Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6149
Gene name
LocationContig_608:8577..9960
Strand+
Gene length (bp)1383
Transcript length (bp)1269
Coding sequence length (bp)1269
Protein length (aa) 423

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08711 Med26 TFIIS helical bundle-like domain 4.4E-10 271 319

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IJ11|IWS1_GIBZE Transcription factor IWS1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=IWS1 PE=3 SV=1 1 422 0.0E+00
sp|Q870S2|IWS1_NEUCR Transcription factor iws-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=iws-1 PE=3 SV=1 33 419 2.0E-122
sp|Q4WSM6|IWS1_ASPFU Transcription factor iws1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=iws1 PE=3 SV=1 8 414 1.0E-105
sp|Q5BEG5|IWS1_EMENI Transcription factor iws1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=iws1 PE=3 SV=2 31 414 2.0E-93
sp|Q6CGB2|IWS1_YARLI Transcription factor IWS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IWS1 PE=3 SV=1 146 392 5.0E-50
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IJ11|IWS1_GIBZE Transcription factor IWS1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=IWS1 PE=3 SV=1 1 422 0.0E+00
sp|Q870S2|IWS1_NEUCR Transcription factor iws-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=iws-1 PE=3 SV=1 33 419 2.0E-122
sp|Q4WSM6|IWS1_ASPFU Transcription factor iws1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=iws1 PE=3 SV=1 8 414 1.0E-105
sp|Q5BEG5|IWS1_EMENI Transcription factor iws1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=iws1 PE=3 SV=2 31 414 2.0E-93
sp|Q6CGB2|IWS1_YARLI Transcription factor IWS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IWS1 PE=3 SV=1 146 392 5.0E-50
sp|Q5AAR0|IWS1_CANAL Transcription factor IWS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IWS1 PE=3 SV=1 147 417 8.0E-45
sp|Q6BQ49|IWS1_DEBHA Transcription factor IWS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IWS1 PE=3 SV=2 112 417 1.0E-41
sp|Q6FVX3|IWS1_CANGA Transcription factor IWS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IWS1 PE=3 SV=1 153 342 3.0E-41
sp|Q06505|IWS1_YEAST Transcription factor SPN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPN1 PE=1 SV=1 141 339 4.0E-41
sp|Q4P7X6|IWS1_USTMA Transcription factor IWS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=IWS1 PE=3 SV=2 140 346 7.0E-41
sp|Q75EH2|IWS1_ASHGO Transcription factor IWS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IWS1 PE=3 SV=1 153 337 2.0E-39
sp|Q6CVL1|IWS1_KLULA Transcription factor IWS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IWS1 PE=3 SV=1 152 337 2.0E-38
sp|O42964|IWS1_SCHPO Transcription factor iws1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=iws1 PE=3 SV=1 34 346 3.0E-38
sp|P0CO38|IWS1_CRYNJ Transcription factor IWS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=IWS1 PE=3 SV=1 152 334 7.0E-29
sp|P0CO39|IWS1_CRYNB Transcription factor IWS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=IWS1 PE=3 SV=1 152 334 7.0E-29
sp|Q3SWT4|IWS1_RAT Protein IWS1 homolog OS=Rattus norvegicus GN=Iws1 PE=1 SV=1 166 389 9.0E-21
sp|Q8C1D8|IWS1_MOUSE Protein IWS1 homolog OS=Mus musculus GN=Iws1 PE=1 SV=1 166 420 1.0E-20
sp|Q96ST2|IWS1_HUMAN Protein IWS1 homolog OS=Homo sapiens GN=IWS1 PE=1 SV=2 166 389 2.0E-20
sp|Q505H7|IWS1_XENTR Protein IWS1 homolog OS=Xenopus tropicalis GN=iws1 PE=2 SV=1 166 389 2.0E-20
sp|Q6DE96|IWS1A_XENLA Protein IWS1 homolog A OS=Xenopus laevis GN=iws1-a PE=2 SV=1 170 398 5.0E-20
sp|Q61MR2|IWS1_CAEBR IWS1-like protein OS=Caenorhabditis briggsae GN=iws-1 PE=3 SV=3 173 352 1.0E-16
sp|Q19375|IWS1_CAEEL IWS1-like protein OS=Caenorhabditis elegans GN=iws-1 PE=3 SV=1 179 352 2.0E-16
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1022
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6149 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4726
Ophiocordyceps camponoti-floridani Ophcf2|02922
Ophiocordyceps camponoti-rufipedis Ophun1|4913
Ophiocordyceps kimflemingae Ophio5|180
Ophiocordyceps kimflemingae Ophio5|199
Ophiocordyceps subramaniannii Hirsu2|9228

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6149
MSDMGPPASPVADEPVDHGQQGDHEHAMAAADSDRESDMLSEIDENQFEDYDPETANIEDRPVEIDEDIARTLKA
TKRKRADGDAPKKPREGRREKKRRDHDQDISMDQDGEAEAAKTQRRSRRAPEGERRRAKADTPPDGEKEEDLSPE
ERRRRAIDRALDAAIKKPGGGKRRRKDEIDLEDEIDEQLANLKVQMERACQADNTARESGQPALHKLKLLPDVTA
ILNRNNVQHAVLDPDTNFLQHVKFFLEPLNDGSLPAYNIQRDIFMALTRLNIEKEALLSSGIGKVVLFYTRSKKP
EPVIKRMAERLLGEWSRPILKRTDDYKKRHVETREFDHQAAKMAQRQKSQFNLTQRPVQSARDAFLAPQGGNNQA
RMASLPSSYTIAPKSTFDGSRSQDHRPLGASGMEAFRRMTQKTKKRA*
Coding >OphauG2|6149
ATGTCCGACATGGGGCCACCCGCCAGTCCGGTGGCAGACGAGCCTGTCGACCATGGACAACAAGGAGACCACGAG
CATGCCATGGCGGCTGCCGACTCGGATCGCGAATCAGACATGCTTTCCGAAATCGACGAGAATCAGTTTGAGGAC
TACGATCCCGAGACGGCAAACATTGAGGATAGACCAGTAGAAATCGACGAGGACATTGCGCGCACTCTCAAGGCA
ACGAAGCGGAAGCGTGCCGACGGAGACGCGCCAAAGAAGCCGAGAGAAGGCCGCCGGGAAAAGAAGAGGCGGGAC
CACGACCAGGATATCTCGATGGACCAAGATGGCGAAGCCGAGGCGGCCAAGACACAACGGAGGTCAAGGAGAGCT
CCGGAAGGCGAGAGACGCCGGGCCAAAGCTGATACGCCTCCTGATGGGGAAAAGGAAGAGGATTTGAGCCCAGAG
GAACGTAGGAGACGTGCCATTGACCGCGCACTTGATGCTGCCATTAAAAAACCGGGCGGCGGCAAGCGCAGACGC
AAGGACGAGATTGACCTCGAGGACGAGATTGACGAACAACTGGCAAATCTCAAGGTACAGATGGAGCGGGCTTGC
CAGGCGGATAACACTGCACGCGAGTCGGGCCAGCCCGCGTTGCACAAGCTCAAACTACTTCCGGATGTAACGGCC
ATTCTTAACCGCAACAACGTGCAGCACGCGGTACTCGACCCCGACACCAACTTTTTACAACACGTCAAGTTTTTT
CTCGAGCCGCTTAACGATGGATCATTGCCGGCATACAATATACAGCGAGACATTTTCATGGCGCTGACGCGTCTC
AACATTGAAAAGGAGGCACTTTTGAGCAGCGGCATTGGCAAAGTGGTTCTCTTTTACACCCGCAGTAAGAAGCCG
GAGCCGGTGATTAAGCGCATGGCGGAGCGTCTGCTGGGAGAATGGAGCAGGCCGATTCTCAAGCGGACCGACGAC
TACAAGAAGCGGCATGTTGAGACGCGCGAGTTTGATCACCAGGCTGCCAAGATGGCACAGCGACAAAAGAGCCAG
TTCAATCTGACGCAGCGGCCGGTCCAATCTGCGCGTGACGCGTTTCTGGCGCCACAGGGAGGTAACAATCAGGCC
AGAATGGCTAGCCTGCCGTCGAGTTACACAATTGCGCCCAAGAGCACGTTTGACGGGTCGCGAAGTCAGGATCAC
CGCCCGCTTGGGGCGAGTGGGATGGAGGCTTTTAGGCGCATGACGCAAAAGACAAAGAAGCGTGCCTGA
Transcript >OphauG2|6149
ATGTCCGACATGGGGCCACCCGCCAGTCCGGTGGCAGACGAGCCTGTCGACCATGGACAACAAGGAGACCACGAG
CATGCCATGGCGGCTGCCGACTCGGATCGCGAATCAGACATGCTTTCCGAAATCGACGAGAATCAGTTTGAGGAC
TACGATCCCGAGACGGCAAACATTGAGGATAGACCAGTAGAAATCGACGAGGACATTGCGCGCACTCTCAAGGCA
ACGAAGCGGAAGCGTGCCGACGGAGACGCGCCAAAGAAGCCGAGAGAAGGCCGCCGGGAAAAGAAGAGGCGGGAC
CACGACCAGGATATCTCGATGGACCAAGATGGCGAAGCCGAGGCGGCCAAGACACAACGGAGGTCAAGGAGAGCT
CCGGAAGGCGAGAGACGCCGGGCCAAAGCTGATACGCCTCCTGATGGGGAAAAGGAAGAGGATTTGAGCCCAGAG
GAACGTAGGAGACGTGCCATTGACCGCGCACTTGATGCTGCCATTAAAAAACCGGGCGGCGGCAAGCGCAGACGC
AAGGACGAGATTGACCTCGAGGACGAGATTGACGAACAACTGGCAAATCTCAAGGTACAGATGGAGCGGGCTTGC
CAGGCGGATAACACTGCACGCGAGTCGGGCCAGCCCGCGTTGCACAAGCTCAAACTACTTCCGGATGTAACGGCC
ATTCTTAACCGCAACAACGTGCAGCACGCGGTACTCGACCCCGACACCAACTTTTTACAACACGTCAAGTTTTTT
CTCGAGCCGCTTAACGATGGATCATTGCCGGCATACAATATACAGCGAGACATTTTCATGGCGCTGACGCGTCTC
AACATTGAAAAGGAGGCACTTTTGAGCAGCGGCATTGGCAAAGTGGTTCTCTTTTACACCCGCAGTAAGAAGCCG
GAGCCGGTGATTAAGCGCATGGCGGAGCGTCTGCTGGGAGAATGGAGCAGGCCGATTCTCAAGCGGACCGACGAC
TACAAGAAGCGGCATGTTGAGACGCGCGAGTTTGATCACCAGGCTGCCAAGATGGCACAGCGACAAAAGAGCCAG
TTCAATCTGACGCAGCGGCCGGTCCAATCTGCGCGTGACGCGTTTCTGGCGCCACAGGGAGGTAACAATCAGGCC
AGAATGGCTAGCCTGCCGTCGAGTTACACAATTGCGCCCAAGAGCACGTTTGACGGGTCGCGAAGTCAGGATCAC
CGCCCGCTTGGGGCGAGTGGGATGGAGGCTTTTAGGCGCATGACGCAAAAGACAAAGAAGCGTGCCTGA
Gene >OphauG2|6149
ATGTCCGACATGGGGCCACCCGCCAGTCCGGTGGCAGACGAGCCTGTCGACCATGGACAACAAGGAGACCACGAG
CATGCCATGGCGGCTGCCGACTCGGATCGCGAATCAGACATGCTTTCCGAAATCGACGAGAATCAGTTTGAGGAC
TACGATCCCGAGACGGCAAACATTGAGGATAGACCAGTAGAAATCGACGAGGACATTGCGCGCACTCTCAAGGCA
ACGAAGCGGAAGCGTGCCGACGGAGACGCGCCAAAGAAGCCGAGAGAAGGCCGCCGGGAAAAGAAGAGGCGGGAC
CACGACCAGGATATCTCGATGGACCAAGATGGCGAAGCCGAGGCGGCCAAGACACAACGGAGGTCAAGGAGAGCT
CCGGAAGGCGAGAGACGCCGGGCCAAAGCTGATACGCCTCCTGATGGGGAAAAGGAAGAGGATTTGAGCCCAGAG
GAACGTAGGAGACGTGCCATTGACCGCGCACTTGATGCTGCCATTAAAAAACCGGGCGGCGGCAAGCGCAGACGC
AAGGACGAGATTGTAAGTGGACTCGAGGCGCAGGTTGGAAGCAAGCTAGATACTGACTGTGCACCAAGGACCTCG
AGGACGAGATTGACGAACAACTGGCAAATCTCAAGGTACAGATGGAGCGGGCTTGCCAGGCGGATAACACTGCAC
GCGAGTCGGGCCAGCCCGCGTTGCACAAGCTCAAACTACTTCCGGATGTAACGGCCATTCTTAACCGCAACAACG
TGCAGCACGCGGTACTCGACCCCGACACCAACTTTTTACAACACGTCAAGTTTTTTCTCGAGCCGCTTAACGATG
GATCATTGCCGGCATACAATATACAGCGAGACATTTTCATGGCGCTGACGCGTCTCAACATTGAAAAGGAGGCAC
TTTTGAGCAGCGGCATTGGCAAAGTGGTTCTCTTTTACACCCGCAGTAAGAAGCCGGAGCCGGTGATTAAGCGCA
TGGCGGAGCGTCTGCTGGGAGAATGGAGCAGGCCGATTCTCAAGCGGACCGACGACTACAAGAAGCGGCATGTTG
AGACGCGCGAGTTTGATCACCAGTAAGTGGGCGTGACTCTGGGGAGTGCGGCTTGATGATGGGCTGACGGGCTGC
TACAGGGCTGCCAAGATGGCACAGCGACAAAAGAGCCAGTTCAATCTGACGCAGCGGCCGGTCCAATCTGCGCGT
GACGCGTTTCTGGCGCCACAGGGAGGTAACAATCAGGCCAGAATGGCTAGCCTGCCGTCGAGTTACACAATTGCG
CCCAAGAGCACGTTTGACGGGTCGCGAAGTCAGGATCACCGCCCGCTTGGGGCGAGTGGGATGGAGGCTTTTAGG
CGCATGACGCAAAAGACAAAGAAGCGTGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail