Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6129
Gene name
LocationContig_603:3661..6205
Strand-
Gene length (bp)2544
Transcript length (bp)2373
Coding sequence length (bp)2373
Protein length (aa) 791

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|G5EB30|CHIA1_EMENI Endochitinase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chiA PE=1 SV=1 58 298 2.0E-17
sp|Q92223|CHIA1_EMEND Endochitinase A OS=Emericella nidulans GN=chiA PE=2 SV=3 58 298 2.0E-17
sp|P54197|CHI2_COCP7 Endochitinase 2 OS=Coccidioides posadasii (strain C735) GN=CTS2 PE=3 SV=2 67 290 5.0E-14
sp|E9F9R9|CHI2_METRA Endochitinase 2 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=chi2 PE=3 SV=2 17 308 6.0E-14
sp|Q1EAR5|CHI2_COCIM Endochitinase 2 OS=Coccidioides immitis (strain RS) GN=CTS2 PE=3 SV=2 67 290 8.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|G5EB30|CHIA1_EMENI Endochitinase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chiA PE=1 SV=1 58 298 2.0E-17
sp|Q92223|CHIA1_EMEND Endochitinase A OS=Emericella nidulans GN=chiA PE=2 SV=3 58 298 2.0E-17
sp|P54197|CHI2_COCP7 Endochitinase 2 OS=Coccidioides posadasii (strain C735) GN=CTS2 PE=3 SV=2 67 290 5.0E-14
sp|E9F9R9|CHI2_METRA Endochitinase 2 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=chi2 PE=3 SV=2 17 308 6.0E-14
sp|Q1EAR5|CHI2_COCIM Endochitinase 2 OS=Coccidioides immitis (strain RS) GN=CTS2 PE=3 SV=2 67 290 8.0E-14
sp|P29026|CHI1_RHIOL Chitinase 1 OS=Rhizopus oligosporus GN=CHI1 PE=1 SV=1 1 287 1.0E-13
sp|A2QUQ2|CHIA1_ASPNC Endochitinase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ctcA PE=2 SV=1 72 298 4.0E-13
sp|Q4U4T0|CHI2_METAN Endochitinase 2 OS=Metarhizium anisopliae GN=chi2 PE=1 SV=1 17 287 4.0E-13
sp|Q873Y0|CHIA1_ASPFM Endochitinase A1 OS=Neosartorya fumigata GN=chiA1 PE=1 SV=1 72 295 5.0E-13
sp|Q4WEP7|CHIA1_ASPFU Endochitinase A1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chiA1 PE=3 SV=1 72 295 1.0E-12
sp|P29027|CHI2_RHIOL Chitinase 2 OS=Rhizopus oligosporus GN=CHI2 PE=1 SV=1 1 287 9.0E-12
sp|P40954|CHI3_CANAL Chitinase 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHT3 PE=1 SV=2 17 300 2.0E-10
sp|P17541|CHIA_CUCSA Acidic endochitinase OS=Cucumis sativus PE=1 SV=1 77 293 1.0E-08
sp|P29029|CHIT_YEAST Endochitinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTS1 PE=1 SV=2 17 288 2.0E-06
sp|P29025|CHI1_RHINI Chitinase 1 OS=Rhizopus niveus GN=CHI1 PE=3 SV=1 77 462 4.0E-06
sp|P40953|CHI2_CANAL Chitinase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHT2 PE=1 SV=1 77 304 4.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup175
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6129 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|7112
Ophiocordyceps australis map64 (Brazil) OphauB2|5114
Ophiocordyceps australis map64 (Brazil) OphauB2|5509
Ophiocordyceps camponoti-floridani Ophcf2|00800
Ophiocordyceps camponoti-floridani Ophcf2|05574
Ophiocordyceps camponoti-rufipedis Ophun1|1902
Ophiocordyceps camponoti-rufipedis Ophun1|7604
Ophiocordyceps kimflemingae Ophio5|2615
Ophiocordyceps kimflemingae Ophio5|6743
Ophiocordyceps subramaniannii Hirsu2|242
Ophiocordyceps subramaniannii Hirsu2|7599

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6129
MAVQLASTGAYGAFNGYWSSSSGPHLGSYCDSGIQSATLDLVRILRTGPSTFTLSSDCWSEGILGSNSSAGQLTS
PCLSLKDDIAYCQSKNIQILVSVTLGNDQLYGAAGQDLADLIYSSFGIYDDGWNQARLFGQDVAVDGFNFDISPD
FNSSMVLEMMNRLRELDDRLLIAGTSSCPLDSDNDKNTATVKHLDALFLHYPESSTCVGTDSANLDNNLAAQNWI
QLLTGDKNTGAKLFISLPVSPWAVEAGTPLTAKDASNIMCKVKDDANFGGVSLWDDGKATSNEYGDRVFHEQVLA
TSNQPCTSGTGSLDGQSIKAGSPSSHALKSAKLMQRQVQQEPPESEGWNLAQGSTPENQIWEAPSATVRSCPPGG
AICSQKRRVEYRFVTYFVPCRKDQKNARPRRETVTLGRRQSLEEELDQRIKESLDTARSEYLRLFEERRQRQIAT
WKNRLQREAFPAEIEEQNSLMKKSDDVEMYRLMENYKRELDLWKTRTLEEVARQEQELKNKRPATRPNLQPVQET
TQAIGSSWRAQKTTSVKQQQQQQQQQQQQQQQKQQQQQQQQQQQQQKQAKKDFGVNKSSSKKPEAAATLKPASVA
GKPQAATKTNTANNSGYGMVVSVSKAKPASTKGPEAAKKAQKPDTKTKGSQAQKHEESKAKPRPSRSTNAEKPIK
GAKMEEVKNPEASTNNTEPSTAKQPHVPISKLRPLTLKKEETFSLAAPKKPETSSQEAKSSSDCYQDPVLAASNT
IFVDFYNQGLGFELDSAKVNFERSKLNFHGCLIIITLGRC*
Coding >OphauG2|6129
ATGGCTGTTCAGTTGGCTAGCACTGGTGCCTATGGCGCTTTTAACGGGTACTGGAGCTCTTCTTCTGGGCCGCAT
CTTGGATCCTACTGTGACAGCGGTATTCAGTCTGCTACCTTGGATCTTGTTCGTATACTACGGACAGGTCCCTCC
ACCTTTACTTTGTCCAGTGACTGCTGGTCTGAAGGCATTTTGGGCAGTAACAGCAGCGCTGGGCAGCTAACTAGC
CCGTGCTTATCGCTCAAGGATGATATTGCTTACTGCCAGTCCAAGAATATTCAGATTCTCGTGAGCGTCACTCTT
GGCAACGATCAACTTTATGGCGCTGCTGGACAAGACTTGGCCGACTTGATATACAGTAGCTTTGGGATCTATGAC
GATGGCTGGAATCAGGCCCGTCTCTTTGGCCAAGATGTTGCCGTCGATGGCTTCAACTTTGATATCTCTCCAGAC
TTTAACAGCAGCATGGTGCTGGAAATGATGAACCGGCTTCGGGAATTGGATGACAGGCTGCTCATCGCAGGTACA
TCTTCATGTCCTCTTGACTCTGACAATGACAAGAACACGGCTACGGTTAAGCACCTGGATGCTTTGTTTCTTCAT
TACCCCGAGAGTTCCACCTGTGTAGGGACAGACAGCGCGAATCTGGACAATAATTTGGCGGCTCAAAACTGGATC
CAACTTCTGACGGGGGACAAGAACACGGGCGCCAAGCTATTCATTAGTCTCCCAGTCTCTCCTTGGGCAGTGGAA
GCTGGCACTCCTCTGACTGCCAAGGATGCCTCGAATATCATGTGCAAGGTCAAAGACGACGCCAACTTTGGCGGT
GTCTCTTTGTGGGATGATGGAAAGGCTACGAGTAATGAATATGGCGACCGCGTGTTCCATGAGCAGGTTTTGGCC
ACGAGCAACCAACCATGCACTTCTGGAACCGGGTCTCTTGATGGCCAGTCGATCAAGGCAGGAAGCCCGTCTTCT
CACGCTCTGAAGAGTGCAAAACTCATGCAGCGACAAGTCCAGCAAGAGCCGCCCGAGTCTGAAGGATGGAATCTC
GCTCAAGGATCAACGCCCGAGAATCAAATATGGGAAGCACCTTCAGCAACTGTGCGGTCTTGTCCGCCGGGAGGC
GCCATCTGCTCCCAGAAGCGACGTGTTGAATACCGCTTTGTTACTTACTTTGTTCCTTGTAGAAAGGATCAAAAG
AATGCGCGACCGCGAAGAGAGACGGTGACACTGGGGCGACGACAGTCGTTGGAAGAGGAACTCGATCAACGAATC
AAGGAGAGCCTGGACACAGCAAGAAGCGAATACCTGCGCCTCTTTGAGGAGCGAAGACAGCGGCAGATTGCGACT
TGGAAAAACAGGCTGCAGCGAGAGGCGTTTCCAGCAGAGATTGAGGAGCAGAACTCGCTCATGAAGAAGTCTGAC
GACGTTGAAATGTACAGGTTGATGGAGAATTATAAAAGGGAACTGGATCTATGGAAGACACGGACACTGGAGGAG
GTTGCGCGACAGGAACAGGAACTGAAGAATAAGCGACCCGCAACAAGGCCCAATTTGCAGCCGGTTCAGGAAACG
ACACAAGCGATAGGCTCGTCATGGCGTGCTCAGAAAACAACCTCGGTGAAACAACAGCAACAGCAACAGCAACAG
CAACAGCAACAACAACAGCAAAAGCAACAACAACAGCAGCAGCAACAACAACAGCAACAGCAAAAACAAGCAAAA
AAGGACTTTGGGGTGAACAAGAGCTCCAGTAAAAAGCCAGAGGCTGCTGCTACACTGAAACCAGCGTCGGTCGCT
GGGAAGCCACAAGCGGCGACAAAGACGAATACGGCAAACAATTCTGGTTATGGCATGGTAGTGTCGGTTAGCAAG
GCCAAGCCGGCGTCGACAAAGGGACCCGAGGCAGCCAAAAAGGCTCAAAAACCAGACACAAAGACTAAAGGGTCT
CAGGCTCAGAAGCATGAGGAGTCTAAAGCAAAGCCTAGACCATCACGGTCGACAAATGCAGAAAAGCCCATCAAG
GGTGCCAAGATGGAAGAGGTGAAGAATCCAGAAGCATCAACCAATAATACCGAGCCGTCAACGGCCAAGCAACCG
CACGTACCCATCAGCAAGCTGCGACCATTAACACTCAAGAAAGAAGAGACATTTAGTCTGGCAGCGCCCAAGAAA
CCGGAAACTTCTAGCCAGGAAGCCAAGTCAAGTAGCGACTGCTACCAGGACCCAGTCTTGGCAGCCAGTAACACC
ATCTTTGTCGACTTTTACAACCAAGGCCTCGGCTTCGAGTTGGACAGTGCCAAGGTCAACTTTGAAAGGTCAAAA
CTCAACTTCCACGGCTGTCTCATCATCATCACCTTGGGCCGCTGCTGA
Transcript >OphauG2|6129
ATGGCTGTTCAGTTGGCTAGCACTGGTGCCTATGGCGCTTTTAACGGGTACTGGAGCTCTTCTTCTGGGCCGCAT
CTTGGATCCTACTGTGACAGCGGTATTCAGTCTGCTACCTTGGATCTTGTTCGTATACTACGGACAGGTCCCTCC
ACCTTTACTTTGTCCAGTGACTGCTGGTCTGAAGGCATTTTGGGCAGTAACAGCAGCGCTGGGCAGCTAACTAGC
CCGTGCTTATCGCTCAAGGATGATATTGCTTACTGCCAGTCCAAGAATATTCAGATTCTCGTGAGCGTCACTCTT
GGCAACGATCAACTTTATGGCGCTGCTGGACAAGACTTGGCCGACTTGATATACAGTAGCTTTGGGATCTATGAC
GATGGCTGGAATCAGGCCCGTCTCTTTGGCCAAGATGTTGCCGTCGATGGCTTCAACTTTGATATCTCTCCAGAC
TTTAACAGCAGCATGGTGCTGGAAATGATGAACCGGCTTCGGGAATTGGATGACAGGCTGCTCATCGCAGGTACA
TCTTCATGTCCTCTTGACTCTGACAATGACAAGAACACGGCTACGGTTAAGCACCTGGATGCTTTGTTTCTTCAT
TACCCCGAGAGTTCCACCTGTGTAGGGACAGACAGCGCGAATCTGGACAATAATTTGGCGGCTCAAAACTGGATC
CAACTTCTGACGGGGGACAAGAACACGGGCGCCAAGCTATTCATTAGTCTCCCAGTCTCTCCTTGGGCAGTGGAA
GCTGGCACTCCTCTGACTGCCAAGGATGCCTCGAATATCATGTGCAAGGTCAAAGACGACGCCAACTTTGGCGGT
GTCTCTTTGTGGGATGATGGAAAGGCTACGAGTAATGAATATGGCGACCGCGTGTTCCATGAGCAGGTTTTGGCC
ACGAGCAACCAACCATGCACTTCTGGAACCGGGTCTCTTGATGGCCAGTCGATCAAGGCAGGAAGCCCGTCTTCT
CACGCTCTGAAGAGTGCAAAACTCATGCAGCGACAAGTCCAGCAAGAGCCGCCCGAGTCTGAAGGATGGAATCTC
GCTCAAGGATCAACGCCCGAGAATCAAATATGGGAAGCACCTTCAGCAACTGTGCGGTCTTGTCCGCCGGGAGGC
GCCATCTGCTCCCAGAAGCGACGTGTTGAATACCGCTTTGTTACTTACTTTGTTCCTTGTAGAAAGGATCAAAAG
AATGCGCGACCGCGAAGAGAGACGGTGACACTGGGGCGACGACAGTCGTTGGAAGAGGAACTCGATCAACGAATC
AAGGAGAGCCTGGACACAGCAAGAAGCGAATACCTGCGCCTCTTTGAGGAGCGAAGACAGCGGCAGATTGCGACT
TGGAAAAACAGGCTGCAGCGAGAGGCGTTTCCAGCAGAGATTGAGGAGCAGAACTCGCTCATGAAGAAGTCTGAC
GACGTTGAAATGTACAGGTTGATGGAGAATTATAAAAGGGAACTGGATCTATGGAAGACACGGACACTGGAGGAG
GTTGCGCGACAGGAACAGGAACTGAAGAATAAGCGACCCGCAACAAGGCCCAATTTGCAGCCGGTTCAGGAAACG
ACACAAGCGATAGGCTCGTCATGGCGTGCTCAGAAAACAACCTCGGTGAAACAACAGCAACAGCAACAGCAACAG
CAACAGCAACAACAACAGCAAAAGCAACAACAACAGCAGCAGCAACAACAACAGCAACAGCAAAAACAAGCAAAA
AAGGACTTTGGGGTGAACAAGAGCTCCAGTAAAAAGCCAGAGGCTGCTGCTACACTGAAACCAGCGTCGGTCGCT
GGGAAGCCACAAGCGGCGACAAAGACGAATACGGCAAACAATTCTGGTTATGGCATGGTAGTGTCGGTTAGCAAG
GCCAAGCCGGCGTCGACAAAGGGACCCGAGGCAGCCAAAAAGGCTCAAAAACCAGACACAAAGACTAAAGGGTCT
CAGGCTCAGAAGCATGAGGAGTCTAAAGCAAAGCCTAGACCATCACGGTCGACAAATGCAGAAAAGCCCATCAAG
GGTGCCAAGATGGAAGAGGTGAAGAATCCAGAAGCATCAACCAATAATACCGAGCCGTCAACGGCCAAGCAACCG
CACGTACCCATCAGCAAGCTGCGACCATTAACACTCAAGAAAGAAGAGACATTTAGTCTGGCAGCGCCCAAGAAA
CCGGAAACTTCTAGCCAGGAAGCCAAGTCAAGTAGCGACTGCTACCAGGACCCAGTCTTGGCAGCCAGTAACACC
ATCTTTGTCGACTTTTACAACCAAGGCCTCGGCTTCGAGTTGGACAGTGCCAAGGTCAACTTTGAAAGGTCAAAA
CTCAACTTCCACGGCTGTCTCATCATCATCACCTTGGGCCGCTGCTGA
Gene >OphauG2|6129
ATGGCTGTTCAGTTGGCTAGCACTGGTGCCTATGGCGCTTTTAACGGGTACTGGGTAAGTCGTTGAACAAGGCCG
AGCTGCTAACCAAACACTAACAGTTGCCTCTAGAGCTCTTCTTCTGGGCCGCATCTTGGATCCTACTGTGACAGC
GGTATTCAGTCTGCTACCTTGGATCTTGTTCGTATACTACGGACAGGTCCCTCCACCTTTACTTTGTCCAGTGAC
TGCTGGTCTGAAGGCATTTTGGGCAGTAACAGCAGCGCTGGGCAGCTAACTAGCCCGTGCTTATCGCTCAAGGAT
GATATTGCTTACTGCCAGTCCAAGAATATTCAGATTCTCGTGAGCGTCACTCTTGGCAACGATCAACTTTATGGC
GCTGCTGGACAAGACTTGGCCGACTTGATATACAGTAGCTTTGGGATCTATGACGATGGCTGGAATCAGGCCCGT
CTCTTTGGCCAAGATGTTGCCGTCGATGGCTTCAACTTTGATATCTCTCCAGACTTTAGTAAGCCGTATTGACAC
CTTGTTCAACCAACAATACTTGTGCTCACACTTATTGGCAGACAGCAGCATGGTGCTGGAAATGATGAACCGGCT
TCGGGAATTGGATGACAGGCTGCTCATCGCAGGTACATCTTCATGTCCTCTTGACTCTGACAATGACAAGAACAC
GGCTACGGTTAAGCACCTGGATGCTTTGTTTCTTCATTACCCCGAGAGTTCCACCTGTGTAGGGACAGACAGCGC
GAATCTGGACAATAATTTGGCGGCTCAAAACTGGATCCAACTTCTGACGGGGGACAAGAACACGGGCGCCAAGCT
ATTCATTAGTCTCCCAGTCTCTCCTTGGGCAGTGGAAGCTGGCACTCCTCTGACTGCCAAGGATGCCTCGAATAT
CATGTGCAAGGTCAAAGACGACGCCAACTTTGGCGGTGTCTCTTTGTGGGATGATGGAAAGGCTACGAGTAATGA
ATATGGCGACCGCGTGTTCCATGAGCAGGTTTTGGCCACGAGCAACCAACCATGCACTTCTGGAACCGGGTCTCT
TGATGGCCAGTCGATCAAGGCAGGAAGCCCGTCTTCTCACGCTCTGAAGAGTGCAAAACTCATGCAGCGACAAGT
CCAGCAAGAGCCGCCCGAGTCTGAAGGATGGAATCTCGCTCAAGGATCAACGCCCGAGAATCAAATATGGGAAGC
ACCTTCAGCAACTGTGCGGTCTTGTCCGCCGGGAGGCGCCATCTGCTCCCAGAAGCGACGTGTTGAATACCGCTT
TGTTACTTACTTTGTTCCTTGTAGAAAGGATCAAAAGAATGCGCGACCGCGAAGAGAGACGGTGACACTGGGGCG
ACGACAGTCGTTGGAAGAGGAACTCGATCAACGAATCAAGGAGAGCCTGGACACAGCAAGAAGCGAATACCTGCG
CCTCTTTGAGGAGCGAAGACAGCGGCAGATTGCGACTTGGAAAAACAGGCTGCAGCGAGAGGCGTTTCCAGCAGA
GATTGAGGAGCAGAACTCGCTCATGAAGAAGTCTGACGACGTTGAAATGTACAGGTTGATGGAGAATTATAAAAG
GGAACTGGATCTATGGAAGACACGGACACTGGAGGAGGTTGCGCGACAGGAACAGGAACTGAAGAATAAGCGACC
CGCAACAAGGCCCAATTTGCAGCCGGTTCAGGAAACGACACAAGCGATAGGCTCGTCATGGCGTGCTCAGAAAAC
AACCTCGGTGAAACAACAGCAACAGCAACAGCAACAGCAACAGCAACAACAACAGCAAAAGCAACAACAACAGCA
GCAGCAACAACAACAGCAACAGCAAAAACAAGCAAAAAAGGACTTTGGGGTGAACAAGAGCTCCAGTAAAAAGCC
AGAGGCTGCTGCTACACTGAAACCAGCGTCGGTCGCTGGGAAGCCACAAGCGGCGACAAAGACGAATACGGCAAA
CAATTCTGGTTATGGCATGGTAGTGTCGGTTAGCAAGGCCAAGCCGGCGTCGACAAAGGGACCCGAGGCAGCCAA
AAAGGCTCAAAAACCAGACACAAAGACTAAAGGGTCTCAGGCTCAGAAGCATGAGGAGTCTAAAGCAAAGCCTAG
ACCATCACGGTCGACAAATGCAGAAAAGCCCATCAAGGGTGCCAAGATGGAAGAGGTGAAGAATCCAGAAGCATC
AACCAATAATACCGAGCCGTCAACGGCCAAGCAACCGCACGTACCCATCAGCAAGCTGCGACCATTAACACTCAA
GAAAGAAGAGACATTTAGTCTGGCAGCGCCCAAGAAACCGGAAACTTCTAGCCAGGAAGCCAAGTCGTCATCATC
CGGAAAAGCAGAGACGTCTAGCACCAAGCCCGAGTCATGGAAATGGACAGAAGTAGCGACTGCTACCAGGACCCA
GTCTTGGCAGCCAGTAACACCATCTTTGTCGACTTTTACAACCAAGGCCTCGGCTTCGAGTTGGACAGTGCCAAG
GTCAACTTTGAAAGGTCAAAACTCAACTTCCACGGCTGTCTCATCATCATCACCTTGGGCCGCTGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail