Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6140
Gene name
LocationContig_606:4980..6239
Strand-
Gene length (bp)1259
Transcript length (bp)1062
Coding sequence length (bp)1062
Protein length (aa) 354

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16546 SGTA_dimer Homodimerisation domain of SGTA 4.9E-22 9 72
PF07719 TPR_2 Tetratricopeptide repeat 9.9E-06 95 128

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12118|SGT2_YEAST Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGT2 PE=1 SV=1 9 333 3.0E-55
sp|P0CT30|SGT2_USTMA Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_10205 PE=3 SV=1 13 330 1.0E-50
sp|O13797|SGT2_SCHPO Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sgt2 PE=3 SV=1 9 327 3.0E-47
sp|Q32LM2|SGTA_BOVIN Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Bos taurus GN=SGTA PE=2 SV=1 7 339 8.0E-32
sp|Q96EQ0|SGTB_HUMAN Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Homo sapiens GN=SGTB PE=1 SV=1 7 302 1.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12118|SGT2_YEAST Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGT2 PE=1 SV=1 9 333 3.0E-55
sp|P0CT30|SGT2_USTMA Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_10205 PE=3 SV=1 13 330 1.0E-50
sp|O13797|SGT2_SCHPO Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sgt2 PE=3 SV=1 9 327 3.0E-47
sp|Q32LM2|SGTA_BOVIN Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Bos taurus GN=SGTA PE=2 SV=1 7 339 8.0E-32
sp|Q96EQ0|SGTB_HUMAN Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Homo sapiens GN=SGTB PE=1 SV=1 7 302 1.0E-30
sp|O43765|SGTA_HUMAN Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Homo sapiens GN=SGTA PE=1 SV=1 7 339 2.0E-30
sp|O70593|SGTA_RAT Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Rattus norvegicus GN=Sgta PE=1 SV=1 7 311 6.0E-29
sp|Q8BJU0|SGTA_MOUSE Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Mus musculus GN=Sgta PE=1 SV=2 7 311 6.0E-29
sp|Q80W98|SGTB_RAT Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Rattus norvegicus GN=Sgtb PE=1 SV=1 7 302 3.0E-28
sp|Q8VD33|SGTB_MOUSE Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Mus musculus GN=Sgtb PE=1 SV=1 7 302 3.0E-28
sp|Q54VG4|SGT_DICDI Small glutamine-rich tetratricopeptide repeat-containing protein OS=Dictyostelium discoideum GN=sgt PE=1 SV=1 9 300 1.0E-22
sp|Q9USI5|STI1_SCHPO Heat shock protein sti1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sti1 PE=3 SV=1 94 297 4.0E-22
sp|Q9STH1|HSOP3_ARATH Hsp70-Hsp90 organizing protein 3 OS=Arabidopsis thaliana GN=HOP3 PE=2 SV=1 93 308 7.0E-16
sp|Q5XEP2|HSOP2_ARATH Hsp70-Hsp90 organizing protein 2 OS=Arabidopsis thaliana GN=HOP2 PE=1 SV=1 99 308 9.0E-15
sp|Q43468|HSOP1_SOYBN Hsp70-Hsp90 organizing protein 1 OS=Glycine max GN=HOP1 PE=1 SV=2 94 308 7.0E-14
sp|Q43468|HSOP1_SOYBN Hsp70-Hsp90 organizing protein 1 OS=Glycine max GN=HOP1 PE=1 SV=2 94 297 1.0E-13
sp|Q9LNB6|HSOP1_ARATH Hsp70-Hsp90 organizing protein 1 OS=Arabidopsis thaliana GN=HOP1 PE=2 SV=1 94 297 1.0E-13
sp|Q9LNB6|HSOP1_ARATH Hsp70-Hsp90 organizing protein 1 OS=Arabidopsis thaliana GN=HOP1 PE=2 SV=1 99 308 1.0E-13
sp|P15705|STI1_YEAST Heat shock protein STI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STI1 PE=1 SV=1 95 350 1.0E-13
sp|Q9STH1|HSOP3_ARATH Hsp70-Hsp90 organizing protein 3 OS=Arabidopsis thaliana GN=HOP3 PE=2 SV=1 94 190 2.0E-13
sp|Q9LVH5|OE64C_ARATH Outer envelope protein 64, chloroplastic OS=Arabidopsis thaliana GN=OEP64 PE=1 SV=1 95 195 3.0E-13
sp|Q5XEP2|HSOP2_ARATH Hsp70-Hsp90 organizing protein 2 OS=Arabidopsis thaliana GN=HOP2 PE=1 SV=1 94 190 3.0E-13
sp|Q60864|STIP1_MOUSE Stress-induced-phosphoprotein 1 OS=Mus musculus GN=Stip1 PE=1 SV=1 98 297 3.0E-13
sp|Q8ILC1|STI1L_PLAF7 STI1-like protein OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0324 PE=3 SV=1 95 297 5.0E-13
sp|O35814|STIP1_RAT Stress-induced-phosphoprotein 1 OS=Rattus norvegicus GN=Stip1 PE=1 SV=1 98 297 5.0E-13
sp|O54981|STIP1_CRIGR Stress-induced-phosphoprotein 1 OS=Cricetulus griseus GN=STIP1 PE=2 SV=1 98 297 6.0E-13
sp|F8RP11|HSOP_WHEAT Hsp70-Hsp90 organizing protein OS=Triticum aestivum GN=HOP PE=1 SV=1 94 210 7.0E-13
sp|Q3ZBZ8|STIP1_BOVIN Stress-induced-phosphoprotein 1 OS=Bos taurus GN=STIP1 PE=2 SV=1 98 297 1.0E-12
sp|P31948|STIP1_HUMAN Stress-induced-phosphoprotein 1 OS=Homo sapiens GN=STIP1 PE=1 SV=1 98 297 1.0E-12
sp|Q4R8N7|STIP1_MACFA Stress-induced-phosphoprotein 1 OS=Macaca fascicularis GN=STIP1 PE=2 SV=1 98 297 1.0E-12
sp|Q9H892|TTC12_HUMAN Tetratricopeptide repeat protein 12 OS=Homo sapiens GN=TTC12 PE=1 SV=2 91 205 2.0E-12
sp|Q54DA8|STIP1_DICDI Protein STIP1 homolog OS=Dictyostelium discoideum GN=sti1 PE=3 SV=1 95 297 2.0E-12
sp|Q84K11|PPP5_SOLLC Serine/threonine-protein phosphatase 5 OS=Solanum lycopersicum GN=PP5 PE=1 SV=1 87 188 2.0E-12
sp|Q84XU2|PPP5_ARATH Serine/threonine-protein phosphatase 5 OS=Arabidopsis thaliana GN=PAPP5 PE=1 SV=1 95 188 5.0E-12
sp|P53042|PPP5_RAT Serine/threonine-protein phosphatase 5 OS=Rattus norvegicus GN=Ppp5c PE=1 SV=1 95 213 2.0E-11
sp|P53041|PPP5_HUMAN Serine/threonine-protein phosphatase 5 OS=Homo sapiens GN=PPP5C PE=1 SV=1 87 188 2.0E-11
sp|Q60676|PPP5_MOUSE Serine/threonine-protein phosphatase 5 OS=Mus musculus GN=Ppp5c PE=1 SV=3 87 213 2.0E-11
sp|Q8BW49|TTC12_MOUSE Tetratricopeptide repeat protein 12 OS=Mus musculus GN=Ttc12 PE=1 SV=1 91 188 2.0E-11
sp|Q3ZBZ8|STIP1_BOVIN Stress-induced-phosphoprotein 1 OS=Bos taurus GN=STIP1 PE=2 SV=1 99 282 3.0E-11
sp|Q95LY5|TTC12_MACFA Tetratricopeptide repeat protein 12 (Fragment) OS=Macaca fascicularis GN=TTC12 PE=2 SV=1 91 205 3.0E-11
sp|O54981|STIP1_CRIGR Stress-induced-phosphoprotein 1 OS=Cricetulus griseus GN=STIP1 PE=2 SV=1 99 282 8.0E-11
sp|Q60864|STIP1_MOUSE Stress-induced-phosphoprotein 1 OS=Mus musculus GN=Stip1 PE=1 SV=1 99 190 1.0E-10
sp|O35814|STIP1_RAT Stress-induced-phosphoprotein 1 OS=Rattus norvegicus GN=Stip1 PE=1 SV=1 99 282 1.0E-10
sp|Q4R8N7|STIP1_MACFA Stress-induced-phosphoprotein 1 OS=Macaca fascicularis GN=STIP1 PE=2 SV=1 99 282 2.0E-10
sp|P31948|STIP1_HUMAN Stress-induced-phosphoprotein 1 OS=Homo sapiens GN=STIP1 PE=1 SV=1 99 282 3.0E-10
sp|Q54DA8|STIP1_DICDI Protein STIP1 homolog OS=Dictyostelium discoideum GN=sti1 PE=3 SV=1 99 297 5.0E-10
sp|F8RP11|HSOP_WHEAT Hsp70-Hsp90 organizing protein OS=Triticum aestivum GN=HOP PE=1 SV=1 94 190 8.0E-10
sp|Q99615|DNJC7_HUMAN DnaJ homolog subfamily C member 7 OS=Homo sapiens GN=DNAJC7 PE=1 SV=2 88 190 1.0E-09
sp|Q9MUK5|TOC64_PEA Translocon at the outer membrane of chloroplasts 64 OS=Pisum sativum GN=TOC64 PE=1 SV=1 95 193 2.0E-09
sp|O43049|PPT1_SCHPO Serine/threonine-protein phosphatase T OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppt1 PE=3 SV=2 98 190 2.0E-09
sp|Q5R8D8|DNJC7_PONAB DnaJ homolog subfamily C member 7 OS=Pongo abelii GN=DNAJC7 PE=2 SV=1 88 190 2.0E-09
sp|Q9QYI3|DNJC7_MOUSE DnaJ homolog subfamily C member 7 OS=Mus musculus GN=Dnajc7 PE=1 SV=2 88 190 3.0E-09
sp|Q5ZKQ3|RPAP3_CHICK RNA polymerase II-associated protein 3 OS=Gallus gallus GN=RPAP3 PE=2 SV=1 92 196 7.0E-09
sp|Q9H6T3|RPAP3_HUMAN RNA polymerase II-associated protein 3 OS=Homo sapiens GN=RPAP3 PE=1 SV=2 97 203 9.0E-09
sp|O14217|TOM70_SCHPO Probable mitochondrial import receptor subunit tom70 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tom70 PE=1 SV=1 94 177 2.0E-08
sp|Q28IV3|RPAP3_XENTR RNA polymerase II-associated protein 3 OS=Xenopus tropicalis GN=rpap3 PE=2 SV=1 99 196 1.0E-07
sp|P23231|TOM70_NEUCR Mitochondrial import receptor subunit tom70 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tom70 PE=2 SV=3 80 175 1.0E-07
sp|O16259|STIP1_CAEEL Stress-induced-phosphoprotein 1 OS=Caenorhabditis elegans GN=sti-1 PE=1 SV=1 94 299 2.0E-07
sp|P53043|PPT1_YEAST Serine/threonine-protein phosphatase T OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPT1 PE=1 SV=1 99 182 3.0E-07
sp|Q80ZK9|WDTC1_MOUSE WD and tetratricopeptide repeats protein 1 OS=Mus musculus GN=Wdtc1 PE=1 SV=1 96 185 4.0E-07
sp|Q84JR9|TTL4_ARATH TPR repeat-containing thioredoxin TTL4 OS=Arabidopsis thaliana GN=TTL4 PE=2 SV=1 95 182 4.0E-07
sp|Q9D706|RPAP3_MOUSE RNA polymerase II-associated protein 3 OS=Mus musculus GN=Rpap3 PE=1 SV=1 97 193 4.0E-07
sp|Q28IV3|RPAP3_XENTR RNA polymerase II-associated protein 3 OS=Xenopus tropicalis GN=rpap3 PE=2 SV=1 99 187 6.0E-07
sp|Q6NU95|RPAP3_XENLA RNA polymerase II-associated protein 3 OS=Xenopus laevis GN=rpap3 PE=2 SV=1 99 196 6.0E-07
sp|Q96AY4|TTC28_HUMAN Tetratricopeptide repeat protein 28 OS=Homo sapiens GN=TTC28 PE=1 SV=4 88 190 1.0E-06
sp|Q68FQ7|RPAP3_RAT RNA polymerase II-associated protein 3 OS=Rattus norvegicus GN=Rpap3 PE=1 SV=1 97 186 1.0E-06
sp|Q43468|HSOP1_SOYBN Hsp70-Hsp90 organizing protein 1 OS=Glycine max GN=HOP1 PE=1 SV=2 92 213 2.0E-06
sp|Q80XJ3|TTC28_MOUSE Tetratricopeptide repeat protein 28 OS=Mus musculus GN=Ttc28 PE=1 SV=3 101 190 2.0E-06
sp|Q0JL44|SGT1_ORYSJ Protein SGT1 homolog OS=Oryza sativa subsp. japonica GN=SGT1 PE=1 SV=1 98 215 2.0E-06
sp|Q80ZX8|SPAG1_MOUSE Sperm-associated antigen 1 OS=Mus musculus GN=Spag1 PE=1 SV=1 92 239 2.0E-06
sp|F4IXE4|TTL2_ARATH TPR repeat-containing thioredoxin TTL2 OS=Arabidopsis thaliana GN=TTL2 PE=2 SV=2 96 177 4.0E-06
sp|Q6NU95|RPAP3_XENLA RNA polymerase II-associated protein 3 OS=Xenopus laevis GN=rpap3 PE=2 SV=1 72 187 1.0E-05
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5406
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6140 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3808
Ophiocordyceps camponoti-floridani Ophcf2|04689
Ophiocordyceps camponoti-rufipedis Ophun1|6426
Ophiocordyceps kimflemingae Ophio5|5322
Ophiocordyceps subramaniannii Hirsu2|5646

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6140
MTSAEKLGSKQRLALAICDFLSTSTKDGTLAADDAESVDVAINCISECFKVDGAAAGGARSSASASLLTIFEAAS
ARSSEAAAAAAADGGGKTMAEALKNKGNAAMAQRDYASAVGLYSQALELVPRNAIFLSNRAAAHSAAGDHEAARV
DAEAAVAADPGYTKGWSRLGLARYALGDPRGAMEAYQSGMTHEGNGGSDVMRKGYEKAKRTVEDLDAAAGARSAS
TPSTAAPGAGGLPDLSSLASMFSGGAGGAGAGAQGGMPDLSSIMSNPMFAGMAQNLMSNPDLMGRLMNNPRLRDM
ASQFSSGGGMPDLNSLMSDPNIAEMARSMMGGASPGADNPSNPGRGSGPPNDS*
Coding >OphauG2|6140
ATGACATCGGCCGAGAAACTCGGCTCCAAGCAGCGTCTGGCGCTGGCCATTTGCGATTTCCTCAGCACGTCGACC
AAGGACGGGACGCTGGCCGCCGACGACGCGGAATCTGTGGACGTGGCGATTAACTGTATATCGGAATGCTTCAAA
GTGGATGGCGCAGCGGCGGGCGGCGCAAGGAGCAGTGCTTCGGCGTCGTTGCTGACGATTTTTGAAGCAGCAAGC
GCACGGAGCAGTGAAGCGGCAGCAGCAGCAGCGGCGGACGGCGGGGGCAAGACAATGGCGGAAGCACTCAAGAAT
AAAGGAAACGCCGCCATGGCTCAGCGGGACTATGCGAGCGCGGTTGGGCTGTACTCGCAGGCGCTGGAGCTGGTG
CCGCGGAATGCCATCTTCCTGTCGAACCGCGCGGCGGCGCATTCGGCCGCGGGGGACCATGAGGCTGCGAGGGTG
GATGCAGAGGCGGCCGTTGCCGCGGACCCCGGGTATACAAAGGGCTGGTCCAGGCTCGGGCTGGCGCGCTATGCG
CTTGGGGACCCGCGCGGTGCCATGGAGGCCTATCAGAGTGGCATGACGCACGAGGGCAACGGTGGCTCGGATGTC
ATGCGCAAGGGCTATGAAAAGGCCAAGCGCACCGTGGAGGATCTCGACGCCGCTGCTGGCGCCCGCTCCGCTTCC
ACGCCGTCCACCGCCGCCCCTGGGGCTGGCGGCTTGCCCGACTTGAGCAGCTTGGCCTCCATGTTTTCGGGCGGT
GCTGGCGGTGCCGGCGCTGGCGCTCAGGGCGGCATGCCCGACTTGAGCTCCATCATGAGCAACCCCATGTTTGCC
GGCATGGCCCAGAACCTCATGAGCAACCCAGACCTCATGGGCCGCCTCATGAATAACCCGCGTCTGCGCGACATG
GCTTCTCAGTTTAGCAGCGGCGGCGGCATGCCCGATCTCAACAGCCTCATGTCGGACCCGAACATTGCAGAAATG
GCTCGATCAATGATGGGCGGCGCCTCTCCCGGCGCTGACAACCCCTCCAACCCCGGCCGTGGCTCCGGTCCCCCC
AACGACTCGTAA
Transcript >OphauG2|6140
ATGACATCGGCCGAGAAACTCGGCTCCAAGCAGCGTCTGGCGCTGGCCATTTGCGATTTCCTCAGCACGTCGACC
AAGGACGGGACGCTGGCCGCCGACGACGCGGAATCTGTGGACGTGGCGATTAACTGTATATCGGAATGCTTCAAA
GTGGATGGCGCAGCGGCGGGCGGCGCAAGGAGCAGTGCTTCGGCGTCGTTGCTGACGATTTTTGAAGCAGCAAGC
GCACGGAGCAGTGAAGCGGCAGCAGCAGCAGCGGCGGACGGCGGGGGCAAGACAATGGCGGAAGCACTCAAGAAT
AAAGGAAACGCCGCCATGGCTCAGCGGGACTATGCGAGCGCGGTTGGGCTGTACTCGCAGGCGCTGGAGCTGGTG
CCGCGGAATGCCATCTTCCTGTCGAACCGCGCGGCGGCGCATTCGGCCGCGGGGGACCATGAGGCTGCGAGGGTG
GATGCAGAGGCGGCCGTTGCCGCGGACCCCGGGTATACAAAGGGCTGGTCCAGGCTCGGGCTGGCGCGCTATGCG
CTTGGGGACCCGCGCGGTGCCATGGAGGCCTATCAGAGTGGCATGACGCACGAGGGCAACGGTGGCTCGGATGTC
ATGCGCAAGGGCTATGAAAAGGCCAAGCGCACCGTGGAGGATCTCGACGCCGCTGCTGGCGCCCGCTCCGCTTCC
ACGCCGTCCACCGCCGCCCCTGGGGCTGGCGGCTTGCCCGACTTGAGCAGCTTGGCCTCCATGTTTTCGGGCGGT
GCTGGCGGTGCCGGCGCTGGCGCTCAGGGCGGCATGCCCGACTTGAGCTCCATCATGAGCAACCCCATGTTTGCC
GGCATGGCCCAGAACCTCATGAGCAACCCAGACCTCATGGGCCGCCTCATGAATAACCCGCGTCTGCGCGACATG
GCTTCTCAGTTTAGCAGCGGCGGCGGCATGCCCGATCTCAACAGCCTCATGTCGGACCCGAACATTGCAGAAATG
GCTCGATCAATGATGGGCGGCGCCTCTCCCGGCGCTGACAACCCCTCCAACCCCGGCCGTGGCTCCGGTCCCCCC
AACGACTCGTAA
Gene >OphauG2|6140
ATGGTTCGTCATTACGCCTTTTTTTTTGTTTTCGCCGTTTGAATAAAGAAGAAGACGTGGCAGCTAGGCAAAAGA
ACAATAATAATAATAACAACGCGAAAAAAAAATAGACATCGGCCGAGAAACTCGGCTCCAAGCAGCGTCTGGCGC
TGGCCATTTGCGATTTCCTCAGCACGTCGACCAAGGACGGGACGCTGGCCGCCGACGACGCGGAATCTGTGGACG
TGGCGATTAACTGTATATCGGAATGCTTCAAAGTGGATGGCGCAGCGGCGGGCGGCGCAAGGAGCAGTGCTTCGG
CGTCGTTGCTGACGATTTTTGAAGCAGCAAGCGCACGGAGCAGTGAAGCGGCAGCAGCAGCAGCGGCGGACGGCG
GGGGCAAGACAATGGCGGAAGCACTCAAGAATAAAGGAAACGCCGCCATGGCTCAGCGGGACTATGCGAGCGCGG
TTGGGCTGTACTCGCAGGCGCTGGAGCTGGTGCCGCGGAATGCCATCTTCCTGTCGAACCGCGCGGCGGCGCATT
CGGCCGCGGGGGACCATGAGGCTGCGAGGGTGGATGCAGAGGCGGCCGTTGCCGCGGACCCCGGGTATACAAAGG
GCTGGTCCAGGCTCGGGCTGGCGCGCTATGCGCTTGGGGACCCGCGCGGTGCCATGGAGGCCTATCAGAGTGGCA
TGACGCACGAGGGCAACGGTGGCTCGGATGTCATGCGCAAGGGCTATGAAAAGGCCAAGCGCACCGTGGAGGATC
TCGACGCCGCTGCTGGCGCCCGCTCCGCTTCCACGCCGTCCACCGCCGCCCCTGGGGCTGGCGGCTTGCCCGACT
TGAGCAGCTTGGCCTCCATGTTTTCGGGCGGTGCTGGCGGTGCCGGCGCTGGCGCTCAGGGCGGCATGCCCGACT
TGAGCTCCATCATGAGCAACCCCATGTTTGCCGGCATGGCCCAGAACCTCATGAGCAACCCAGACCTCATGGGCC
GCCTCATGAATAACCCGCGTCTGCGCGACATGGCTTCTCAGTTTAGCAGCGGCGGCGGCATGCCCGATCTCAACA
GCCTCATGTCGGACCCGAACATTGCAGAAATGTACGTCTTGTCCTCCCCCTCCTCCTCTTCTTCTTCTTCCTTCA
TGACCCCCTCCCTCTCCTCTTCCTCTCCTGACTCATCCGCTCCCAGGGCTCGATCAATGATGGGCGGCGCCTCTC
CCGGCGCTGACAACCCCTCCAACCCCGGCCGTGGCTCCGGTCCCCCCAACGACTCGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail