q8Z3H7|IF2_SALTI Translation initiation factor IF-2 OS=Salmonella typhi GN=infB PE=3 SV=1 462 974 2.0E-29
sp|B0U1Q8|IF2_XYLFM Translation initiation factor IF-2 OS=Xylella fastidiosa (strain M12) GN=infB PE=3 SV=1 462 974 2.0E-29
sp|Q8NWZ1|IF2_STAAW Translation initiation factor IF-2 OS=Staphylococcus aureus (strain MW2) GN=infB PE=3 SV=1 462 909 2.0E-29
sp|Q6G9U4|IF2_STAAS Translation initiation factor IF-2 OS=Staphylococcus aureus (strain MSSA476) GN=infB PE=3 SV=1 462 909 2.0E-29
sp|A6L030|IF2_BACV8 Translation initiation factor IF-2 OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=infB PE=3 SV=1 462 909 2.0E-29
sp|Q1QS64|IF2_NITHX Translation initiation factor IF-2 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=infB PE=3 SV=1 462 992 2.0E-29
sp|A3PNL2|IF2_RHOS1 Translation initiation factor IF-2 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=infB PE=3 SV=1 462 910 2.0E-29
sp|Q72ER1|IF2_DESVH Translation initiation factor IF-2 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=infB PE=3 SV=1 462 991 2.0E-29
sp|B7LR37|IF2_ESCF3 Translation initiation factor IF-2 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=infB PE=3 SV=1 462 974 2.0E-29
sp|Q3IYN5|IF2_RHOS4 Translation initiation factor IF-2 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=infB PE=3 SV=1 462 910 2.0E-29
sp|A1VG83|IF2_DESVV Translation initiation factor IF-2 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=infB PE=3 SV=1 462 991 2.0E-29
sp|B2TJ55|IF2_CLOBB Translation initiation factor IF-2 OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=infB PE=3 SV=1 462 910 2.0E-29
sp|B7N0V3|IF2_ECO81 Translation initiation factor IF-2 OS=Escherichia coli O81 (strain ED1a) GN=infB PE=3 SV=1 462 974 2.0E-29
sp|Q8CJQ8|IF2_STRCO Translation initiation factor IF-2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=infB PE=3 SV=1 461 918 2.0E-29
sp|Q3YS01|IF2_EHRCJ Translation initiation factor IF-2 OS=Ehrlichia canis (strain Jake) GN=infB PE=3 SV=1 462 965 2.0E-29
sp|Q5F797|IF2_NEIG1 Translation initiation factor IF-2 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=infB PE=3 SV=1 462 974 2.0E-29
sp|A4SY78|IF2_POLSQ Translation initiation factor IF-2 OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=infB PE=3 SV=1 462 974 2.0E-29
sp|Q812X7|IF2_BACCR Translation initiation factor IF-2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=infB PE=3 SV=1 462 909 2.0E-29
sp|B7HDT6|IF2_BACC4 Translation initiation factor IF-2 OS=Bacillus cereus (strain B4264) GN=infB PE=3 SV=1 462 909 2.0E-29
sp|A0LE19|IF2_MAGMM Translation initiation factor IF-2 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=infB PE=3 SV=1 462 974 2.0E-29
sp|Q97I51|IF2_CLOAB Translation initiation factor IF-2 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=infB PE=3 SV=1 462 909 2.0E-29
sp|Q9AC25|IF2_CAUCR Translation initiation factor IF-2 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=infB PE=3 SV=2 460 909 2.0E-29
sp|A9MP36|IF2_SALAR Translation initiation factor IF-2 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=infB PE=3 SV=1 462 974 2.0E-29
sp|B4RMZ3|IF2_NEIG2 Translation initiation factor IF-2 OS=Neisseria gonorrhoeae (strain NCCP11945) GN=infB PE=3 SV=1 462 974 2.0E-29
sp|Q92C29|IF2_LISIN Translation initiation factor IF-2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=infB PE=3 SV=1 462 909 2.0E-29
sp|A0AIC6|IF2_LISW6 Translation initiation factor IF-2 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=infB PE=3 SV=1 462 909 3.0E-29
sp|Q9Z5I9|IF2_MYCLE Translation initiation factor IF-2 OS=Mycobacterium leprae (strain TN) GN=infB PE=3 SV=1 461 918 3.0E-29
sp|B8ZRT4|IF2_MYCLB Translation initiation factor IF-2 OS=Mycobacterium leprae (strain Br4923) GN=infB PE=3 SV=1 461 918 3.0E-29
sp|Q28WF7|IF2_JANSC Translation initiation factor IF-2 OS=Jannaschia sp. (strain CCS1) GN=infB PE=3 SV=1 462 901 3.0E-29
sp|Q0T0B3|IF2_SHIF8 Translation initiation factor IF-2 OS=Shigella flexneri serotype 5b (strain 8401) GN=infB PE=3 SV=1 462 974 3.0E-29
sp|Q8Y7F6|IF2_LISMO Translation initiation factor IF-2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=infB PE=3 SV=1 462 909 3.0E-29
sp|B5YHT8|IF2_THEYD Translation initiation factor IF-2 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=infB PE=3 SV=1 462 910 3.0E-29
sp|A2C6Q5|IF2_PROM3 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9303) GN=infB PE=3 SV=1 462 981 3.0E-29
sp|B4SQS0|IF2_STRM5 Translation initiation factor IF-2 OS=Stenotrophomonas maltophilia (strain R551-3) GN=infB PE=3 SV=1 462 974 3.0E-29
sp|Q03QT5|IF2_LACBA Translation initiation factor IF-2 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=infB PE=3 SV=1 446 910 3.0E-29
sp|Q7WHG2|IF2_BORBR Translation initiation factor IF-2 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=infB PE=3 SV=1 462 913 3.0E-29
sp|Q71ZZ7|IF2_LISMF Translation initiation factor IF-2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=infB PE=3 SV=1 462 909 3.0E-29
sp|C1L2N1|IF2_LISMC Translation initiation factor IF-2 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=infB PE=3 SV=1 462 909 3.0E-29
sp|Q30WJ0|IF2_DESAG Translation initiation factor IF-2 OS=Desulfovibrio alaskensis (strain G20) GN=infB PE=3 SV=1 462 980 4.0E-29
sp|B5BGJ5|IF2_SALPK Translation initiation factor IF-2 OS=Salmonella paratyphi A (strain AKU_12601) GN=infB PE=3 SV=1 462 974 4.0E-29
sp|Q5PLB0|IF2_SALPA Translation initiation factor IF-2 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=infB PE=3 SV=1 462 974 4.0E-29
sp|Q8EQU1|IF2_OCEIH Translation initiation factor IF-2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=infB PE=3 SV=1 462 909 4.0E-29
sp|B2FN90|IF2_STRMK Translation initiation factor IF-2 OS=Stenotrophomonas maltophilia (strain K279a) GN=infB PE=3 SV=1 452 974 4.0E-29
sp|A2BYM0|IF2_PROM5 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9515) GN=infB PE=3 SV=1 462 980 5.0E-29
sp|Q11PK5|IF2_CYTH3 Translation initiation factor IF-2 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=infB PE=3 SV=1 462 918 5.0E-29
sp|B3QUN2|IF2_CHLT3 Translation initiation factor IF-2 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=infB PE=3 SV=1 462 909 5.0E-29
sp|Q7W9A5|IF2_BORPA Translation initiation factor IF-2 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=infB PE=3 SV=1 462 913 5.0E-29
sp|A4TCF8|IF2_MYCGI Translation initiation factor IF-2 OS=Mycobacterium gilvum (strain PYR-GCK) GN=infB PE=3 SV=1 461 922 5.0E-29
sp|A4WW80|IF2_RHOS5 Translation initiation factor IF-2 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=infB PE=3 SV=1 462 910 5.0E-29
sp|B7IUH1|IF2_BACC2 Translation initiation factor IF-2 OS=Bacillus cereus (strain G9842) GN=infB PE=3 SV=1 462 909 5.0E-29
sp|Q5X1C3|IF2_LEGPA Translation initiation factor IF-2 OS=Legionella pneumophila (strain Paris) GN=infB PE=3 SV=1 462 963 5.0E-29
sp|Q18BH4|IF2_PEPD6 Translation initiation factor IF-2 OS=Peptoclostridium difficile (strain 630) GN=infB PE=3 SV=1 462 909 5.0E-29
sp|Q3BRP5|IF2_XANC5 Translation initiation factor IF-2 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=infB PE=3 SV=1 462 974 5.0E-29
sp|Q6AJY4|IF2_DESPS Translation initiation factor IF-2 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=infB PE=3 SV=1 462 909 6.0E-29
sp|Q5WT36|IF2_LEGPL Translation initiation factor IF-2 OS=Legionella pneumophila (strain Lens) GN=infB PE=3 SV=1 462 963 7.0E-29
sp|B2V4G9|IF2_CLOBA Translation initiation factor IF-2 OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=infB PE=3 SV=1 462 910 7.0E-29
sp|A1T7H8|IF2_MYCVP Translation initiation factor IF-2 OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=infB PE=3 SV=1 461 922 8.0E-29
sp|Q3AZB7|IF2_SYNS9 Translation initiation factor IF-2 OS=Synechococcus sp. (strain CC9902) GN=infB PE=3 SV=1 462 981 8.0E-29
sp|A1SLK7|IF2_NOCSJ Translation initiation factor IF-2 OS=Nocardioides sp. (strain BAA-499 / JS614) GN=infB PE=3 SV=1 462 918 8.0E-29
[Show less]

GO

GO Term Description Terminal node
GO:0003924 GTPase activity Yes
GO:0005525 GTP binding Yes
GO:0016462 pyrophosphatase activity No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:1901265 nucleoside phosphate binding No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016787 hydrolase activity No
GO:0005488 binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0036094 small molecule binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0032555 purine ribonucleotide binding No
GO:0019001 guanyl nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5137
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6150 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3950
Ophiocordyceps camponoti-floridani Ophcf2|04249
Ophiocordyceps camponoti-rufipedis Ophun1|5566
Ophiocordyceps kimflemingae Ophio5|7358
Ophiocordyceps subramaniannii Hirsu2|3501

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6150
MAPKKKGNNRGQDDWEAELGESIQPVAAGAGDEQVDNDEGAQEGAGGFMAMLRKNKEKRKKKGIPTSDDIVDDAE
KTAVEPEPKAPEEATIDDEFALPDKKTKGGAKNKQAAKKTDANDDDNETGKVLTKAEKEKLRKEREKLRKKEQAA
KKKVTAPSKPSEAAKATVVPLEEGVAEPSAAAGADVGGKKKKVPAHLALIQKQQEERRRRQEEVARLEAEAKAKA
EEQDRLDAEEIKRREEQRAAKKQKEKERIEQLKKEGKFLTKAQKEEKARNERKLQQMLAAGIKVGPQDDEAKKKS
VHEGRKKRGKNEQKLDEDAAMAEAAERARVQAEKAMREAEEREAQAKAEAAAKAAATEKAGESDVEEDWEAAADS
EAEDVKDSWDAESGDEGGNGKKSKGSLEDDDDDEDEDDDDEDDDDDQDDERISAARQAEAQRKKEAAERREKAHQ
AALAARSADNLRSPICCVLGHVDTGKTKLLDKVRQTHVQEGEAGGITQQIGATYFPVEAIKHKTAVVNRDNKFEF
KVPGLLVIDTPGHESFSNLRSRGSSLCNIAILVVDIMHGLEPQTLESMRLLRERKTPFIVALNKIDRLYGWKKVD
NNGFQESLALQSKSVHNEFKNRLQQTKLAFAEQGFNSELFYENKSMAKFVSLVPTSAHTGEGVPDMLKLIVQLTQ
ERMVGSLMYLSEVQATVLEVKAIEGFGMTIDVILSNGVLREGDRIVLCGTEGAIKTNIRALLTPAPLRELRLKSA
YVHNKEVKAALGVKISAPGLDGAIAGSRLMVVGPDDDEEDIEDEVESDLAKLLSRVEKSGRGVSVQASTLGSLEA
LLDFLKDCKIPVANVGIGPVYKRDIMQCGIMLEKAPDYAVMLCFDVKIDKEAQAYADEQGIKIFTAAIIYHLFDD
FTRHMDEMLQKKKDQSKLLAVFPCVLTPVAVFNKTNPIVIGVDVADGQLKINTPLAVVKANPVTNVKEVISLGRV
TSIERDHKQIPVCKKGQPSVAIKIEMGAHQPMYGRQIEESDQLYSLISRASIDCLKDFYRKDVSNDEWQLIIKLK
PYFDIN*
Coding >OphauG2|6150
ATGGCGCCCAAGAAAAAGGGCAATAACAGGGGCCAGGATGATTGGGAAGCCGAGCTTGGCGAATCCATTCAACCT
GTTGCAGCCGGGGCAGGCGACGAGCAAGTTGACAATGATGAAGGTGCTCAAGAGGGCGCAGGAGGGTTCATGGCC
ATGTTGCGCAAAAACAAGGAGAAGCGGAAAAAGAAGGGCATACCTACCAGCGACGACATTGTCGATGACGCAGAG
AAGACTGCCGTCGAACCAGAACCAAAGGCTCCAGAAGAGGCGACAATAGATGACGAGTTTGCTCTCCCCGACAAG
AAGACCAAGGGTGGCGCCAAAAACAAGCAGGCGGCCAAAAAGACGGATGCCAATGACGATGACAATGAAACGGGC
AAAGTTCTGACAAAGGCTGAAAAGGAGAAGCTTAGGAAGGAACGCGAAAAGCTGCGGAAAAAAGAACAGGCTGCC
AAAAAGAAGGTGACGGCTCCGAGCAAGCCCTCAGAAGCAGCCAAAGCGACGGTTGTTCCCTTGGAAGAAGGGGTG
GCAGAGCCTTCAGCTGCTGCTGGGGCCGATGTGGGTGGCAAGAAGAAAAAAGTGCCTGCACATCTTGCCTTGATT
CAAAAGCAGCAAGAAGAACGGCGGCGACGTCAGGAAGAAGTGGCACGTCTGGAAGCCGAGGCAAAGGCTAAAGCC
GAGGAACAGGATCGCTTAGATGCCGAGGAAATCAAGCGGCGAGAGGAGCAGAGGGCAGCAAAGAAGCAAAAGGAA
AAGGAGCGCATTGAGCAGCTCAAAAAGGAAGGCAAGTTTCTTACCAAGGCACAAAAGGAAGAAAAGGCTCGCAAC
GAGCGCAAGCTTCAGCAGATGCTGGCGGCGGGCATCAAGGTCGGGCCTCAGGATGACGAAGCAAAGAAGAAGAGT
GTCCATGAGGGCAGAAAAAAGAGGGGCAAAAATGAACAAAAGTTGGATGAAGATGCAGCCATGGCTGAAGCTGCC
GAACGAGCGCGCGTGCAGGCGGAAAAGGCGATGAGGGAAGCAGAAGAGAGAGAGGCGCAAGCCAAGGCTGAGGCA
GCAGCCAAGGCAGCAGCGACAGAAAAGGCGGGCGAGAGCGATGTGGAAGAGGATTGGGAGGCGGCAGCAGACTCG
GAGGCGGAGGATGTAAAGGATAGCTGGGATGCCGAGTCGGGGGATGAGGGCGGCAATGGCAAAAAGAGCAAAGGC
AGCTTGGAGGACGACGACGACGACGAAGACGAAGACGACGACGACGAGGATGATGATGACGACCAAGACGATGAG
CGCATCTCGGCAGCGCGACAGGCCGAGGCGCAGCGGAAAAAGGAGGCGGCAGAGCGCAGGGAAAAGGCGCATCAG
GCGGCGCTGGCCGCTCGGTCGGCGGACAACCTGCGATCACCGATTTGCTGTGTCTTGGGCCACGTGGACACGGGC
AAGACGAAGCTCCTGGACAAGGTGCGGCAGACACACGTGCAAGAAGGCGAGGCGGGAGGAATCACGCAGCAGATT
GGCGCGACGTATTTCCCCGTCGAGGCCATCAAGCACAAGACGGCCGTGGTGAACCGCGACAACAAGTTTGAGTTC
AAGGTGCCCGGGCTGCTGGTGATTGACACGCCGGGGCACGAGTCGTTTTCCAACCTGCGGTCGCGCGGGTCGTCG
CTGTGCAACATTGCCATTCTGGTGGTGGACATTATGCACGGGCTGGAGCCGCAGACGCTCGAGTCGATGCGGCTG
CTGCGCGAGCGCAAGACGCCCTTTATTGTGGCGCTCAACAAGATTGACCGGCTGTACGGGTGGAAAAAGGTGGAC
AACAACGGCTTCCAGGAGAGCCTGGCGCTGCAGAGCAAGTCGGTGCACAACGAGTTCAAGAACCGCCTGCAGCAG
ACCAAGCTGGCCTTTGCCGAGCAGGGCTTCAACTCGGAGCTCTTTTACGAGAACAAGTCCATGGCCAAGTTTGTG
TCGCTGGTGCCCACGTCGGCCCACACGGGCGAGGGCGTGCCCGACATGCTCAAGCTCATTGTCCAGCTGACCCAG
GAGCGCATGGTGGGCTCGCTCATGTACCTGTCCGAGGTGCAGGCCACGGTGCTCGAGGTCAAGGCCATTGAGGGC
TTTGGCATGACGATTGACGTTATCCTGTCCAACGGCGTGCTGCGCGAGGGCGACCGCATTGTGCTGTGCGGCACC
GAGGGCGCCATCAAGACGAACATCCGCGCCCTGCTGACGCCTGCGCCGCTGCGCGAGCTGCGCCTCAAGTCGGCC
TATGTCCACAACAAGGAGGTCAAGGCGGCCCTGGGCGTCAAGATTAGCGCCCCGGGGCTCGACGGCGCCATTGCC
GGCTCGCGCCTCATGGTGGTTGGCCCCGACGACGACGAGGAGGACATTGAGGACGAGGTGGAGTCGGACCTGGCC
AAGCTGCTGAGCCGCGTGGAAAAGTCTGGCCGCGGCGTCAGCGTCCAGGCGTCGACGCTGGGCTCGCTCGAGGCC
CTGCTCGACTTTCTCAAGGACTGCAAGATCCCCGTGGCCAATGTCGGCATCGGGCCCGTCTACAAGCGCGACATT
ATGCAGTGCGGCATCATGCTGGAAAAGGCCCCCGACTATGCCGTCATGCTGTGCTTTGACGTCAAGATTGACAAG
GAGGCCCAGGCCTATGCCGACGAGCAGGGCATCAAGATTTTCACCGCCGCCATCATCTACCACTTGTTTGACGAC
TTTACCCGCCACATGGACGAGATGCTGCAGAAGAAGAAGGACCAGTCCAAGCTGCTGGCCGTCTTTCCCTGCGTC
TTGACCCCCGTCGCCGTCTTTAACAAGACGAATCCCATTGTCATTGGCGTCGATGTCGCCGACGGCCAGCTCAAG
ATTAACACCCCGCTGGCTGTCGTCAAGGCGAATCCCGTCACCAATGTCAAGGAGGTTATAAGCCTCGGCAGAGTA
ACCTCGATTGAGCGCGACCACAAGCAAATCCCCGTCTGCAAAAAGGGCCAGCCCTCGGTCGCCATCAAGATTGAA
ATGGGCGCCCACCAGCCCATGTACGGCCGCCAGATTGAAGAGTCGGACCAGCTCTACAGCCTCATTTCCCGCGCC
AGCATCGACTGCCTCAAGGACTTTTACCGCAAGGACGTGTCGAATGACGAGTGGCAGCTCATTATCAAGCTCAAG
CCCTACTTTGACATTAATTGA
Transcript >OphauG2|6150
ATGGCGCCCAAGAAAAAGGGCAATAACAGGGGCCAGGATGATTGGGAAGCCGAGCTTGGCGAATCCATTCAACCT
GTTGCAGCCGGGGCAGGCGACGAGCAAGTTGACAATGATGAAGGTGCTCAAGAGGGCGCAGGAGGGTTCATGGCC
ATGTTGCGCAAAAACAAGGAGAAGCGGAAAAAGAAGGGCATACCTACCAGCGACGACATTGTCGATGACGCAGAG
AAGACTGCCGTCGAACCAGAACCAAAGGCTCCAGAAGAGGCGACAATAGATGACGAGTTTGCTCTCCCCGACAAG
AAGACCAAGGGTGGCGCCAAAAACAAGCAGGCGGCCAAAAAGACGGATGCCAATGACGATGACAATGAAACGGGC
AAAGTTCTGACAAAGGCTGAAAAGGAGAAGCTTAGGAAGGAACGCGAAAAGCTGCGGAAAAAAGAACAGGCTGCC
AAAAAGAAGGTGACGGCTCCGAGCAAGCCCTCAGAAGCAGCCAAAGCGACGGTTGTTCCCTTGGAAGAAGGGGTG
GCAGAGCCTTCAGCTGCTGCTGGGGCCGATGTGGGTGGCAAGAAGAAAAAAGTGCCTGCACATCTTGCCTTGATT
CAAAAGCAGCAAGAAGAACGGCGGCGACGTCAGGAAGAAGTGGCACGTCTGGAAGCCGAGGCAAAGGCTAAAGCC
GAGGAACAGGATCGCTTAGATGCCGAGGAAATCAAGCGGCGAGAGGAGCAGAGGGCAGCAAAGAAGCAAAAGGAA
AAGGAGCGCATTGAGCAGCTCAAAAAGGAAGGCAAGTTTCTTACCAAGGCACAAAAGGAAGAAAAGGCTCGCAAC
GAGCGCAAGCTTCAGCAGATGCTGGCGGCGGGCATCAAGGTCGGGCCTCAGGATGACGAAGCAAAGAAGAAGAGT
GTCCATGAGGGCAGAAAAAAGAGGGGCAAAAATGAACAAAAGTTGGATGAAGATGCAGCCATGGCTGAAGCTGCC
GAACGAGCGCGCGTGCAGGCGGAAAAGGCGATGAGGGAAGCAGAAGAGAGAGAGGCGCAAGCCAAGGCTGAGGCA
GCAGCCAAGGCAGCAGCGACAGAAAAGGCGGGCGAGAGCGATGTGGAAGAGGATTGGGAGGCGGCAGCAGACTCG
GAGGCGGAGGATGTAAAGGATAGCTGGGATGCCGAGTCGGGGGATGAGGGCGGCAATGGCAAAAAGAGCAAAGGC
AGCTTGGAGGACGACGACGACGACGAAGACGAAGACGACGACGACGAGGATGATGATGACGACCAAGACGATGAG
CGCATCTCGGCAGCGCGACAGGCCGAGGCGCAGCGGAAAAAGGAGGCGGCAGAGCGCAGGGAAAAGGCGCATCAG
GCGGCGCTGGCCGCTCGGTCGGCGGACAACCTGCGATCACCGATTTGCTGTGTCTTGGGCCACGTGGACACGGGC
AAGACGAAGCTCCTGGACAAGGTGCGGCAGACACACGTGCAAGAAGGCGAGGCGGGAGGAATCACGCAGCAGATT
GGCGCGACGTATTTCCCCGTCGAGGCCATCAAGCACAAGACGGCCGTGGTGAACCGCGACAACAAGTTTGAGTTC
AAGGTGCCCGGGCTGCTGGTGATTGACACGCCGGGGCACGAGTCGTTTTCCAACCTGCGGTCGCGCGGGTCGTCG
CTGTGCAACATTGCCATTCTGGTGGTGGACATTATGCACGGGCTGGAGCCGCAGACGCTCGAGTCGATGCGGCTG
CTGCGCGAGCGCAAGACGCCCTTTATTGTGGCGCTCAACAAGATTGACCGGCTGTACGGGTGGAAAAAGGTGGAC
AACAACGGCTTCCAGGAGAGCCTGGCGCTGCAGAGCAAGTCGGTGCACAACGAGTTCAAGAACCGCCTGCAGCAG
ACCAAGCTGGCCTTTGCCGAGCAGGGCTTCAACTCGGAGCTCTTTTACGAGAACAAGTCCATGGCCAAGTTTGTG
TCGCTGGTGCCCACGTCGGCCCACACGGGCGAGGGCGTGCCCGACATGCTCAAGCTCATTGTCCAGCTGACCCAG
GAGCGCATGGTGGGCTCGCTCATGTACCTGTCCGAGGTGCAGGCCACGGTGCTCGAGGTCAAGGCCATTGAGGGC
TTTGGCATGACGATTGACGTTATCCTGTCCAACGGCGTGCTGCGCGAGGGCGACCGCATTGTGCTGTGCGGCACC
GAGGGCGCCATCAAGACGAACATCCGCGCCCTGCTGACGCCTGCGCCGCTGCGCGAGCTGCGCCTCAAGTCGGCC
TATGTCCACAACAAGGAGGTCAAGGCGGCCCTGGGCGTCAAGATTAGCGCCCCGGGGCTCGACGGCGCCATTGCC
GGCTCGCGCCTCATGGTGGTTGGCCCCGACGACGACGAGGAGGACATTGAGGACGAGGTGGAGTCGGACCTGGCC
AAGCTGCTGAGCCGCGTGGAAAAGTCTGGCCGCGGCGTCAGCGTCCAGGCGTCGACGCTGGGCTCGCTCGAGGCC
CTGCTCGACTTTCTCAAGGACTGCAAGATCCCCGTGGCCAATGTCGGCATCGGGCCCGTCTACAAGCGCGACATT
ATGCAGTGCGGCATCATGCTGGAAAAGGCCCCCGACTATGCCGTCATGCTGTGCTTTGACGTCAAGATTGACAAG
GAGGCCCAGGCCTATGCCGACGAGCAGGGCATCAAGATTTTCACCGCCGCCATCATCTACCACTTGTTTGACGAC
TTTACCCGCCACATGGACGAGATGCTGCAGAAGAAGAAGGACCAGTCCAAGCTGCTGGCCGTCTTTCCCTGCGTC
TTGACCCCCGTCGCCGTCTTTAACAAGACGAATCCCATTGTCATTGGCGTCGATGTCGCCGACGGCCAGCTCAAG
ATTAACACCCCGCTGGCTGTCGTCAAGGCGAATCCCGTCACCAATGTCAAGGAGGTTATAAGCCTCGGCAGAGTA
ACCTCGATTGAGCGCGACCACAAGCAAATCCCCGTCTGCAAAAAGGGCCAGCCCTCGGTCGCCATCAAGATTGAA
ATGGGCGCCCACCAGCCCATGTACGGCCGCCAGATTGAAGAGTCGGACCAGCTCTACAGCCTCATTTCCCGCGCC
AGCATCGACTGCCTCAAGGACTTTTACCGCAAGGACGTGTCGAATGACGAGTGGCAGCTCATTATCAAGCTCAAG
CCCTACTTTGACATTAATTGA
Gene >OphauG2|6150
ATGGCGCCCAAGAAAAAGGGCAATAACAGGGGCCAGGATGATTGGGAAGCCGAGCTTGGCGAATCCATTCAACCT
GTTGCAGCCGGGGCAGGCGACGAGCAAGTTGACAATGATGAAGGTGCTCAAGAGGGCGCAGGAGGGTTCATGGCC
ATGTTGCGCAAAAACAAGGAGAAGCGGAAAAAGAAGGGCATACCTACCAGCGACGACATTGTCGATGACGCAGAG
AAGACTGCCGTCGAACCAGAACCAAAGGCTCCAGAAGAGGCGACAATAGATGACGAGTTTGCTCTCCCCGACAAG
AAGACCAAGGGTGGCGCCAAAAACAAGCAGGCGGCCAAAAAGACGGATGCCAATGACGATGACAATGAAACGGGC
AAAGTTCTGACAAAGGCTGAAAAGGAGAAGCTTAGGAAGGAACGCGAAAAGCTGCGGAAAAAAGAACAGGTAAAA
TTAGAAGCTGTTTTTTTGGTATTAAAAAAACGAGGGTTAAAAAGCTAATACCGAGTCTGGATCAAAGGCTGCCAA
AAAGAAGGTGACGGCTCCGAGCAAGCCCTCAGAAGCAGCCAAAGCGACGGTTGTTCCCTTGGAAGAAGGGGTGGC
AGAGCCTTCAGCTGCTGCTGGGGCCGATGTGGGTGGCAAGAAGAAAAAAGTGCCTGCACATCTTGCCTTGATTCA
AAAGCAGCAAGAAGAACGGCGGCGACGTCAGGAAGAAGTGGCACGTCTGGAAGCCGAGGCAAAGGCTAAAGCCGA
GGAACAGGATCGCTTAGATGCCGAGGAAATCAAGCGGCGAGAGGAGCAGAGGGCAGCAAAGAAGCAAAAGGAAAA
GGAGCGCATTGAGCAGCTCAAAAAGGAAGGCAAGTTTCTTACCAAGGCACAAAAGGAAGAAAAGGCTCGCAACGA
GCGCAAGCTTCAGCAGATGCTGGCGGCGGGCATCAAGGTCGGGCCTCAGGATGACGAAGCAAAGAAGAAGAGTGT
CCATGAGGGCAGAAAAAAGAGGGGCAAAAATGAACAAAAGGTATGTGTGTGTGTGTGAGAGAGAGAGAGGGTATT
GCGGCTTGAGATGCTAAGCGAGGCATGTTAGTTGGATGAAGATGCAGCCATGGCTGAAGCTGCCGAACGAGCGCG
CGTGCAGGCGGAAAAGGCGATGAGGGAAGCAGAAGAGAGAGAGGCGCAAGCCAAGGCTGAGGCAGCAGCCAAGGC
AGCAGCGACAGAAAAGGCGGGCGAGAGCGATGTGGAAGAGGATTGGGAGGCGGCAGCAGACTCGGAGGCGGAGGA
TGTAAAGGATAGCTGGGATGCCGAGTCGGGGGATGAGGGCGGCAATGGCAAAAAGAGCAAAGGCAGCTTGGAGGA
CGACGACGACGACGAAGACGAAGACGACGACGACGAGGATGATGATGACGACCAAGACGATGAGCGCATCTCGGC
AGCGCGACAGGCCGAGGCGCAGCGGAAAAAGGAGGCGGCAGAGCGCAGGGAAAAGGCGCATCAGGCGGCGCTGGC
CGCTCGGTCGGCGGACAACCTGCGATCACCGATTTGCTGTGTCTTGGGCCACGTGGACACGGGCAAGACGAAGCT
CCTGGACAAGGTGCGGCAGACACACGTGCAAGAAGGCGAGGCGGGAGGAATCACGCAGCAGATTGGCGCGACGTA
TTTCCCCGTCGAGGCCATCAAGCACAAGACGGCCGTGGTGAACCGCGACAACAAGTTTGAGTTCAAGGTGCCCGG
GCTGCTGGTGATTGACACGCCGGGGCACGAGTCGTTTTCCAACCTGCGGTCGCGCGGGTCGTCGCTGTGCAACAT
TGCCATTCTGGTGGTGGACATTATGCACGGGCTGGAGCCGCAGACGCTCGAGTCGATGCGGCTGCTGCGCGAGCG
CAAGACGCCCTTTATTGTGGCGCTCAACAAGATTGACCGGCTGTACGGGTGGAAAAAGGTGGACAACAACGGCTT
CCAGGAGAGCCTGGCGCTGCAGAGCAAGTCGGTGCACAACGAGTTCAAGAACCGCCTGCAGCAGACCAAGCTGGC
CTTTGCCGAGCAGGGCTTCAACTCGGAGCTCTTTTACGAGAACAAGTCCATGGCCAAGTTTGTGTCGCTGGTGCC
CACGTCGGCCCACACGGGCGAGGGCGTGCCCGACATGCTCAAGCTCATTGTCCAGCTGACCCAGGAGCGCATGGT
GGGCTCGCTCATGTACCTGTCCGAGGTGCAGGCCACGGTGCTCGAGGTCAAGGCCATTGAGGGCTTTGGCATGAC
GATTGACGTTATCCTGTCCAACGGCGTGCTGCGCGAGGGCGACCGCATTGTGCTGTGCGGCACCGAGGGCGCCAT
CAAGACGAACATCCGCGCCCTGCTGACGCCTGCGCCGCTGCGCGAGCTGCGCCTCAAGTCGGCCTATGTCCACAA
CAAGGAGGTCAAGGCGGCCCTGGGCGTCAAGATTAGCGCCCCGGGGCTCGACGGCGCCATTGCCGGCTCGCGCCT
CATGGTGGTTGGCCCCGACGACGACGAGGAGGACATTGAGGACGAGGTGGAGTCGGACCTGGCCAAGCTGCTGAG
CCGCGTGGAAAAGTCTGGCCGCGGCGTCAGCGTCCAGGCGTCGACGCTGGGCTCGCTCGAGGCCCTGCTCGACTT
TCTCAAGGACTGCAAGATCCCCGTGGCCAATGTCGGCATCGGGCCCGTCTACAAGCGCGACATTATGCAGTGCGG
CATCATGCTGGAAAAGGCCCCCGACTATGCCGTCATGCTGTGCTTTGACGTCAAGATTGACAAGGAGGCCCAGGC
CTATGCCGACGAGCAGGGCATCAAGATTTTCACCGCCGCCATCATCTACCACTTGTTTGACGACTTTACCCGCCA
CATGGACGAGATGCTGCAGAAGAAGAAGGACCAGTCCAAGCTGCTGGCCGTCTTTCCCTGCGTCTTGACCCCCGT
CGCCGTCTTTAACAAGACGAATCCCATTGTCATTGGCGTCGATGTCGCCGACGGCCAGCTCAAGATTAACACCCC
GCTGGCTGTCGTCAAGGCGAATCCCGTCACCAATGTCAAGGAGGTTATAAGCCTCGGCAGAGTGTGCGTCTTTTT
TCACTTGTATCCATCCCCTCGTCTACCCAAGCCAACTTTTACTAACCCACTTCCAAACCCTCAGAACCTCGATTG
AGCGCGACCACAAGCAAATCCCCGTCTGCAAAAAGGGCCAGCCCTCGGTCGCCATCAAGATTGAAATGGGCGCCC
ACCAGCCCATGTACGGCCGCCAGATTGAAGAGTCGGACCAGCTCTACAGCCTCATTTCCCGCGCCAGCATCGACT
GCCTCAAGGACTTTTACCGCAAGGACGTGTCGAATGACGAGTGGCAGCTCATTATCAAGCTCAAGCCCTACTTTG
ACATTAATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail