Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|614
Gene name
LocationContig_1150:27..2059
Strand-
Gene length (bp)2032
Transcript length (bp)1752
Coding sequence length (bp)1752
Protein length (aa) 584

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 5.6E-50 54 231
PF00679 EFG_C Elongation factor G C-terminus 8.3E-19 454 538
PF01926 MMR_HSR1 50S ribosome-binding GTPase 1.3E-04 59 167

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C7ZA26|GUF1_NECH7 Translation factor GUF1, mitochondrial OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=GUF1 PE=3 SV=1 1 579 0.0E+00
sp|D1ZET3|GUF1_SORMK Translation factor GUF1, mitochondrial OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=GUF1 PE=3 SV=1 42 582 0.0E+00
sp|Q7S0P6|GUF1_NEUCR Translation factor guf1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=guf1 PE=3 SV=2 42 582 0.0E+00
sp|C0NZL9|GUF1_AJECG Translation factor GUF1, mitochondrial OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=GUF1 PE=3 SV=1 26 579 0.0E+00
sp|C6HPI9|GUF1_AJECH Translation factor GUF1, mitochondrial OS=Ajellomyces capsulatus (strain H143) GN=GUF1 PE=3 SV=2 26 579 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C7ZA26|GUF1_NECH7 Translation factor GUF1, mitochondrial OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=GUF1 PE=3 SV=1 1 579 0.0E+00
sp|D1ZET3|GUF1_SORMK Translation factor GUF1, mitochondrial OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=GUF1 PE=3 SV=1 42 582 0.0E+00
sp|Q7S0P6|GUF1_NEUCR Translation factor guf1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=guf1 PE=3 SV=2 42 582 0.0E+00
sp|C0NZL9|GUF1_AJECG Translation factor GUF1, mitochondrial OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=GUF1 PE=3 SV=1 26 579 0.0E+00
sp|C6HPI9|GUF1_AJECH Translation factor GUF1, mitochondrial OS=Ajellomyces capsulatus (strain H143) GN=GUF1 PE=3 SV=2 26 579 0.0E+00
sp|C5JRK2|GUF1_AJEDS Translation factor GUF1, mitochondrial OS=Ajellomyces dermatitidis (strain SLH14081) GN=GUF1 PE=3 SV=1 26 582 0.0E+00
sp|C5GRI9|GUF1_AJEDR Translation factor GUF1, mitochondrial OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=GUF1 PE=3 SV=1 26 582 0.0E+00
sp|A6RGX9|GUF1_AJECN Translation factor GUF1, mitochondrial OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=GUF1 PE=3 SV=2 26 579 0.0E+00
sp|A4QV78|GUF1_MAGO7 Translation factor GUF1, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=GUF1 PE=3 SV=2 32 579 0.0E+00
sp|C0SHD5|GUF1_PARBP Translation factor GUF1, mitochondrial OS=Paracoccidioides brasiliensis (strain Pb03) GN=GUF1 PE=3 SV=1 11 579 0.0E+00
sp|C1GX39|GUF1_PARBA Translation factor GUF1, mitochondrial OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=GUF1 PE=3 SV=2 32 579 0.0E+00
sp|C1GGI6|GUF1_PARBD Translation factor GUF1, mitochondrial OS=Paracoccidioides brasiliensis (strain Pb18) GN=GUF1 PE=3 SV=1 11 579 0.0E+00
sp|C8VPJ1|GUF1_EMENI Translation factor guf1, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=guf1 PE=3 SV=1 41 582 0.0E+00
sp|C4JWU3|GUF1_UNCRE Translation factor GUF1, mitochondrial OS=Uncinocarpus reesii (strain UAMH 1704) GN=GUF1 PE=3 SV=1 27 582 0.0E+00
sp|B8MS24|GUF1_TALSN Translation factor guf1, mitochondrial OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=guf1 PE=3 SV=1 7 582 0.0E+00
sp|A2QU25|GUF1_ASPNC Translation factor guf1, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=guf1 PE=3 SV=1 12 582 0.0E+00
sp|Q2U3T4|GUF1_ASPOR Translation factor guf1, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=guf1 PE=3 SV=1 32 579 0.0E+00
sp|Q0CS42|GUF1_ASPTN Translation factor guf1, mitochondrial OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=guf1 PE=3 SV=1 40 579 0.0E+00
sp|A1CLD7|GUF1_ASPCL Translation factor guf1, mitochondrial OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=guf1 PE=3 SV=1 32 579 0.0E+00
sp|B6QW35|GUF1_TALMQ Translation factor guf1, mitochondrial OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=guf1 PE=3 SV=1 31 582 0.0E+00
sp|A1D5Z0|GUF1_NEOFI Translation factor guf1, mitochondrial OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=guf1 PE=3 SV=1 5 579 0.0E+00
sp|B6H2S6|GUF1_PENRW Translation factor guf1, mitochondrial OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=guf1 PE=3 SV=1 12 582 0.0E+00
sp|C5PCH4|GUF1_COCP7 Translation factor GUF1, mitochondrial OS=Coccidioides posadasii (strain C735) GN=GUF1 PE=3 SV=1 33 582 0.0E+00
sp|Q0V3J4|GUF1_PHANO Translation factor GUF1, mitochondrial OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=GUF1 PE=3 SV=2 9 582 0.0E+00
sp|Q4WYV0|GUF1_ASPFU Translation factor guf1, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=guf1 PE=3 SV=2 5 579 0.0E+00
sp|B0XZZ2|GUF1_ASPFC Translation factor guf1, mitochondrial OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=guf1 PE=3 SV=2 5 579 0.0E+00
sp|C5FMX6|GUF1_ARTOC Translation factor GUF1, mitochondrial OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=GUF1 PE=3 SV=2 21 582 0.0E+00
sp|C5DN84|GUF1_LACTC Translation factor GUF1, mitochondrial OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=GUF1 PE=3 SV=1 29 579 0.0E+00
sp|C5DWG7|GUF1_ZYGRC Translation factor GUF1, mitochondrial OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=GUF1 PE=3 SV=1 34 579 0.0E+00
sp|Q6FR62|GUF1_CANGA Translation factor GUF1, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GUF1 PE=3 SV=1 39 579 0.0E+00
sp|Q74ZG2|GUF1_ASHGO Translation factor GUF1, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GUF1 PE=3 SV=1 33 579 0.0E+00
sp|C4Y8M4|GUF1_CLAL4 Translation factor GUF1, mitochondrial OS=Clavispora lusitaniae (strain ATCC 42720) GN=GUF1 PE=3 SV=1 12 579 0.0E+00
sp|Q6CUH2|GUF1_KLULA Translation factor GUF1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GUF1 PE=3 SV=1 26 579 0.0E+00
sp|Q6BMV8|GUF1_DEBHA Translation factor GUF1, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GUF1 PE=3 SV=2 33 579 0.0E+00
sp|A5DG70|GUF1_PICGU Translation factor GUF1, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=GUF1 PE=3 SV=2 17 579 0.0E+00
sp|B9WBR8|GUF1_CANDC Translation factor GUF1, mitochondrial OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=GUF1 PE=3 SV=1 43 579 0.0E+00
sp|Q59P53|GUF1_CANAL Translation factor GUF1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GUF1 PE=3 SV=1 43 579 0.0E+00
sp|C5M6K8|GUF1_CANTT Translation factor GUF1, mitochondrial OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=GUF1 PE=3 SV=1 34 579 0.0E+00
sp|C4YIT6|GUF1_CANAW Translation factor GUF1, mitochondrial OS=Candida albicans (strain WO-1) GN=GUF1 PE=3 SV=1 43 579 0.0E+00
sp|A5DWY7|GUF1_LODEL Translation factor GUF1, mitochondrial OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=GUF1 PE=3 SV=1 14 579 0.0E+00
sp|Q6C255|GUF1_YARLI Translation factor GUF1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GUF1 PE=3 SV=1 6 582 0.0E+00
sp|C8ZDQ3|GUF1_YEAS8 Translation factor GUF1, mitochondrial OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=GUF1 PE=3 SV=1 26 579 0.0E+00
sp|A7A1H2|GUF1_YEAS7 Translation factor GUF1, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=GUF1 PE=3 SV=1 26 579 0.0E+00
sp|B3RHG9|GUF1_YEAS1 Translation factor GUF1, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=GUF1 PE=3 SV=1 26 579 0.0E+00
sp|P46943|GUF1_YEAST Translation factor GUF1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GUF1 PE=1 SV=2 26 579 0.0E+00
sp|A7TPD4|GUF1_VANPO Translation factor GUF1, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=GUF1 PE=3 SV=1 5 579 0.0E+00
sp|O13869|GUF1_SCHPO Translation factor guf1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=guf1 PE=3 SV=2 32 582 0.0E+00
sp|B6K6L6|GUF1_SCHJY Translation factor guf1, mitochondrial OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=guf1 PE=3 SV=1 32 579 0.0E+00
sp|B9RUN8|GUF1_RICCO Translation factor GUF1 homolog, mitochondrial OS=Ricinus communis GN=RCOM_0855130 PE=3 SV=1 47 579 3.0E-175
sp|C5Z3W1|GUF1_SORBI Translation factor GUF1 homolog, mitochondrial OS=Sorghum bicolor GN=Sb10g003070 PE=3 SV=1 6 579 9.0E-175
sp|Q5VQ69|GUF1_ORYSJ Translation factor GUF1 homolog, mitochondrial OS=Oryza sativa subsp. japonica GN=Os06g0144800 PE=3 SV=1 32 579 1.0E-173
sp|B3RXR7|GUF1_TRIAD Translation factor GUF1 homolog, mitochondrial OS=Trichoplax adhaerens GN=TRIADDRAFT_56304 PE=3 SV=1 2 579 2.0E-173
sp|A9S3D3|GUF1_PHYPA Translation factor GUF1 homolog, mitochondrial OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_180825 PE=3 SV=1 51 579 1.0E-171
sp|Q9FLE4|GUF1_ARATH Translation factor GUF1 homolog, mitochondrial OS=Arabidopsis thaliana GN=At5g39900 PE=2 SV=1 33 582 2.0E-171
sp|B0G189|GUF1_DICDI Translation factor GUF1 homolog, mitochondrial OS=Dictyostelium discoideum GN=guf1 PE=3 SV=1 27 579 2.0E-168
sp|Q8N442|GUF1_HUMAN Translation factor GUF1, mitochondrial OS=Homo sapiens GN=GUF1 PE=1 SV=1 32 579 2.0E-167
sp|O67618|LEPA_AQUAE Elongation factor 4 OS=Aquifex aeolicus (strain VF5) GN=lepA PE=1 SV=1 56 579 3.0E-167
sp|Q8C3X4|GUF1_MOUSE Translation factor Guf1, mitochondrial OS=Mus musculus GN=Guf1 PE=1 SV=1 25 579 4.0E-167
sp|A6QLJ3|GUF1_BOVIN Translation factor GUF1, mitochondrial OS=Bos taurus GN=GUF1 PE=2 SV=1 12 579 8.0E-166
sp|Q3AF13|LEPA_CARHZ Elongation factor 4 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=lepA PE=3 SV=1 53 579 1.0E-165
sp|B8B2R1|GUF1_ORYSI Translation factor GUF1 homolog, mitochondrial OS=Oryza sativa subsp. indica GN=OsI_21607 PE=3 SV=1 6 579 1.0E-165
sp|Q5FJP6|LEPA_LACAC Elongation factor 4 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=lepA PE=3 SV=1 55 579 2.0E-165
sp|Q9A9F4|LEPA_CAUCR Elongation factor 4 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=lepA PE=3 SV=2 43 579 4.0E-162
sp|A0L631|LEPA_MAGMM Elongation factor 4 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=lepA PE=3 SV=1 50 579 1.0E-161
sp|Q30XI4|LEPA_DESAG Elongation factor 4 OS=Desulfovibrio alaskensis (strain G20) GN=lepA PE=3 SV=1 55 579 1.0E-161
sp|B8H2Z7|LEPA_CAUCN Elongation factor 4 OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=lepA PE=3 SV=1 47 579 2.0E-161
sp|B0CS18|GUF1_LACBS Translation factor GUF1, mitochondrial OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=GUF1 PE=3 SV=1 56 579 3.0E-161
sp|P60790|LEPA_LACJO Elongation factor 4 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=lepA PE=3 SV=1 53 579 4.0E-161
sp|Q044A7|LEPA_LACGA Elongation factor 4 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=lepA PE=3 SV=1 53 579 7.0E-161
sp|Q11AY3|LEPA_CHESB Elongation factor 4 OS=Chelativorans sp. (strain BNC1) GN=lepA PE=3 SV=1 46 579 1.0E-160
sp|B0KA85|LEPA_THEP3 Elongation factor 4 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=lepA PE=3 SV=1 52 579 1.0E-160
sp|B0K3Y4|LEPA_THEPX Elongation factor 4 OS=Thermoanaerobacter sp. (strain X514) GN=lepA PE=3 SV=1 52 579 2.0E-160
sp|Q72E76|LEPA_DESVH Elongation factor 4 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=lepA PE=3 SV=1 53 579 6.0E-160
sp|Q8RB72|LEPA_CALS4 Elongation factor 4 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=lepA PE=3 SV=1 55 579 7.0E-160
sp|B8DIZ5|LEPA_DESVM Elongation factor 4 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=lepA PE=3 SV=1 53 579 1.0E-159
sp|Q2Y873|LEPA_NITMU Elongation factor 4 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=lepA PE=3 SV=1 52 579 2.0E-159
sp|Q0BRZ7|LEPA_GRABC Elongation factor 4 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=lepA PE=3 SV=2 50 579 2.0E-159
sp|Q0AF67|LEPA_NITEC Elongation factor 4 OS=Nitrosomonas eutropha (strain C91) GN=lepA PE=3 SV=1 52 579 4.0E-159
sp|B3PLU0|LEPA_MYCA5 Elongation factor 4 OS=Mycoplasma arthritidis (strain 158L3-1) GN=lepA PE=3 SV=1 53 579 5.0E-159
sp|A9GWZ4|LEPA_SORC5 Elongation factor 4 OS=Sorangium cellulosum (strain So ce56) GN=lepA PE=3 SV=1 55 579 5.0E-159
sp|A6SXR0|LEPA_JANMA Elongation factor 4 OS=Janthinobacterium sp. (strain Marseille) GN=lepA PE=3 SV=1 52 579 6.0E-159
sp|Q47EG0|LEPA_DECAR Elongation factor 4 OS=Dechloromonas aromatica (strain RCB) GN=lepA PE=3 SV=1 52 579 8.0E-159
sp|Q8UIQ2|LEPA_AGRFC Elongation factor 4 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=lepA PE=3 SV=1 51 579 1.0E-158
sp|Q0IFX5|GUF1_AEDAE Translation factor GUF1 homolog, mitochondrial OS=Aedes aegypti GN=AAEL003926 PE=3 SV=1 21 578 2.0E-158
sp|A8YVQ1|LEPA_LACH4 Elongation factor 4 OS=Lactobacillus helveticus (strain DPC 4571) GN=lepA PE=3 SV=1 53 579 2.0E-158
sp|B2G6W5|LEPA_LACRJ Elongation factor 4 OS=Lactobacillus reuteri (strain JCM 1112) GN=lepA PE=3 SV=1 53 579 4.0E-158
sp|A5VJE9|LEPA_LACRD Elongation factor 4 OS=Lactobacillus reuteri (strain DSM 20016) GN=lepA PE=3 SV=1 53 579 4.0E-158
sp|A9A0N0|LEPA_DESOH Elongation factor 4 OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=lepA PE=3 SV=1 52 579 4.0E-158
sp|Q98DV1|LEPA_RHILO Elongation factor 4 OS=Rhizobium loti (strain MAFF303099) GN=lepA PE=3 SV=1 51 579 6.0E-158
sp|Q92SU3|LEPA_RHIME Elongation factor 4 OS=Rhizobium meliloti (strain 1021) GN=lepA PE=3 SV=1 51 579 7.0E-158
sp|C1D7L2|LEPA_LARHH Elongation factor 4 OS=Laribacter hongkongensis (strain HLHK9) GN=lepA PE=3 SV=1 52 579 7.0E-158
sp|Q2JWR1|LEPA_SYNJA Elongation factor 4 OS=Synechococcus sp. (strain JA-3-3Ab) GN=lepA PE=3 SV=1 50 579 8.0E-158
sp|A4JCQ9|LEPA_BURVG Elongation factor 4 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=lepA PE=3 SV=1 52 579 1.0E-157
sp|A5G4G3|LEPA_GEOUR Elongation factor 4 OS=Geobacter uraniireducens (strain Rf4) GN=lepA PE=3 SV=1 52 579 2.0E-157
sp|Q8Y0I4|LEPA_RALSO Elongation factor 4 OS=Ralstonia solanacearum (strain GMI1000) GN=lepA PE=3 SV=1 52 579 4.0E-157
sp|Q0A8Z4|LEPA_ALKEH Elongation factor 4 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=lepA PE=3 SV=1 21 579 8.0E-157
sp|B8J444|LEPA_DESDA Elongation factor 4 OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=lepA PE=3 SV=1 53 579 9.0E-157
sp|Q8F500|LEPA_LEPIN Elongation factor 4 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=lepA PE=3 SV=1 55 579 1.0E-156
sp|Q72QU8|LEPA_LEPIC Elongation factor 4 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=lepA PE=3 SV=1 55 579 1.0E-156
sp|Q89BJ8|LEPA_BRADU Elongation factor 4 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=lepA PE=3 SV=2 47 579 1.0E-156
sp|B3PYC6|LEPA_RHIE6 Elongation factor 4 OS=Rhizobium etli (strain CIAT 652) GN=lepA PE=3 SV=1 51 579 1.0E-156
sp|Q28LR4|LEPA_JANSC Elongation factor 4 OS=Jannaschia sp. (strain CCS1) GN=lepA PE=3 SV=1 52 579 2.0E-156
sp|Q8YDB8|LEPA_BRUME Elongation factor 4 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=lepA PE=3 SV=1 49 579 2.0E-156
sp|C0RMH8|LEPA_BRUMB Elongation factor 4 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=lepA PE=3 SV=1 49 579 2.0E-156
sp|Q576S5|LEPA_BRUAB Elongation factor 4 OS=Brucella abortus biovar 1 (strain 9-941) GN=lepA PE=3 SV=1 49 579 2.0E-156
sp|Q2YJP8|LEPA_BRUA2 Elongation factor 4 OS=Brucella abortus (strain 2308) GN=lepA PE=3 SV=1 49 579 2.0E-156
sp|B2SC25|LEPA_BRUA1 Elongation factor 4 OS=Brucella abortus (strain S19) GN=lepA PE=3 SV=1 49 579 2.0E-156
sp|Q8FV17|LEPA_BRUSU Elongation factor 4 OS=Brucella suis biovar 1 (strain 1330) GN=lepA PE=3 SV=1 49 579 2.0E-156
sp|A9WW49|LEPA_BRUSI Elongation factor 4 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=lepA PE=3 SV=1 49 579 2.0E-156
sp|A5VVU4|LEPA_BRUO2 Elongation factor 4 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=lepA PE=3 SV=1 49 579 2.0E-156
sp|A9MCW5|LEPA_BRUC2 Elongation factor 4 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=lepA PE=3 SV=1 49 579 2.0E-156
sp|Q3J4P0|LEPA_RHOS4 Elongation factor 4 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=lepA PE=3 SV=2 52 579 2.0E-156
sp|Q2JQ51|LEPA_SYNJB Elongation factor 4 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=lepA PE=3 SV=1 47 579 3.0E-156
sp|B1IC02|LEPA_STRPI Elongation factor 4 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=lepA PE=3 SV=1 42 579 3.0E-156
sp|Q1D6M1|LEPA_MYXXD Elongation factor 4 OS=Myxococcus xanthus (strain DK 1622) GN=lepA PE=3 SV=1 55 579 4.0E-156
sp|A0K5V7|LEPA_BURCH Elongation factor 4 OS=Burkholderia cenocepacia (strain HI2424) GN=lepA PE=3 SV=1 52 579 4.0E-156
sp|B1JYB1|LEPA_BURCC Elongation factor 4 OS=Burkholderia cenocepacia (strain MC0-3) GN=lepA PE=3 SV=1 52 579 4.0E-156
sp|Q1BXU3|LEPA_BURCA Elongation factor 4 OS=Burkholderia cenocepacia (strain AU 1054) GN=lepA PE=3 SV=1 52 579 4.0E-156
sp|B5ZXQ5|LEPA_RHILW Elongation factor 4 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=lepA PE=3 SV=1 51 579 6.0E-156
sp|Q2W0F9|LEPA_MAGSA Elongation factor 4 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=lepA PE=3 SV=1 52 579 7.0E-156
sp|A9ADE0|LEPA_BURM1 Elongation factor 4 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=lepA PE=3 SV=1 52 579 7.0E-156
sp|Q5P089|LEPA_AROAE Elongation factor 4 OS=Aromatoleum aromaticum (strain EbN1) GN=lepA PE=3 SV=1 52 579 8.0E-156
sp|P37949|LEPA_BACSU Elongation factor 4 OS=Bacillus subtilis (strain 168) GN=lepA PE=3 SV=2 41 579 9.0E-156
sp|Q0BH06|LEPA_BURCM Elongation factor 4 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=lepA PE=3 SV=1 52 579 9.0E-156
sp|B1YVM2|LEPA_BURA4 Elongation factor 4 OS=Burkholderia ambifaria (strain MC40-6) GN=lepA PE=3 SV=1 52 579 9.0E-156
sp|B4UDQ7|LEPA_ANASK Elongation factor 4 OS=Anaeromyxobacter sp. (strain K) GN=lepA PE=3 SV=1 55 579 1.0E-155
sp|A3PHQ9|LEPA_RHOS1 Elongation factor 4 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=lepA PE=3 SV=1 52 579 1.0E-155
sp|Q67S76|LEPA_SYMTH Elongation factor 4 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=lepA PE=3 SV=1 55 579 1.0E-155
sp|C1C7G9|LEPA_STRP7 Elongation factor 4 OS=Streptococcus pneumoniae (strain 70585) GN=lepA PE=3 SV=1 42 579 2.0E-155
sp|B5E4T8|LEPA_STRP4 Elongation factor 4 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=lepA PE=3 SV=1 42 579 2.0E-155
sp|Q1MMQ8|LEPA_RHIL3 Elongation factor 4 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=lepA PE=3 SV=1 51 579 2.0E-155
sp|Q2IIA6|LEPA_ANADE Elongation factor 4 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=lepA PE=3 SV=1 55 579 2.0E-155
sp|Q1GIV5|LEPA_RUEST Elongation factor 4 OS=Ruegeria sp. (strain TM1040) GN=lepA PE=3 SV=1 52 579 2.0E-155
sp|A5FY07|LEPA_ACICJ Elongation factor 4 OS=Acidiphilium cryptum (strain JF-5) GN=lepA PE=3 SV=1 47 579 2.0E-155
sp|Q03QU8|LEPA_LACBA Elongation factor 4 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=lepA PE=3 SV=1 55 579 2.0E-155
sp|Q7V8S4|LEPA_PROMM Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9313) GN=lepA PE=3 SV=1 50 579 2.0E-155
sp|B9KNH9|LEPA_RHOSK Elongation factor 4 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=lepA PE=3 SV=1 52 579 4.0E-155
sp|A4J7F8|LEPA_DESRM Elongation factor 4 OS=Desulfotomaculum reducens (strain MI-1) GN=lepA PE=3 SV=1 51 579 4.0E-155
sp|Q2G550|LEPA_NOVAD Elongation factor 4 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=lepA PE=3 SV=1 55 579 5.0E-155
sp|B8IMT0|LEPA_METNO Elongation factor 4 OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=lepA PE=3 SV=1 47 579 6.0E-155
sp|Q0K8N0|LEPA_CUPNH Elongation factor 4 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=lepA PE=3 SV=1 52 579 6.0E-155
sp|B2JFK0|LEPA_BURP8 Elongation factor 4 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=lepA PE=3 SV=1 52 579 6.0E-155
sp|B0JQT7|LEPA_MICAN Elongation factor 4 OS=Microcystis aeruginosa (strain NIES-843) GN=lepA PE=3 SV=1 50 579 6.0E-155
sp|Q2SXT6|LEPA_BURTA Elongation factor 4 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=lepA PE=3 SV=1 52 579 7.0E-155
sp|Q2KDL5|LEPA_RHIEC Elongation factor 4 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=lepA PE=3 SV=1 51 579 8.0E-155
sp|Q63S94|LEPA_BURPS Elongation factor 4 OS=Burkholderia pseudomallei (strain K96243) GN=lepA PE=3 SV=1 52 579 8.0E-155
sp|A3NBT1|LEPA_BURP6 Elongation factor 4 OS=Burkholderia pseudomallei (strain 668) GN=lepA PE=3 SV=1 52 579 8.0E-155
sp|Q3JQ75|LEPA_BURP1 Elongation factor 4 OS=Burkholderia pseudomallei (strain 1710b) GN=lepA PE=3 SV=1 52 579 8.0E-155
sp|A3NXL8|LEPA_BURP0 Elongation factor 4 OS=Burkholderia pseudomallei (strain 1106a) GN=lepA PE=3 SV=1 52 579 8.0E-155
sp|A1V6B9|LEPA_BURMS Elongation factor 4 OS=Burkholderia mallei (strain SAVP1) GN=lepA PE=3 SV=1 52 579 8.0E-155
sp|Q62LT1|LEPA_BURMA Elongation factor 4 OS=Burkholderia mallei (strain ATCC 23344) GN=lepA PE=3 SV=1 52 579 8.0E-155
sp|A2S9Z3|LEPA_BURM9 Elongation factor 4 OS=Burkholderia mallei (strain NCTC 10229) GN=lepA PE=3 SV=1 52 579 8.0E-155
sp|A3MM44|LEPA_BURM7 Elongation factor 4 OS=Burkholderia mallei (strain NCTC 10247) GN=lepA PE=3 SV=1 52 579 8.0E-155
sp|C1CKU6|LEPA_STRZP Elongation factor 4 OS=Streptococcus pneumoniae (strain P1031) GN=lepA PE=3 SV=1 42 579 9.0E-155
sp|Q97QK5|LEPA_STRPN Elongation factor 4 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=lepA PE=3 SV=1 42 579 9.0E-155
sp|Q049W8|LEPA_LACDB Elongation factor 4 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=lepA PE=3 SV=1 53 579 9.0E-155
sp|Q1G9R4|LEPA_LACDA Elongation factor 4 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=lepA PE=3 SV=1 53 579 9.0E-155
sp|C1CR98|LEPA_STRZT Elongation factor 4 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=lepA PE=3 SV=1 42 579 1.0E-154
sp|Q8DPN5|LEPA_STRR6 Elongation factor 4 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=lepA PE=3 SV=1 42 579 1.0E-154
sp|B8ZQ69|LEPA_STRPJ Elongation factor 4 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=lepA PE=3 SV=1 42 579 1.0E-154
sp|Q04KB7|LEPA_STRP2 Elongation factor 4 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=lepA PE=3 SV=1 42 579 1.0E-154
sp|B3WEQ5|LEPA_LACCB Elongation factor 4 OS=Lactobacillus casei (strain BL23) GN=lepA PE=3 SV=1 53 579 1.0E-154
sp|Q038N6|LEPA_LACC3 Elongation factor 4 OS=Lactobacillus casei (strain ATCC 334) GN=lepA PE=3 SV=1 53 579 1.0E-154
sp|Q88VN0|LEPA1_LACPL Elongation factor 4 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=lepA1 PE=3 SV=1 53 579 1.0E-154
sp|A4WX88|LEPA_RHOS5 Elongation factor 4 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=lepA PE=3 SV=1 52 579 1.0E-154
sp|B8ENL1|LEPA_METSB Elongation factor 4 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=lepA PE=3 SV=1 47 579 1.0E-154
sp|Q8Y742|LEPA_LISMO Elongation factor 4 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lepA PE=3 SV=1 53 579 1.0E-154
sp|B8DE32|LEPA_LISMH Elongation factor 4 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=lepA PE=3 SV=1 53 579 1.0E-154
sp|Q71ZJ1|LEPA_LISMF Elongation factor 4 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=lepA PE=3 SV=1 53 579 1.0E-154
sp|C1KVC6|LEPA_LISMC Elongation factor 4 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=lepA PE=3 SV=1 53 579 1.0E-154
sp|A5GMR2|LEPA_SYNPW Elongation factor 4 OS=Synechococcus sp. (strain WH7803) GN=lepA PE=3 SV=1 51 579 1.0E-154
sp|Q3ALG5|LEPA_SYNSC Elongation factor 4 OS=Synechococcus sp. (strain CC9605) GN=lepA PE=3 SV=1 51 579 1.0E-154
sp|B9MJZ5|LEPA_CALBD Elongation factor 4 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=lepA PE=3 SV=1 53 579 1.0E-154
sp|Q7U5L9|LEPA_SYNPX Elongation factor 4 OS=Synechococcus sp. (strain WH8102) GN=lepA PE=3 SV=1 51 579 1.0E-154
sp|Q47WP3|LEPA_COLP3 Elongation factor 4 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=lepA PE=3 SV=1 52 579 1.0E-154
sp|Q5KWZ3|LEPA_GEOKA Elongation factor 4 OS=Geobacillus kaustophilus (strain HTA426) GN=lepA PE=3 SV=1 53 579 2.0E-154
sp|A9III9|LEPA_BORPD Elongation factor 4 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=lepA PE=3 SV=1 52 579 2.0E-154
sp|A1K601|LEPA_AZOSB Elongation factor 4 OS=Azoarcus sp. (strain BH72) GN=lepA PE=3 SV=1 52 579 2.0E-154
sp|P60789|LEPA_GEOSL Elongation factor 4 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=lepA PE=3 SV=1 50 579 2.0E-154
sp|B8JAF3|LEPA_ANAD2 Elongation factor 4 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=lepA PE=3 SV=1 55 579 2.0E-154
sp|Q16BA3|LEPA_ROSDO Elongation factor 4 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=lepA PE=3 SV=1 51 579 2.0E-154
sp|A4XKA0|LEPA_CALS8 Elongation factor 4 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=lepA PE=3 SV=1 53 579 2.0E-154
sp|B3R202|LEPA_CUPTR Elongation factor 4 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=lepA PE=3 SV=1 52 579 3.0E-154
sp|Q3A445|LEPA_PELCD Elongation factor 4 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=lepA PE=3 SV=1 54 579 3.0E-154
sp|B2U978|LEPA_RALPJ Elongation factor 4 OS=Ralstonia pickettii (strain 12J) GN=lepA PE=3 SV=1 52 579 3.0E-154
sp|B9M4U5|LEPA_GEODF Elongation factor 4 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=lepA PE=3 SV=1 52 579 3.0E-154
sp|B5EB36|LEPA_GEOBB Elongation factor 4 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=lepA PE=3 SV=1 52 579 4.0E-154
sp|Q39I75|LEPA_BURL3 Elongation factor 4 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=lepA PE=3 SV=1 52 579 4.0E-154
sp|A6WYK4|LEPA_OCHA4 Elongation factor 4 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=lepA PE=3 SV=1 51 579 4.0E-154
sp|B9DSE0|LEPA_STRU0 Elongation factor 4 OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=lepA PE=3 SV=1 53 579 4.0E-154
sp|A0AIS8|LEPA_LISW6 Elongation factor 4 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=lepA PE=3 SV=1 53 579 4.0E-154
sp|Q831Z0|LEPA_ENTFA Elongation factor 4 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=lepA PE=3 SV=1 53 579 5.0E-154
sp|Q24SR6|LEPA_DESHY Elongation factor 4 OS=Desulfitobacterium hafniense (strain Y51) GN=lepA PE=3 SV=1 55 579 6.0E-154
sp|B8FUP2|LEPA_DESHD Elongation factor 4 OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=lepA PE=3 SV=1 55 579 6.0E-154
sp|A8LR11|LEPA_DINSH Elongation factor 4 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=lepA PE=3 SV=1 52 579 6.0E-154
sp|Q13VM6|LEPA_BURXL Elongation factor 4 OS=Burkholderia xenovorans (strain LB400) GN=lepA PE=3 SV=1 52 579 7.0E-154
sp|Q3SH47|LEPA_THIDA Elongation factor 4 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=lepA PE=3 SV=1 56 579 7.0E-154
sp|A8Z4C4|LEPA_STAAT Elongation factor 4 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=lepA PE=3 SV=1 53 579 8.0E-154
sp|A6QHC7|LEPA_STAAE Elongation factor 4 OS=Staphylococcus aureus (strain Newman) GN=lepA PE=3 SV=1 53 579 8.0E-154
sp|Q5HFH6|LEPA_STAAC Elongation factor 4 OS=Staphylococcus aureus (strain COL) GN=lepA PE=3 SV=1 53 579 8.0E-154
sp|Q2FXY7|LEPA_STAA8 Elongation factor 4 OS=Staphylococcus aureus (strain NCTC 8325) GN=lepA PE=1 SV=1 53 579 8.0E-154
sp|Q2FGD9|LEPA_STAA3 Elongation factor 4 OS=Staphylococcus aureus (strain USA300) GN=lepA PE=3 SV=1 53 579 8.0E-154
sp|Q38W39|LEPA_LACSS Elongation factor 4 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=lepA PE=3 SV=1 53 579 8.0E-154
sp|B0WXB8|GUF1_CULQU Translation factor GUF1 homolog, mitochondrial OS=Culex quinquefasciatus GN=CPIJ012086 PE=3 SV=1 50 578 9.0E-154
sp|C1CEG3|LEPA_STRZJ Elongation factor 4 OS=Streptococcus pneumoniae (strain JJA) GN=lepA PE=3 SV=1 42 579 1.0E-153
sp|Q6G8Y3|LEPA_STAAS Elongation factor 4 OS=Staphylococcus aureus (strain MSSA476) GN=lepA PE=3 SV=1 53 579 1.0E-153
sp|Q6GGB6|LEPA_STAAR Elongation factor 4 OS=Staphylococcus aureus (strain MRSA252) GN=lepA PE=3 SV=1 53 579 1.0E-153
sp|P65272|LEPA_STAAN Elongation factor 4 OS=Staphylococcus aureus (strain N315) GN=lepA PE=1 SV=1 53 579 1.0E-153
sp|P65271|LEPA_STAAM Elongation factor 4 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=lepA PE=3 SV=1 53 579 1.0E-153
sp|Q2YT42|LEPA_STAAB Elongation factor 4 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=lepA PE=3 SV=1 53 579 1.0E-153
sp|A5ITB2|LEPA_STAA9 Elongation factor 4 OS=Staphylococcus aureus (strain JH9) GN=lepA PE=3 SV=1 53 579 1.0E-153
sp|A6U257|LEPA_STAA2 Elongation factor 4 OS=Staphylococcus aureus (strain JH1) GN=lepA PE=3 SV=1 53 579 1.0E-153
sp|A7X2Y7|LEPA_STAA1 Elongation factor 4 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=lepA PE=3 SV=1 53 579 1.0E-153
sp|A8AWG3|LEPA_STRGC Elongation factor 4 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=lepA PE=3 SV=1 53 579 1.0E-153
sp|Q8NWA7|LEPA_STAAW Elongation factor 4 OS=Staphylococcus aureus (strain MW2) GN=lepA PE=3 SV=1 53 579 1.0E-153
sp|P56865|LEPA_BORPE Elongation factor 4 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=lepA PE=3 SV=2 52 579 1.0E-153
sp|Q820H8|LEPA_NITEU Elongation factor 4 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=lepA PE=3 SV=1 52 579 1.0E-153
sp|B2SZV7|LEPA_BURPP Elongation factor 4 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=lepA PE=3 SV=1 52 579 2.0E-153
sp|A1ARG8|LEPA_PELPD Elongation factor 4 OS=Pelobacter propionicus (strain DSM 2379) GN=lepA PE=3 SV=1 52 579 2.0E-153
sp|A4IR35|LEPA_GEOTN Elongation factor 4 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=lepA PE=3 SV=1 53 579 2.0E-153
sp|A2C0M8|LEPA_PROM1 Elongation factor 4 OS=Prochlorococcus marinus (strain NATL1A) GN=lepA PE=3 SV=1 50 579 2.0E-153
sp|A3DF29|LEPA_CLOTH Elongation factor 4 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=lepA PE=3 SV=1 53 579 2.0E-153
sp|A5IYS0|LEPA_MYCAP Elongation factor 4 OS=Mycoplasma agalactiae (strain PG2) GN=lepA PE=3 SV=1 54 579 2.0E-153
sp|Q7W5J4|LEPA_BORPA Elongation factor 4 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=lepA PE=3 SV=1 52 579 2.0E-153
sp|Q7WD30|LEPA_BORBR Elongation factor 4 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=lepA PE=3 SV=1 52 579 2.0E-153
sp|A5D3X6|LEPA_PELTS Elongation factor 4 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=lepA PE=3 SV=1 53 579 2.0E-153
sp|B1XTL2|LEPA_POLNS Elongation factor 4 OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=lepA PE=3 SV=1 55 579 2.0E-153
sp|A2CBG9|LEPA_PROM3 Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9303) GN=lepA PE=3 SV=1 50 579 3.0E-153
sp|Q46GZ6|LEPA_PROMT Elongation factor 4 OS=Prochlorococcus marinus (strain NATL2A) GN=lepA PE=3 SV=1 50 579 4.0E-153
sp|Q92BN4|LEPA_LISIN Elongation factor 4 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lepA PE=3 SV=1 53 579 5.0E-153
sp|B6IUG3|LEPA_RHOCS Elongation factor 4 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=lepA PE=3 SV=1 52 579 5.0E-153
sp|A9M3J8|LEPA_NEIM0 Elongation factor 4 OS=Neisseria meningitidis serogroup C (strain 053442) GN=lepA PE=3 SV=1 52 579 5.0E-153
sp|B2GBR9|LEPA_LACF3 Elongation factor 4 OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=lepA PE=3 SV=1 53 579 6.0E-153
sp|B4U6M2|LEPA_HYDS0 Elongation factor 4 OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=lepA PE=3 SV=1 52 579 7.0E-153
sp|Q5WHG5|LEPA_BACSK Elongation factor 4 OS=Bacillus clausii (strain KSM-K16) GN=lepA PE=3 SV=1 54 579 8.0E-153
sp|B4RK41|LEPA_NEIG2 Elongation factor 4 OS=Neisseria gonorrhoeae (strain NCCP11945) GN=lepA PE=3 SV=1 52 579 9.0E-153
sp|Q5F9P9|LEPA_NEIG1 Elongation factor 4 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=lepA PE=3 SV=1 52 579 9.0E-153
sp|A1KT27|LEPA_NEIMF Elongation factor 4 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=lepA PE=3 SV=1 52 579 1.0E-152
sp|Q2KWY3|LEPA_BORA1 Elongation factor 4 OS=Bordetella avium (strain 197N) GN=lepA PE=3 SV=1 52 579 1.0E-152
sp|Q9K055|LEPA_NEIMB Elongation factor 4 OS=Neisseria meningitidis serogroup B (strain MC58) GN=lepA PE=3 SV=1 52 579 1.0E-152
sp|Q46Z15|LEPA_CUPPJ Elongation factor 4 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=lepA PE=3 SV=1 52 579 1.0E-152
sp|Q1WUE6|LEPA_LACS1 Elongation factor 4 OS=Lactobacillus salivarius (strain UCC118) GN=lepA PE=3 SV=1 53 579 1.0E-152
sp|B9E6X5|LEPA_MACCJ Elongation factor 4 OS=Macrococcus caseolyticus (strain JCSC5402) GN=lepA PE=3 SV=1 53 579 1.0E-152
sp|B0C9R9|LEPA_ACAM1 Elongation factor 4 OS=Acaryochloris marina (strain MBIC 11017) GN=lepA PE=3 SV=1 50 579 1.0E-152
sp|B7KR78|LEPA_METC4 Elongation factor 4 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=lepA PE=3 SV=1 52 579 1.0E-152
sp|B8CQJ7|LEPA_SHEPW Elongation factor 4 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=lepA PE=3 SV=1 52 579 2.0E-152
sp|Q9JV65|LEPA_NEIMA Elongation factor 4 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=lepA PE=3 SV=1 52 579 2.0E-152
sp|A7Z6W5|LEPA_BACMF Elongation factor 4 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=lepA PE=3 SV=1 41 579 2.0E-152
sp|A4S3R2|GUF1_OSTLU Translation factor GUF1 homolog, mitochondrial OS=Ostreococcus lucimarinus (strain CCE9901) GN=OSTLU_88434 PE=3 SV=1 33 579 2.0E-152
sp|B1ZC10|LEPA_METPB Elongation factor 4 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=lepA PE=3 SV=1 52 579 2.0E-152
sp|Q1QR19|LEPA_NITHX Elongation factor 4 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=lepA PE=3 SV=1 42 579 3.0E-152
sp|B3E9R0|LEPA_GEOLS Elongation factor 4 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=lepA PE=3 SV=1 52 579 3.0E-152
sp|Q1LKM8|LEPA_CUPMC Elongation factor 4 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=lepA PE=3 SV=1 52 579 3.0E-152
sp|Q8AA33|LEPA_BACTN Elongation factor 4 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=lepA PE=3 SV=1 52 579 3.0E-152
sp|Q7VDF7|LEPA_PROMA Elongation factor 4 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=lepA PE=3 SV=1 50 579 3.0E-152
sp|Q1H2L5|LEPA_METFK Elongation factor 4 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=lepA1 PE=3 SV=1 52 579 4.0E-152
sp|Q2RKX8|LEPA_MOOTA Elongation factor 4 OS=Moorella thermoacetica (strain ATCC 39073) GN=lepA PE=3 SV=1 55 579 4.0E-152
sp|A7GT14|LEPA_BACCN Elongation factor 4 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=lepA PE=3 SV=1 54 579 5.0E-152
sp|Q64T74|LEPA_BACFR Elongation factor 4 OS=Bacteroides fragilis (strain YCH46) GN=lepA PE=3 SV=1 52 579 5.0E-152
sp|Q5LC85|LEPA_BACFN Elongation factor 4 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=lepA PE=3 SV=1 52 579 5.0E-152
sp|Q0HSI9|LEPA_SHESR Elongation factor 4 OS=Shewanella sp. (strain MR-7) GN=lepA PE=3 SV=1 52 579 5.0E-152
sp|Q0HG96|LEPA_SHESM Elongation factor 4 OS=Shewanella sp. (strain MR-4) GN=lepA PE=3 SV=1 52 579 5.0E-152
sp|A7HCF3|LEPA_ANADF Elongation factor 4 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=lepA PE=3 SV=1 55 579 6.0E-152
sp|A9RFQ5|GUFP_PHYPA Translation factor GUF1 homolog, chloroplastic OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_158777 PE=3 SV=1 46 579 7.0E-152
sp|Q9KD76|LEPA_BACHD Elongation factor 4 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=lepA PE=3 SV=1 54 579 7.0E-152
sp|C6DZ67|LEPA_GEOSM Elongation factor 4 OS=Geobacter sp. (strain M21) GN=lepA PE=3 SV=1 52 579 8.0E-152
sp|Q39US7|LEPA_GEOMG Elongation factor 4 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=lepA PE=3 SV=2 50 579 8.0E-152
sp|Q2GJV7|LEPA_ANAPZ Elongation factor 4 OS=Anaplasma phagocytophilum (strain HZ) GN=lepA PE=3 SV=1 55 581 9.0E-152
sp|Q15R31|LEPA_PSEA6 Elongation factor 4 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=lepA PE=3 SV=1 53 579 1.0E-151
sp|A5GRE6|LEPA_SYNR3 Elongation factor 4 OS=Synechococcus sp. (strain RCC307) GN=lepA PE=3 SV=1 51 579 1.0E-151
sp|B0TAD2|LEPA_HELMI Elongation factor 4 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=lepA PE=3 SV=1 55 579 1.0E-151
sp|B8HLK8|LEPA_CYAP4 Elongation factor 4 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=lepA PE=3 SV=1 51 579 1.0E-151
sp|Q8DTF3|LEPA_STRMU Elongation factor 4 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=lepA PE=3 SV=1 53 579 1.0E-151
sp|Q65H50|LEPA_BACLD Elongation factor 4 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=lepA PE=3 SV=1 41 579 1.0E-151
sp|Q00ZZ1|GUF1_OSTTA Translation factor GUF1 homolog, mitochondrial OS=Ostreococcus tauri GN=Ot10g01840 PE=3 SV=1 35 579 1.0E-151
sp|Q8DM20|LEPA_THEEB Elongation factor 4 OS=Thermosynechococcus elongatus (strain BP-1) GN=lepA PE=3 SV=1 50 579 1.0E-151
sp|Q3AWX3|LEPA_SYNS9 Elongation factor 4 OS=Synechococcus sp. (strain CC9902) GN=lepA PE=3 SV=1 51 579 2.0E-151
sp|Q050R3|LEPA_LEPBL Elongation factor 4 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=lepA PE=3 SV=1 55 579 2.0E-151
sp|Q04SN9|LEPA_LEPBJ Elongation factor 4 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=lepA PE=3 SV=1 55 579 2.0E-151
sp|Q3J8D2|LEPA_NITOC Elongation factor 4 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=lepA PE=3 SV=1 52 579 2.0E-151
sp|B0UFE0|LEPA_METS4 Elongation factor 4 OS=Methylobacterium sp. (strain 4-46) GN=lepA PE=3 SV=1 47 579 2.0E-151
sp|B7KJX0|LEPA_CYAP7 Elongation factor 4 OS=Cyanothece sp. (strain PCC 7424) GN=lepA PE=3 SV=1 50 579 2.0E-151
sp|A4G6S1|LEPA_HERAR Elongation factor 4 OS=Herminiimonas arsenicoxydans GN=lepA PE=3 SV=1 52 579 2.0E-151
sp|B9DNK4|LEPA_STACT Elongation factor 4 OS=Staphylococcus carnosus (strain TM300) GN=lepA PE=3 SV=1 53 579 3.0E-151
sp|A0KZN4|LEPA_SHESA Elongation factor 4 OS=Shewanella sp. (strain ANA-3) GN=lepA PE=3 SV=1 52 579 3.0E-151
sp|A6Q241|LEPA_NITSB Elongation factor 4 OS=Nitratiruptor sp. (strain SB155-2) GN=lepA PE=3 SV=1 52 579 3.0E-151
sp|B1WWD8|LEPA_CYAA5 Elongation factor 4 OS=Cyanothece sp. (strain ATCC 51142) GN=lepA PE=3 SV=1 50 579 3.0E-151
sp|Q1GRH5|LEPA_SPHAL Elongation factor 4 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=lepA PE=3 SV=1 51 579 3.0E-151
sp|Q730L6|LEPA_BACC1 Elongation factor 4 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=lepA PE=3 SV=1 54 579 3.0E-151
sp|B1XK44|LEPA_SYNP2 Elongation factor 4 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=lepA PE=3 SV=1 50 581 4.0E-151
sp|Q03KW7|LEPA_STRTD Elongation factor 4 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=lepA PE=3 SV=1 53 579 4.0E-151
sp|Q5M008|LEPA_STRT1 Elongation factor 4 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=lepA PE=3 SV=1 53 579 4.0E-151
sp|B7K3Z7|LEPA_CYAP8 Elongation factor 4 OS=Cyanothece sp. (strain PCC 8801) GN=lepA PE=3 SV=1 50 579 4.0E-151
sp|Q3SVT1|LEPA_NITWN Elongation factor 4 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=lepA PE=3 SV=1 51 579 4.0E-151
sp|Q8GCP5|LEPA_MYCFP Elongation factor 4 OS=Mycoplasma fermentans (strain ATCC 19989 / NBRC 14854 / NCTC 10117 / PG18) GN=lepA PE=3 SV=1 54 579 4.0E-151
sp|A1S3X9|LEPA_SHEAM Elongation factor 4 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=lepA PE=3 SV=1 52 579 4.0E-151
sp|B7GKC4|LEPA_ANOFW Elongation factor 4 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=lepA PE=3 SV=1 53 579 6.0E-151
sp|Q7NGX4|LEPA_GLOVI Elongation factor 4 OS=Gloeobacter violaceus (strain PCC 7421) GN=lepA PE=3 SV=1 47 579 6.0E-151
sp|Q8CP13|LEPA_STAES Elongation factor 4 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=lepA PE=3 SV=1 53 579 7.0E-151
sp|Q5HNW2|LEPA_STAEQ Elongation factor 4 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=lepA PE=3 SV=1 53 579 7.0E-151
sp|A4VUL8|LEPA_STRSY Elongation factor 4 OS=Streptococcus suis (strain 05ZYH33) GN=lepA PE=3 SV=1 53 579 7.0E-151
sp|A4W0W0|LEPA_STRS2 Elongation factor 4 OS=Streptococcus suis (strain 98HAH33) GN=lepA PE=3 SV=1 53 579 7.0E-151
sp|Q87LN7|LEPA_VIBPA Elongation factor 4 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=lepA PE=3 SV=1 52 579 7.0E-151
sp|Q5M4M2|LEPA_STRT2 Elongation factor 4 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=lepA PE=3 SV=1 53 579 8.0E-151
sp|P60930|LEPA_BDEBA Elongation factor 4 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=lepA PE=3 SV=2 55 579 8.0E-151
sp|P65274|LEPA_STRA5 Elongation factor 4 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=lepA PE=3 SV=1 53 579 8.0E-151
sp|P65273|LEPA_STRA3 Elongation factor 4 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=lepA PE=3 SV=1 53 579 8.0E-151
sp|Q3K1F9|LEPA_STRA1 Elongation factor 4 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=lepA PE=3 SV=1 53 579 8.0E-151
sp|B4U3G9|LEPA_STREM Elongation factor 4 OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=lepA PE=3 SV=1 42 579 9.0E-151
sp|Q0C5X0|LEPA_HYPNA Elongation factor 4 OS=Hyphomonas neptunium (strain ATCC 15444) GN=lepA PE=3 SV=1 51 579 1.0E-150
sp|A7MZB0|LEPA_VIBCB Elongation factor 4 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=lepA PE=3 SV=1 52 579 1.0E-150
sp|A8FSD4|LEPA_SHESH Elongation factor 4 OS=Shewanella sediminis (strain HAW-EB3) GN=lepA PE=3 SV=1 52 579 1.0E-150
sp|Q4L6T4|LEPA_STAHJ Elongation factor 4 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=lepA PE=3 SV=1 53 579 1.0E-150
sp|Q0ATE3|LEPA_MARMM Elongation factor 4 OS=Maricaulis maris (strain MCS10) GN=lepA PE=3 SV=2 55 579 1.0E-150
sp|B7PJS6|GUF1_IXOSC Translation factor GUF1 homolog, mitochondrial OS=Ixodes scapularis GN=ISCW003920 PE=3 SV=1 48 581 1.0E-150
sp|Q5LUS0|LEPA_RUEPO Elongation factor 4 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=lepA PE=3 SV=1 52 579 2.0E-150
sp|C0M8H9|LEPA_STRE4 Elongation factor 4 OS=Streptococcus equi subsp. equi (strain 4047) GN=lepA PE=3 SV=1 42 579 2.0E-150
sp|Q6G550|LEPA_BARHE Elongation factor 4 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=lepA PE=3 SV=1 55 579 2.0E-150
sp|Q818E4|LEPA_BACCR Elongation factor 4 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=lepA PE=3 SV=1 54 579 2.0E-150
sp|C0MDV7|LEPA_STRS7 Elongation factor 4 OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=lepA PE=3 SV=1 42 579 2.0E-150
sp|B7HCU5|LEPA_BACC4 Elongation factor 4 OS=Bacillus cereus (strain B4264) GN=lepA PE=3 SV=1 54 579 2.0E-150
sp|B7IYH2|LEPA_BACC2 Elongation factor 4 OS=Bacillus cereus (strain G9842) GN=lepA PE=3 SV=1 54 579 2.0E-150
sp|A1RMC9|LEPA_SHESW Elongation factor 4 OS=Shewanella sp. (strain W3-18-1) GN=lepA PE=3 SV=1 52 579 2.0E-150
sp|Q5NLP5|LEPA_ZYMMO Elongation factor 4 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=lepA PE=3 SV=1 51 579 2.0E-150
sp|A8FFD6|LEPA_BACP2 Elongation factor 4 OS=Bacillus pumilus (strain SAFR-032) GN=lepA PE=3 SV=1 41 579 3.0E-150
sp|A3QBS5|LEPA_SHELP Elongation factor 4 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=lepA PE=3 SV=1 52 579 3.0E-150
sp|A6WKQ5|LEPA_SHEB8 Elongation factor 4 OS=Shewanella baltica (strain OS185) GN=lepA PE=3 SV=1 52 579 4.0E-150
sp|A3D1V4|LEPA_SHEB5 Elongation factor 4 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=lepA PE=3 SV=1 52 579 4.0E-150
sp|Q6F0Z2|LEPA_MESFL Elongation factor 4 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=lepA PE=3 SV=1 54 579 4.0E-150
sp|Q5YZZ7|LEPA_NOCFA Elongation factor 4 OS=Nocardia farcinica (strain IFM 10152) GN=lepA PE=3 SV=1 54 579 4.0E-150
sp|A7ZCJ3|LEPA_CAMC1 Elongation factor 4 OS=Campylobacter concisus (strain 13826) GN=lepA PE=3 SV=1 52 579 4.0E-150
sp|Q0ICF2|LEPA_SYNS3 Elongation factor 4 OS=Synechococcus sp. (strain CC9311) GN=lepA PE=3 SV=1 51 579 4.0E-150
sp|B7HPL8|LEPA_BACC7 Elongation factor 4 OS=Bacillus cereus (strain AH187) GN=lepA PE=3 SV=1 54 579 4.0E-150
sp|B7JNV1|LEPA_BACC0 Elongation factor 4 OS=Bacillus cereus (strain AH820) GN=lepA PE=3 SV=1 54 579 4.0E-150
sp|Q81LR7|LEPA_BACAN Elongation factor 4 OS=Bacillus anthracis GN=lepA PE=3 SV=1 54 579 5.0E-150
sp|C3P8M5|LEPA_BACAA Elongation factor 4 OS=Bacillus anthracis (strain A0248) GN=lepA PE=3 SV=1 54 579 5.0E-150
sp|A2RL76|LEPA_LACLM Elongation factor 4 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=lepA PE=3 SV=1 53 579 5.0E-150
sp|Q6G1F5|LEPA_BARQU Elongation factor 4 OS=Bartonella quintana (strain Toulouse) GN=lepA PE=3 SV=1 55 579 5.0E-150
sp|Q02Z80|LEPA_LACLS Elongation factor 4 OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=lepA PE=3 SV=1 53 579 5.0E-150
sp|C3L5S2|LEPA_BACAC Elongation factor 4 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=lepA PE=3 SV=1 54 579 5.0E-150
sp|B4RVA8|LEPA_ALTMD Elongation factor 4 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=lepA1 PE=3 SV=1 55 579 5.0E-150
sp|Q5FHQ1|LEPA_EHRRG Elongation factor 4 OS=Ehrlichia ruminantium (strain Gardel) GN=lepA PE=3 SV=1 55 581 6.0E-150
sp|A4Y4K2|LEPA_SHEPC Elongation factor 4 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=lepA PE=3 SV=1 52 579 7.0E-150
sp|Q5HBH4|LEPA_EHRRW Elongation factor 4 OS=Ehrlichia ruminantium (strain Welgevonden) GN=lepA PE=3 SV=1 55 581 7.0E-150
sp|A9BE39|LEPA_PROM4 Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9211) GN=lepA PE=3 SV=1 50 579 7.0E-150
sp|A9L5N4|LEPA_SHEB9 Elongation factor 4 OS=Shewanella baltica (strain OS195) GN=lepA PE=3 SV=1 52 579 8.0E-150
sp|B8EBQ4|LEPA_SHEB2 Elongation factor 4 OS=Shewanella baltica (strain OS223) GN=lepA PE=3 SV=1 52 579 8.0E-150
sp|B1X3K4|GUFP_PAUCH Translation factor GUF1 homolog, organellar chromatophore OS=Paulinella chromatophora GN=lepA PE=3 SV=1 51 579 8.0E-150
sp|Q5E312|LEPA_VIBF1 Elongation factor 4 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=lepA PE=3 SV=1 52 579 1.0E-149
sp|Q49Y26|LEPA_STAS1 Elongation factor 4 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=lepA PE=3 SV=1 53 579 1.0E-149
sp|Q6HDK2|LEPA_BACHK Elongation factor 4 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=lepA PE=3 SV=1 54 579 1.0E-149
sp|Q634M2|LEPA_BACCZ Elongation factor 4 OS=Bacillus cereus (strain ZK / E33L) GN=lepA PE=3 SV=1 54 579 1.0E-149
sp|C1ESL3|LEPA_BACC3 Elongation factor 4 OS=Bacillus cereus (strain 03BB102) GN=lepA PE=3 SV=1 54 579 1.0E-149
sp|A0RIT7|LEPA_BACAH Elongation factor 4 OS=Bacillus thuringiensis (strain Al Hakam) GN=lepA PE=3 SV=1 54 579 1.0E-149
sp|Q8EH83|LEPA_SHEON Elongation factor 4 OS=Shewanella oneidensis (strain MR-1) GN=lepA PE=3 SV=1 52 579 1.0E-149
sp|Q5FUC2|LEPA_GLUOX Elongation factor 4 OS=Gluconobacter oxydans (strain 621H) GN=lepA PE=3 SV=2 51 579 1.0E-149
sp|Q9CGI8|LEPA_LACLA Elongation factor 4 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lepA PE=3 SV=1 53 579 1.0E-149
sp|B9IY86|LEPA_BACCQ Elongation factor 4 OS=Bacillus cereus (strain Q1) GN=lepA PE=3 SV=1 54 579 2.0E-149
sp|Q87C09|LEPA_XYLFT Elongation factor 4 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=lepA PE=3 SV=1 51 579 2.0E-149
sp|B2I601|LEPA_XYLF2 Elongation factor 4 OS=Xylella fastidiosa (strain M23) GN=lepA PE=3 SV=1 51 579 2.0E-149
sp|Q5PAX8|LEPA_ANAMM Elongation factor 4 OS=Anaplasma marginale (strain St. Maries) GN=lepA PE=3 SV=1 55 579 2.0E-149
sp|B9KIE5|LEPA_ANAMF Elongation factor 4 OS=Anaplasma marginale (strain Florida) GN=lepA PE=3 SV=1 55 579 2.0E-149
sp|Q7NWC7|LEPA_CHRVO Elongation factor 4 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=lepA PE=3 SV=1 52 579 3.0E-149
sp|Q01SV7|LEPA_SOLUE Elongation factor 4 OS=Solibacter usitatus (strain Ellin6076) GN=lepA PE=3 SV=1 53 579 3.0E-149
sp|P43729|LEPA_HAEIN Elongation factor 4 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lepA PE=3 SV=1 52 579 3.0E-149
sp|Q1MQF3|LEPA_LAWIP Elongation factor 4 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=lepA PE=3 SV=1 50 579 3.0E-149
sp|A5UFI9|LEPA_HAEIG Elongation factor 4 OS=Haemophilus influenzae (strain PittGG) GN=lepA PE=3 SV=1 52 579 4.0E-149
sp|A5UBC2|LEPA_HAEIE Elongation factor 4 OS=Haemophilus influenzae (strain PittEE) GN=lepA PE=3 SV=1 52 579 4.0E-149
sp|Q4QPM8|LEPA_HAEI8 Elongation factor 4 OS=Haemophilus influenzae (strain 86-028NP) GN=lepA PE=3 SV=1 52 579 4.0E-149
sp|B2FQC4|LEPA_STRMK Elongation factor 4 OS=Stenotrophomonas maltophilia (strain K279a) GN=lepA PE=3 SV=1 52 579 4.0E-149
sp|Q9PBA1|LEPA_XYLFA Elongation factor 4 OS=Xylella fastidiosa (strain 9a5c) GN=lepA PE=3 SV=1 51 579 4.0E-149
sp|Q8CXD0|LEPA_OCEIH Elongation factor 4 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=lepA PE=3 SV=1 56 579 5.0E-149
sp|A0Q453|LEPA_FRATN Elongation factor 4 OS=Francisella tularensis subsp. novicida (strain U112) GN=lepA PE=3 SV=1 52 579 6.0E-149
sp|Q9FNM5|GUFP_ARATH Translation factor GUF1 homolog, chloroplastic OS=Arabidopsis thaliana GN=At5g08650 PE=2 SV=2 7 579 7.0E-149
sp|Q68X95|LEPA_RICTY Elongation factor 4 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=lepA PE=3 SV=1 55 577 1.0E-148
sp|Q9VRH6|GUF1_DROME Translation factor waclaw, mitochondrial OS=Drosophila melanogaster GN=waw PE=3 SV=2 30 578 1.0E-148
sp|Q112D2|LEPA_TRIEI Elongation factor 4 OS=Trichodesmium erythraeum (strain IMS101) GN=lepA PE=3 SV=1 47 579 1.0E-148
sp|Q6AL53|LEPA_DESPS Elongation factor 4 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=lepA PE=3 SV=1 52 581 2.0E-148
sp|A0Q1R8|LEPA_CLONN Elongation factor 4 OS=Clostridium novyi (strain NT) GN=lepA PE=3 SV=1 56 579 2.0E-148
sp|Q1JH37|LEPA_STRPD Elongation factor 4 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=lepA PE=3 SV=1 53 579 2.0E-148
sp|B1KI55|LEPA_SHEWM Elongation factor 4 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=lepA PE=3 SV=1 52 579 2.0E-148
sp|C6BST2|LEPA_DESAD Elongation factor 4 OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=lepA PE=3 SV=1 52 582 2.0E-148
sp|Q5ZUD2|LEPA_LEGPH Elongation factor 4 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=lepA PE=3 SV=1 52 579 3.0E-148
sp|A5ID24|LEPA_LEGPC Elongation factor 4 OS=Legionella pneumophila (strain Corby) GN=lepA PE=3 SV=1 52 579 3.0E-148
sp|Q5X443|LEPA_LEGPA Elongation factor 4 OS=Legionella pneumophila (strain Paris) GN=lepA PE=3 SV=1 52 579 3.0E-148
sp|B4SRL3|LEPA_STRM5 Elongation factor 4 OS=Stenotrophomonas maltophilia (strain R551-3) GN=lepA PE=3 SV=1 52 579 3.0E-148
sp|A9VHU6|LEPA_BACWK Elongation factor 4 OS=Bacillus weihenstephanensis (strain KBAB4) GN=lepA PE=3 SV=1 54 579 3.0E-148
sp|B9F2U5|GUFP_ORYSJ Translation factor GUF1 homolog, chloroplastic OS=Oryza sativa subsp. japonica GN=Os02g0157700 PE=3 SV=1 44 579 3.0E-148
sp|A9HG78|LEPA_GLUDA Elongation factor 4 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=lepA PE=3 SV=1 51 579 3.0E-148
sp|Q21XN4|LEPA_RHOFT Elongation factor 4 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=lepA PE=3 SV=1 52 579 3.0E-148
sp|B0U3D5|LEPA_XYLFM Elongation factor 4 OS=Xylella fastidiosa (strain M12) GN=lepA PE=3 SV=1 51 579 4.0E-148
sp|Q31R08|LEPA_SYNE7 Elongation factor 4 OS=Synechococcus elongatus (strain PCC 7942) GN=lepA PE=3 SV=1 50 579 4.0E-148
sp|C1F2I3|LEPA_ACIC5 Elongation factor 4 OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=lepA PE=3 SV=1 55 579 6.0E-148
sp|A7GZW3|LEPA_CAMC5 Elongation factor 4 OS=Campylobacter curvus (strain 525.92) GN=lepA PE=3 SV=1 52 579 6.0E-148
sp|A6L744|LEPA_BACV8 Elongation factor 4 OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=lepA PE=3 SV=1 52 579 7.0E-148
sp|Q8YU48|LEPA_NOSS1 Elongation factor 4 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=lepA PE=3 SV=1 50 579 7.0E-148
sp|Q1QX26|LEPA_CHRSD Elongation factor 4 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=lepA PE=3 SV=1 44 579 7.0E-148
sp|Q99ZV8|LEPA_STRP1 Elongation factor 4 OS=Streptococcus pyogenes serotype M1 GN=lepA PE=3 SV=1 53 579 7.0E-148
sp|Q07YZ4|LEPA_SHEFN Elongation factor 4 OS=Shewanella frigidimarina (strain NCIMB 400) GN=lepA PE=3 SV=1 52 579 7.0E-148
sp|Q48TU0|LEPA_STRPM Elongation factor 4 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=lepA PE=3 SV=1 53 579 8.0E-148
sp|Q1JLY8|LEPA_STRPC Elongation factor 4 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=lepA PE=3 SV=1 53 579 8.0E-148
sp|P0DC23|LEPA_STRPQ Elongation factor 4 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=lepA PE=3 SV=1 53 579 1.0E-147
sp|P0DC22|LEPA_STRP3 Elongation factor 4 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=lepA PE=3 SV=1 53 579 1.0E-147
sp|Q1JC06|LEPA_STRPB Elongation factor 4 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=lepA PE=3 SV=1 53 579 2.0E-147
sp|P53530|LEPA_MYCLE Elongation factor 4 OS=Mycobacterium leprae (strain TN) GN=lepA PE=3 SV=1 54 579 2.0E-147
sp|B8ZUS2|LEPA_MYCLB Elongation factor 4 OS=Mycobacterium leprae (strain Br4923) GN=lepA PE=3 SV=1 54 579 2.0E-147
sp|A1U2V8|LEPA_MARHV Elongation factor 4 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=lepA PE=3 SV=1 52 581 2.0E-147
sp|Q2RNY6|LEPA_RHORT Elongation factor 4 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=lepA PE=3 SV=2 52 579 2.0E-147
sp|Q31HP5|LEPA_THICR Elongation factor 4 OS=Thiomicrospira crunogena (strain XCL-2) GN=lepA PE=3 SV=1 52 579 2.0E-147
sp|Q1J6V6|LEPA_STRPF Elongation factor 4 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=lepA PE=3 SV=1 53 579 3.0E-147
sp|Q3MG20|LEPA_ANAVT Elongation factor 4 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=lepA PE=3 SV=1 50 579 3.0E-147
sp|A0RQX4|LEPA_CAMFF Elongation factor 4 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=lepA PE=3 SV=1 52 579 3.0E-147
sp|B5XLC6|LEPA_STRPZ Elongation factor 4 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=lepA PE=3 SV=1 53 579 3.0E-147
sp|A4SVW0|LEPA_POLSQ Elongation factor 4 OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=lepA PE=3 SV=1 52 579 3.0E-147
sp|A8MFA6|LEPA_ALKOO Elongation factor 4 OS=Alkaliphilus oremlandii (strain OhILAs) GN=lepA PE=3 SV=1 53 579 3.0E-147
sp|D2VRR7|GUF1_NAEGR Translation factor GUF1 homolog, mitochondrial OS=Naegleria gruberi GN=NAEGRDRAFT_71680 PE=3 SV=1 53 579 3.0E-147
sp|Q3BVV9|LEPA_XANC5 Elongation factor 4 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=lepA PE=3 SV=1 52 579 3.0E-147
sp|Q5WVI1|LEPA_LEGPL Elongation factor 4 OS=Legionella pneumophila (strain Lens) GN=lepA PE=3 SV=1 52 579 4.0E-147
sp|A5VB59|LEPA_SPHWW Elongation factor 4 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=lepA PE=3 SV=1 50 579 4.0E-147
sp|Q7VL73|LEPA_HAEDU Elongation factor 4 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=lepA PE=3 SV=2 52 579 4.0E-147
sp|P74751|LEPA_SYNY3 Elongation factor 4 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=lepA PE=3 SV=1 50 579 4.0E-147
sp|O51115|LEPA_BORBU Elongation factor 4 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=lepA PE=3 SV=2 54 579 6.0E-147
sp|Q9ZDQ1|LEPA_RICPR Elongation factor 4 OS=Rickettsia prowazekii (strain Madrid E) GN=lepA PE=3 SV=1 55 577 6.0E-147
sp|Q65VN2|LEPA_MANSM Elongation factor 4 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=lepA PE=3 SV=2 52 579 6.0E-147
sp|Q7NAT2|LEPA_MYCGA Elongation factor 4 OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=lepA PE=3 SV=2 53 579 7.0E-147
sp|B9GHA6|GUFP_POPTR Translation factor GUF1 homolog, chloroplastic OS=Populus trichocarpa GN=POPTRDRAFT_815670 PE=3 SV=2 44 579 7.0E-147
sp|C4L433|LEPA_EXISA Elongation factor 4 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=lepA PE=3 SV=1 42 579 7.0E-147
sp|A2BV79|LEPA_PROM5 Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9515) GN=lepA PE=3 SV=1 50 581 7.0E-147
sp|A6VLV6|LEPA_ACTSZ Elongation factor 4 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=lepA PE=3 SV=1 52 579 7.0E-147
sp|Q5N390|LEPA_SYNP6 Elongation factor 4 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=lepA PE=3 SV=2 50 579 8.0E-147
sp|Q5XCD2|LEPA_STRP6 Elongation factor 4 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=lepA PE=3 SV=1 53 579 9.0E-147
sp|B5EQB5|LEPA_ACIF5 Elongation factor 4 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=lepA PE=3 SV=1 53 579 9.0E-147
sp|B7J9J8|LEPA_ACIF2 Elongation factor 4 OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=lepA PE=3 SV=1 53 579 9.0E-147
sp|Q88MY7|LEPA_PSEPK Elongation factor 4 OS=Pseudomonas putida (strain KT2440) GN=lepA PE=3 SV=1 52 579 1.0E-146
sp|A5W8F4|LEPA_PSEP1 Elongation factor 4 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=lepA PE=3 SV=1 52 579 1.0E-146
sp|A7IEG8|LEPA_XANP2 Elongation factor 4 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=lepA PE=3 SV=1 53 581 1.0E-146
sp|Q7V2Q1|LEPA_PROMP Elongation factor 4 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=lepA PE=3 SV=1 50 581 1.0E-146
sp|Q21IH3|LEPA_SACD2 Elongation factor 4 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=lepA PE=3 SV=1 52 579 2.0E-146
sp|A1SSM6|LEPA_PSYIN Elongation factor 4 OS=Psychromonas ingrahamii (strain 37) GN=lepA PE=3 SV=1 52 581 2.0E-146
sp|Q0AWL9|LEPA_SYNWW Elongation factor 4 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=lepA PE=3 SV=1 53 579 2.0E-146
sp|B5FAH2|LEPA_VIBFM Elongation factor 4 OS=Vibrio fischeri (strain MJ11) GN=lepA PE=3 SV=1 52 579 3.0E-146
sp|Q3IDL4|LEPA_PSEHT Elongation factor 4 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=lepA PE=3 SV=1 52 579 3.0E-146
sp|Q13E78|LEPA_RHOPS Elongation factor 4 OS=Rhodopseudomonas palustris (strain BisB5) GN=lepA PE=3 SV=2 47 579 3.0E-146
sp|B0USR9|LEPA_HISS2 Elongation factor 4 OS=Histophilus somni (strain 2336) GN=lepA PE=3 SV=1 52 579 3.0E-146
sp|Q0I4Z1|LEPA_HAES1 Elongation factor 4 OS=Haemophilus somnus (strain 129Pt) GN=lepA PE=3 SV=1 52 579 3.0E-146
sp|B8AI54|GUFP_ORYSI Translation factor GUF1 homolog, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_05919 PE=3 SV=1 56 579 3.0E-146
sp|Q1LTI1|LEPA_BAUCH Elongation factor 4 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=lepA PE=3 SV=1 52 581 4.0E-146
sp|C3LR06|LEPA_VIBCM Elongation factor 4 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=lepA PE=3 SV=1 52 579 4.0E-146
sp|Q9KPB0|LEPA_VIBCH Elongation factor 4 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=lepA PE=3 SV=1 52 579 4.0E-146
sp|A5F5G3|LEPA_VIBC3 Elongation factor 4 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=lepA PE=3 SV=1 52 579 4.0E-146
sp|Q7M8H5|LEPA_WOLSU Elongation factor 4 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=lepA PE=3 SV=1 52 579 4.0E-146
sp|B9RHQ5|GUFP_RICCO Translation factor GUF1 homolog, chloroplastic OS=Ricinus communis GN=RCOM_1767360 PE=3 SV=1 44 579 4.0E-146
sp|Q8RFD1|LEPA_FUSNN Elongation factor 4 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=lepA PE=3 SV=1 56 579 5.0E-146
sp|Q3YSC2|LEPA_EHRCJ Elongation factor 4 OS=Ehrlichia canis (strain Jake) GN=lepA PE=3 SV=1 55 581 6.0E-146
sp|Q2J2Y0|LEPA_RHOP2 Elongation factor 4 OS=Rhodopseudomonas palustris (strain HaA2) GN=lepA PE=3 SV=2 51 579 6.0E-146
sp|Q3KHM1|LEPA_PSEPF Elongation factor 4 OS=Pseudomonas fluorescens (strain Pf0-1) GN=lepA PE=3 SV=1 52 579 6.0E-146
sp|A4XSC1|LEPA_PSEMY Elongation factor 4 OS=Pseudomonas mendocina (strain ymp) GN=lepA PE=3 SV=1 52 579 6.0E-146
sp|Q1B684|LEPA_MYCSS Elongation factor 4 OS=Mycobacterium sp. (strain MCS) GN=lepA PE=3 SV=1 54 579 7.0E-146
sp|A1UIU2|LEPA_MYCSK Elongation factor 4 OS=Mycobacterium sp. (strain KMS) GN=lepA PE=3 SV=1 54 579 7.0E-146
sp|A3Q2A6|LEPA_MYCSJ Elongation factor 4 OS=Mycobacterium sp. (strain JLS) GN=lepA PE=3 SV=1 54 579 7.0E-146
sp|Q7MHN6|LEPA_VIBVY Elongation factor 4 OS=Vibrio vulnificus (strain YJ016) GN=lepA PE=3 SV=1 52 579 7.0E-146
sp|Q8DC78|LEPA_VIBVU Elongation factor 4 OS=Vibrio vulnificus (strain CMCP6) GN=lepA PE=3 SV=1 52 579 7.0E-146
sp|A9KKU4|LEPA_CLOPH Elongation factor 4 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=lepA PE=3 SV=1 47 579 7.0E-146
sp|B3Q991|LEPA_RHOPT Elongation factor 4 OS=Rhodopseudomonas palustris (strain TIE-1) GN=lepA PE=3 SV=1 51 579 8.0E-146
sp|P60793|LEPA_RHOPA Elongation factor 4 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=lepA PE=3 SV=1 51 579 8.0E-146
sp|Q1I5V6|LEPA_PSEE4 Elongation factor 4 OS=Pseudomonas entomophila (strain L48) GN=lepA PE=3 SV=1 52 579 8.0E-146
sp|B3CPV1|LEPA_WOLPP Elongation factor 4 OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=lepA PE=3 SV=1 52 581 8.0E-146
sp|Q0SP76|LEPA_BORAP Elongation factor 4 OS=Borrelia afzelii (strain PKo) GN=lepA PE=3 SV=1 54 581 9.0E-146
sp|A4J080|LEPA_FRATW Elongation factor 4 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=lepA PE=3 SV=1 52 579 9.0E-146
sp|Q8PMV3|LEPA_XANAC Elongation factor 4 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=lepA PE=3 SV=1 52 579 9.0E-146
sp|Q12KH9|LEPA_SHEDO Elongation factor 4 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=lepA PE=3 SV=1 52 579 1.0E-145
sp|Q5NEF8|LEPA_FRATT Elongation factor 4 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=lepA PE=3 SV=1 52 579 1.0E-145
sp|Q14FW1|LEPA_FRAT1 Elongation factor 4 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=lepA PE=3 SV=1 52 579 1.0E-145
sp|Q9I5G8|LEPA_PSEAE Elongation factor 4 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lepA PE=3 SV=1 52 579 1.0E-145
sp|Q02HR9|LEPA_PSEAB Elongation factor 4 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=lepA PE=3 SV=1 52 579 1.0E-145
sp|B7UYX5|LEPA_PSEA8 Elongation factor 4 OS=Pseudomonas aeruginosa (strain LESB58) GN=lepA PE=3 SV=1 52 579 1.0E-145
sp|B0KV29|LEPA_PSEPG Elongation factor 4 OS=Pseudomonas putida (strain GB-1) GN=lepA PE=3 SV=1 52 579 1.0E-145
sp|B2J0M4|LEPA_NOSP7 Elongation factor 4 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=lepA PE=3 SV=1 50 579 1.0E-145
sp|A6VAK9|LEPA_PSEA7 Elongation factor 4 OS=Pseudomonas aeruginosa (strain PA7) GN=lepA PE=3 SV=1 52 579 1.0E-145
sp|Q1QDV6|LEPA_PSYCK Elongation factor 4 OS=Psychrobacter cryohalolentis (strain K5) GN=lepA PE=3 SV=1 52 579 2.0E-145
sp|C4LBZ6|LEPA_TOLAT Elongation factor 4 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=lepA PE=3 SV=1 52 579 2.0E-145
sp|C1AUN7|LEPA_RHOOB Elongation factor 4 OS=Rhodococcus opacus (strain B4) GN=lepA PE=3 SV=1 54 579 2.0E-145
sp|A8H1C5|LEPA_SHEPA Elongation factor 4 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=lepA PE=3 SV=1 52 579 2.0E-145
sp|A5B4D2|GUFP_VITVI Translation factor GUF1 homolog, chloroplastic OS=Vitis vinifera GN=VITISV_013255 PE=3 SV=1 44 579 2.0E-145
sp|Q0VP16|LEPA_ALCBS Elongation factor 4 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=lepA PE=3 SV=1 52 579 2.0E-145
sp|Q662S4|LEPA_BORBP Elongation factor 4 OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=lepA PE=3 SV=1 54 581 2.0E-145
sp|Q0SH84|LEPA_RHOJR Elongation factor 4 OS=Rhodococcus jostii (strain RHA1) GN=lepA PE=3 SV=1 54 579 2.0E-145
sp|Q892Q6|LEPA_CLOTE Elongation factor 4 OS=Clostridium tetani (strain Massachusetts / E88) GN=lepA PE=3 SV=2 53 579 3.0E-145
sp|Q8PB55|LEPA_XANCP Elongation factor 4 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=lepA PE=3 SV=1 52 579 3.0E-145
sp|B2SEJ6|LEPA_FRATM Elongation factor 4 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=lepA PE=3 SV=1 52 579 4.0E-145
sp|Q4A5S3|LEPA_MYCS5 Elongation factor 4 OS=Mycoplasma synoviae (strain 53) GN=lepA PE=3 SV=1 54 579 4.0E-145
sp|B3ESU2|LEPA_AMOA5 Elongation factor 4 OS=Amoebophilus asiaticus (strain 5a2) GN=lepA PE=3 SV=1 52 579 4.0E-145
sp|Q2GGA6|LEPA_EHRCR Elongation factor 4 OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=lepA PE=3 SV=1 55 581 4.0E-145
sp|C1N1Y2|GUFP_MICPC Translation factor GUF1 homolog, chloroplastic OS=Micromonas pusilla (strain CCMP1545) GN=MICPUCDRAFT_51778 PE=3 SV=1 4 579 4.0E-145
sp|B0RX30|LEPA_XANCB Elongation factor 4 OS=Xanthomonas campestris pv. campestris (strain B100) GN=lepA PE=3 SV=1 52 579 5.0E-145
sp|Q4USF4|LEPA_XANC8 Elongation factor 4 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=lepA PE=3 SV=1 52 579 5.0E-145
sp|A6LC18|LEPA_PARD8 Elongation factor 4 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=lepA PE=3 SV=1 52 579 5.0E-145
sp|Q6KHP1|LEPA_MYCMO Elongation factor 4 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=lepA PE=3 SV=1 54 579 5.0E-145
sp|A1AWP9|LEPA_RUTMC Elongation factor 4 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=lepA PE=3 SV=1 52 579 5.0E-145
sp|A0LI00|LEPA_SYNFM Elongation factor 4 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=lepA PE=3 SV=1 54 581 5.0E-145
[Show less]

GO

GO Term Description Terminal node
GO:0003924 GTPase activity Yes
GO:0005525 GTP binding Yes
GO:0016462 pyrophosphatase activity No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:1901265 nucleoside phosphate binding No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016787 hydrolase activity No
GO:0005488 binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0036094 small molecule binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0032555 purine ribonucleotide binding No
GO:0019001 guanyl nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup685
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|614 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5428
Ophiocordyceps camponoti-floridani Ophcf2|02496
Ophiocordyceps camponoti-rufipedis Ophun1|1349
Ophiocordyceps kimflemingae Ophio5|2673
Ophiocordyceps subramaniannii Hirsu2|11205

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|614
MNWAWRSGWRAWTRALPVLEPSLVARPPRRIRAFSAKSTPTELEKRIAAIPIERFRNFCIVAHIDHGKSTLSDRL
LELTGTISASDGNKQILDKLDVERERGITVKAQTCTMLYTHKGDDYLLHLVDTPGHVDFRAEVMRSYASCGGALL
LVDASQGIQAQTVSNFHLAFAEDLALVPVINKIDMMSADVPRVLDQIETSFELDPKDAVLVSAKTGKGVPELLPV
VVERMPHPEGDETKPLKMLLVDSWYDNFKGVGLLVRVFDGVVKAGDQVVSLGTGSRYTVGQVGIQYPDATPQNVL
RAGQVGFVFFNPAVKRIQEAKLGDTYTTVAHETAVTPCPGFQEPKPMVFVAAFPADSTDYGRLADSIGQLALNDR
SVTVAKDFSEALGSGWRLGFLGSLHCSVFQDRLKQEHGRSLILTEPTVPSKIVRSDGTEEVVTNPALFPDSEKRS
GIKTLEPYVKATITVPNEHLGRIIEICEANRGEQVSLEYYGDQVILVYDMPTAHLVDDLFGKLKSASKGYATLEY
EDDGWRESSLVKLQLLVNRVPVDAVCRVLHESQSERLARQWVTKFREHVDRQMFGMLT*
Coding >OphauG2|614
ATGAACTGGGCCTGGAGAAGCGGGTGGCGGGCATGGACTCGAGCATTGCCAGTGTTGGAGCCCAGCCTTGTTGCT
CGACCGCCACGACGCATTCGAGCTTTTTCGGCCAAGTCGACGCCCACGGAGCTGGAGAAGAGAATTGCTGCCATT
CCAATCGAGCGGTTTCGCAACTTTTGCATCGTTGCACACATTGATCATGGCAAGAGTACGCTTAGCGATAGGCTG
CTGGAGCTAACGGGCACGATATCGGCCAGCGATGGCAACAAGCAAATTCTCGACAAGCTCGATGTTGAACGCGAG
CGCGGCATCACGGTCAAGGCGCAGACTTGCACCATGCTCTACACCCACAAGGGCGACGACTATCTACTGCACCTT
GTCGACACGCCGGGCCACGTCGATTTCCGTGCCGAGGTGATGCGGTCGTATGCCAGCTGTGGTGGCGCGCTGCTG
CTAGTCGATGCCAGCCAGGGCATCCAGGCGCAGACGGTGTCCAACTTCCATCTTGCCTTTGCCGAAGACCTGGCT
CTGGTTCCCGTCATCAATAAAATCGACATGATGTCTGCAGACGTTCCGCGCGTGCTGGACCAGATTGAGACGTCG
TTTGAGCTGGACCCCAAGGATGCGGTGCTGGTGAGCGCCAAGACGGGCAAAGGCGTCCCCGAGCTATTGCCCGTT
GTGGTGGAGCGAATGCCGCATCCCGAGGGCGACGAGACGAAGCCGCTCAAGATGTTGCTGGTGGACTCGTGGTAC
GACAACTTCAAGGGCGTGGGGCTTCTTGTGCGAGTCTTTGACGGCGTCGTCAAGGCCGGAGACCAGGTGGTCTCG
CTCGGCACCGGCTCGCGCTACACAGTCGGCCAGGTGGGCATCCAGTATCCCGATGCCACGCCGCAAAACGTGCTC
CGGGCCGGCCAAGTCGGCTTTGTCTTTTTCAACCCAGCCGTCAAGCGCATCCAGGAAGCAAAGCTGGGAGACACA
TACACCACTGTAGCACACGAGACGGCTGTGACGCCTTGCCCGGGCTTCCAAGAGCCGAAGCCCATGGTGTTTGTG
GCTGCTTTTCCCGCAGACTCGACCGACTATGGCCGCCTGGCTGACAGCATTGGCCAACTCGCCCTCAACGACCGC
AGCGTCACGGTAGCCAAGGACTTTTCCGAAGCGCTGGGATCAGGCTGGCGGCTAGGTTTCCTGGGCAGCTTGCAC
TGCTCCGTCTTCCAGGACCGCCTGAAGCAGGAGCATGGACGCAGCCTTATCCTGACGGAGCCAACCGTGCCGTCA
AAGATTGTGAGGAGTGACGGAACAGAAGAAGTGGTGACGAATCCAGCCCTATTTCCCGACAGCGAGAAGCGGTCG
GGCATCAAGACTCTTGAACCATATGTCAAGGCCACAATTACCGTGCCTAATGAGCACTTGGGGCGTATAATTGAG
ATTTGCGAGGCTAATCGCGGAGAGCAAGTCAGCCTCGAGTACTACGGGGACCAAGTCATTTTGGTGTACGACATG
CCGACGGCGCATCTTGTCGACGACTTGTTTGGCAAACTCAAGAGCGCAAGCAAGGGATACGCTACCCTCGAGTAC
GAAGATGATGGGTGGCGGGAAAGCTCACTGGTCAAGCTGCAACTTCTGGTTAACCGAGTGCCGGTGGATGCCGTG
TGCCGCGTCTTGCACGAGTCGCAGTCTGAGCGCCTGGCGCGACAATGGGTGACCAAGTTTAGAGAGCATGTTGAT
CGGCAAATGTTTGGTATGTTGACATAA
Transcript >OphauG2|614
ATGAACTGGGCCTGGAGAAGCGGGTGGCGGGCATGGACTCGAGCATTGCCAGTGTTGGAGCCCAGCCTTGTTGCT
CGACCGCCACGACGCATTCGAGCTTTTTCGGCCAAGTCGACGCCCACGGAGCTGGAGAAGAGAATTGCTGCCATT
CCAATCGAGCGGTTTCGCAACTTTTGCATCGTTGCACACATTGATCATGGCAAGAGTACGCTTAGCGATAGGCTG
CTGGAGCTAACGGGCACGATATCGGCCAGCGATGGCAACAAGCAAATTCTCGACAAGCTCGATGTTGAACGCGAG
CGCGGCATCACGGTCAAGGCGCAGACTTGCACCATGCTCTACACCCACAAGGGCGACGACTATCTACTGCACCTT
GTCGACACGCCGGGCCACGTCGATTTCCGTGCCGAGGTGATGCGGTCGTATGCCAGCTGTGGTGGCGCGCTGCTG
CTAGTCGATGCCAGCCAGGGCATCCAGGCGCAGACGGTGTCCAACTTCCATCTTGCCTTTGCCGAAGACCTGGCT
CTGGTTCCCGTCATCAATAAAATCGACATGATGTCTGCAGACGTTCCGCGCGTGCTGGACCAGATTGAGACGTCG
TTTGAGCTGGACCCCAAGGATGCGGTGCTGGTGAGCGCCAAGACGGGCAAAGGCGTCCCCGAGCTATTGCCCGTT
GTGGTGGAGCGAATGCCGCATCCCGAGGGCGACGAGACGAAGCCGCTCAAGATGTTGCTGGTGGACTCGTGGTAC
GACAACTTCAAGGGCGTGGGGCTTCTTGTGCGAGTCTTTGACGGCGTCGTCAAGGCCGGAGACCAGGTGGTCTCG
CTCGGCACCGGCTCGCGCTACACAGTCGGCCAGGTGGGCATCCAGTATCCCGATGCCACGCCGCAAAACGTGCTC
CGGGCCGGCCAAGTCGGCTTTGTCTTTTTCAACCCAGCCGTCAAGCGCATCCAGGAAGCAAAGCTGGGAGACACA
TACACCACTGTAGCACACGAGACGGCTGTGACGCCTTGCCCGGGCTTCCAAGAGCCGAAGCCCATGGTGTTTGTG
GCTGCTTTTCCCGCAGACTCGACCGACTATGGCCGCCTGGCTGACAGCATTGGCCAACTCGCCCTCAACGACCGC
AGCGTCACGGTAGCCAAGGACTTTTCCGAAGCGCTGGGATCAGGCTGGCGGCTAGGTTTCCTGGGCAGCTTGCAC
TGCTCCGTCTTCCAGGACCGCCTGAAGCAGGAGCATGGACGCAGCCTTATCCTGACGGAGCCAACCGTGCCGTCA
AAGATTGTGAGGAGTGACGGAACAGAAGAAGTGGTGACGAATCCAGCCCTATTTCCCGACAGCGAGAAGCGGTCG
GGCATCAAGACTCTTGAACCATATGTCAAGGCCACAATTACCGTGCCTAATGAGCACTTGGGGCGTATAATTGAG
ATTTGCGAGGCTAATCGCGGAGAGCAAGTCAGCCTCGAGTACTACGGGGACCAAGTCATTTTGGTGTACGACATG
CCGACGGCGCATCTTGTCGACGACTTGTTTGGCAAACTCAAGAGCGCAAGCAAGGGATACGCTACCCTCGAGTAC
GAAGATGATGGGTGGCGGGAAAGCTCACTGGTCAAGCTGCAACTTCTGGTTAACCGAGTGCCGGTGGATGCCGTG
TGCCGCGTCTTGCACGAGTCGCAGTCTGAGCGCCTGGCGCGACAATGGGTGACCAAGTTTAGAGAGCATGTTGAT
CGGCAAATGTTTGGTATGTTGACATAA
Gene >OphauG2|614
ATGAACTGGGCCTGGAGAAGCGGGTGGCGGGCATGGACTCGAGCATTGCCAGTGTTGGAGCCCAGCCTTGTTGCT
CGACCGCCACGACGCATTCGAGCTTTTTCGGCCAAGTCGACGCCCACGGAGCTGGAGAAGAGAATTGCTGCCATT
CCAATCGAGCGGTTTCGCAACTTTTGCATCGTTGCACACATTGATCATGGCAAGAGTACGCTTAGCGATAGGCTG
CTGGAGCTAACGGGCACGATATCGGCCAGCGATGGCAACAAGCAAATTCTCGTACGTCTCAAGAGCTCTTTGCAG
CAGGATTCTCGGGGGTGCAATGAAGCAAAAAAACGAGGAAAAAAAAACAAAAAAACGAGGAAAAAAAAACAAAGA
ACCGCTTGAGCTAGAGAGCCGGGCTGACTCGTCTTTTCCAGGACAAGCTCGATGTTGAACGCGAGCGCGGCATCA
CGGTCAAGGCGCAGACTTGCACCATGCTCTACACCCACAAGGGCGACGACTATCTACTGCACCTTGTCGACACGC
CGGGCCACGTCGATTTCCGTGCCGAGGTGATGCGGTCGTATGCCAGCTGTGGTGGCGCGCTGCTGCTAGTCGATG
CCAGCCAGGGCATCCAGGCGCAGACGGTGTCCAACTTCCATCTTGCCTTTGCCGAAGACCTGGCTCTGGTTCCCG
TCATCAATAAAATCGACATGATGTCTGCAGACGTTCCGCGCGTGCTGGACCAGATTGAGACGTCGTTTGAGCTGG
ACCCCAAGGATGCGGTGCTGGTGAGCGCCAAGACGGGCAAAGGCGTCCCCGAGCTATTGCCCGTTGTGGTGGAGC
GAATGCCGCATCCCGAGGGCGACGAGACGAAGCCGCTCAAGATGTTGCTGGTGGACTCGTGGTACGACAACTTCA
AGGGCGTGGGGCTTCTTGTGCGAGTCTTTGACGGCGTCGTCAAGGCCGGAGACCAGGTGGTCTCGCTCGGCACCG
GCTCGCGCTACACAGTCGGCCAGGTGGGCATCCAGTATCCCGATGCCACGCCGCAAAACGTGCTCCGGGCCGGCC
AAGTCGGCTTTGTCTTTTTCAACCCAGCCGTCAAGCGCATCCAGGAAGCAAAGCTGGGAGACACATACACCACTG
TAGCACACGAGACGGCTGTGACGCCTTGCCCGGGCTTCCAAGAGCCGAAGCCCATGGTGTTTGTGGCTGCTTTTC
CCGCAGACTCGACCGACTATGGCCGCCTGGCTGACAGCATTGGCCAACTCGCCCTCAACGACCGCAGCGTCACGG
TAGCCAAGGACTTTTCCGAAGCGCTGGGATCAGGCTGGCGGCTAGGTTTCCTGGGCAGCTTGCACTGCTCCGTCT
TCCAGGACCGCCTGAAGCAGGAGCATGGACGCAGCCTTATCCTGACGGAGCCAACCGTGCCGTCAAAGATTGTGA
GGAGTGACGGAACAGAAGAAGTGGTGACGAATCCAGCCCTATTTCCCGACAGCGAGAAGCGGTCGGGCATCAAGA
CTCTTGAACCGTGGGCTGCCCTTTTTTCCCCTGCTTTTCCCTTTCTTTTTTGACGTTGCAAAAGCTAATACCCCC
CCTCAAAAAACAGATATGTCAAGGCCACAATTACCGTGCCTAATGAGCACTTGGGGCGTATAATTGAGATTTGCG
AGGCTAATCGCGGAGAGCAAGTCAGCCTCGAGTACTACGGGGACCAAGTCATTTTGGTGTACGACATGCCGACGG
CGCATCTTGTCGACGACTTGTTTGGCAAACTCAAGAGCGCAAGGTGCGTTTTCTTTTTTGAGAGGACTATGATGA
TGAGTTTCAAGGACTGACCATGAGACTTAGCAAGGGATACGCTACCCTCGAGTACGAAGATGATGGGTGGCGGGA
AAGCTCACTGGTCAAGCTGCAACTTCTGGTTAACCGAGTGCCGGTGGATGCCGTGTGCCGCGTCTTGCACGAGTC
GCAGTCTGAGCGCCTGGCGCGACAATGGGTGACCAAGTTTAGAGAGCATGTTGATCGGCAAATGTTTGGTATGTT
GACATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail