Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6119
Gene name
LocationContig_601:8524..9085
Strand-
Gene length (bp)561
Transcript length (bp)495
Coding sequence length (bp)495
Protein length (aa) 165

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04099 Sybindin Sybindin-like family 6.5E-52 16 160
PF04628 Sedlin_N Sedlin, N-terminal conserved region 2.5E-07 87 156

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43041|TRS23_SCHPO Transport protein particle subunit trs23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trs23 PE=3 SV=1 16 158 2.0E-39
sp|Q54UU1|TPPC4_DICDI Trafficking protein particle complex subunit 4 OS=Dictyostelium discoideum GN=trappc4 PE=3 SV=1 13 154 1.0E-37
sp|Q69BT7|TPPC4_RAT Trafficking protein particle complex subunit 4 OS=Rattus norvegicus GN=Trappc4 PE=2 SV=1 39 154 4.0E-32
sp|Q9ES56|TPPC4_MOUSE Trafficking protein particle complex subunit 4 OS=Mus musculus GN=Trappc4 PE=1 SV=1 39 154 4.0E-32
sp|Q2TBL9|TPPC4_BOVIN Trafficking protein particle complex subunit 4 OS=Bos taurus GN=TRAPPC4 PE=2 SV=1 39 154 4.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43041|TRS23_SCHPO Transport protein particle subunit trs23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trs23 PE=3 SV=1 16 158 2.0E-39
sp|Q54UU1|TPPC4_DICDI Trafficking protein particle complex subunit 4 OS=Dictyostelium discoideum GN=trappc4 PE=3 SV=1 13 154 1.0E-37
sp|Q69BT7|TPPC4_RAT Trafficking protein particle complex subunit 4 OS=Rattus norvegicus GN=Trappc4 PE=2 SV=1 39 154 4.0E-32
sp|Q9ES56|TPPC4_MOUSE Trafficking protein particle complex subunit 4 OS=Mus musculus GN=Trappc4 PE=1 SV=1 39 154 4.0E-32
sp|Q2TBL9|TPPC4_BOVIN Trafficking protein particle complex subunit 4 OS=Bos taurus GN=TRAPPC4 PE=2 SV=1 39 154 4.0E-32
sp|Q5R9J9|TPPC4_PONAB Trafficking protein particle complex subunit 4 OS=Pongo abelii GN=TRAPPC4 PE=2 SV=1 39 154 1.0E-31
sp|Q9Y296|TPPC4_HUMAN Trafficking protein particle complex subunit 4 OS=Homo sapiens GN=TRAPPC4 PE=1 SV=1 39 154 1.0E-31
sp|Q03784|TRS23_YEAST Trafficking protein particle complex subunit 23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRS23 PE=1 SV=1 14 161 6.0E-20
sp|Q557G3|TPPC1_DICDI Trafficking protein particle complex subunit 1 OS=Dictyostelium discoideum GN=trappc1-1 PE=3 SV=1 14 161 8.0E-10
sp|Q2KMM2|TPPC1_RAT Trafficking protein particle complex subunit 1 OS=Rattus norvegicus GN=Trappc1 PE=2 SV=1 13 161 1.0E-06
sp|Q5NCF2|TPPC1_MOUSE Trafficking protein particle complex subunit 1 OS=Mus musculus GN=Trappc1 PE=1 SV=1 13 161 1.0E-06
sp|Q9Y5R8|TPPC1_HUMAN Trafficking protein particle complex subunit 1 OS=Homo sapiens GN=TRAPPC1 PE=1 SV=1 13 161 3.0E-06
sp|Q17QI1|TPPC1_BOVIN Trafficking protein particle complex subunit 1 OS=Bos taurus GN=TRAPPC1 PE=2 SV=1 13 161 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Yes
GO:0030008 TRAPP complex Yes
GO:0016192 vesicle-mediated transport Yes
GO:0051234 establishment of localization No
GO:0051649 establishment of localization in cell No
GO:0051641 cellular localization No
GO:0051179 localization No
GO:0006810 transport No
GO:0032991 protein-containing complex No
GO:0008150 biological_process No
GO:0099023 vesicle tethering complex No
GO:0046907 intracellular transport No
GO:0140535 intracellular protein-containing complex No
GO:0005575 cellular_component No
GO:0009987 cellular process No
GO:0048193 Golgi vesicle transport No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4968
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6119 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2645
Ophiocordyceps camponoti-floridani Ophcf2|07320
Ophiocordyceps camponoti-rufipedis Ophun1|4438
Ophiocordyceps kimflemingae Ophio5|8363
Ophiocordyceps subramaniannii Hirsu2|2058

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6119
MATATQHVLVDRTVLALIVINKAGGLVYNRLFHEGSLNKLSTNDYLVLAGTFHGVHAITARLNPVKPLGPAAPAT
MPSRPEPSSGLEVLETENFRLQCFNTMTGTKFLLFTDTAQANVDLTLRRIYDLYADYVMKNPFYSLEMPIRCDLF
DKKLLSYIREINNR*
Coding >OphauG2|6119
ATGGCCACTGCCACTCAGCACGTCCTTGTCGATAGGACCGTCCTGGCTCTCATTGTCATCAACAAGGCCGGCGGC
TTGGTCTACAACCGTCTCTTCCACGAAGGCAGCCTCAACAAACTCAGCACAAACGACTATCTCGTCCTCGCCGGC
ACCTTTCACGGCGTCCACGCCATCACGGCCCGCCTCAATCCTGTCAAGCCTCTTGGGCCTGCCGCTCCCGCCACT
ATGCCCAGCAGACCAGAGCCGTCGTCAGGACTCGAAGTGCTCGAGACGGAAAACTTTCGCCTGCAGTGCTTCAAC
ACCATGACGGGCACCAAGTTCCTCCTCTTCACCGACACGGCCCAGGCCAATGTTGACCTGACGCTCAGGAGAATC
TACGATCTTTATGCCGACTACGTCATGAAGAATCCCTTCTACTCCCTCGAAATGCCTATTCGCTGTGACCTCTTT
GACAAGAAGCTCCTCTCCTACATTAGAGAAATCAACAACCGATAA
Transcript >OphauG2|6119
ATGGCCACTGCCACTCAGCACGTCCTTGTCGATAGGACCGTCCTGGCTCTCATTGTCATCAACAAGGCCGGCGGC
TTGGTCTACAACCGTCTCTTCCACGAAGGCAGCCTCAACAAACTCAGCACAAACGACTATCTCGTCCTCGCCGGC
ACCTTTCACGGCGTCCACGCCATCACGGCCCGCCTCAATCCTGTCAAGCCTCTTGGGCCTGCCGCTCCCGCCACT
ATGCCCAGCAGACCAGAGCCGTCGTCAGGACTCGAAGTGCTCGAGACGGAAAACTTTCGCCTGCAGTGCTTCAAC
ACCATGACGGGCACCAAGTTCCTCCTCTTCACCGACACGGCCCAGGCCAATGTTGACCTGACGCTCAGGAGAATC
TACGATCTTTATGCCGACTACGTCATGAAGAATCCCTTCTACTCCCTCGAAATGCCTATTCGCTGTGACCTCTTT
GACAAGAAGCTCCTCTCCTACATTAGAGAAATCAACAACCGATAA
Gene >OphauG2|6119
ATGGCCACTGCCACTCAGCACGTCCTTGTCGATAGGACCGTCCTGGCTCTCATTGTCATCAACAAGGCCGGCGGC
TTGGTCTACAACCGTCTCTTCCACGAAGGCAGCCTCAACAAACTCAGCACAAACGACTATCTCGTCCTCGCCGGC
ACCTTTCACGGGTACGCACCCATCATGTCTTGTCCCCCGTGTCCGCCGCGCACAGCTATAGACGCTCATTGACAC
AGCGTCCACGCCATCACGGCCCGCCTCAATCCTGTCAAGCCTCTTGGGCCTGCCGCTCCCGCCACTATGCCCAGC
AGACCAGAGCCGTCGTCAGGACTCGAAGTGCTCGAGACGGAAAACTTTCGCCTGCAGTGCTTCAACACCATGACG
GGCACCAAGTTCCTCCTCTTCACCGACACGGCCCAGGCCAATGTTGACCTGACGCTCAGGAGAATCTACGATCTT
TATGCCGACTACGTCATGAAGAATCCCTTCTACTCCCTCGAAATGCCTATTCGCTGTGACCTCTTTGACAAGAAG
CTCCTCTCCTACATTAGAGAAATCAACAACCGATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail