Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6113
Gene name
LocationContig_600:9650..11144
Strand-
Gene length (bp)1494
Transcript length (bp)1494
Coding sequence length (bp)1494
Protein length (aa) 498

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05148 Methyltransf_8 Hypothetical methyltransferase 4.3E-56 146 342
PF08241 Methyltransf_11 Methyltransferase domain 3.9E-05 248 330

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10257|RRP8_SCHPO 25S rRNA (adenine(645)-N(1))-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp8 PE=3 SV=1 142 338 4.0E-57
sp|P38961|RRP8_YEAST 25S rRNA (adenine(645)-N(1))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP8 PE=1 SV=2 138 354 2.0E-54
sp|Q9DB85|RRP8_MOUSE Ribosomal RNA-processing protein 8 OS=Mus musculus GN=Rrp8 PE=1 SV=1 146 343 1.0E-41
sp|O43159|RRP8_HUMAN Ribosomal RNA-processing protein 8 OS=Homo sapiens GN=RRP8 PE=1 SV=2 134 343 5.0E-41
sp|Q54CP1|RRP8_DICDI Ribosomal RNA-processing protein 8 OS=Dictyostelium discoideum GN=rrp8 PE=3 SV=1 142 343 1.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10257|RRP8_SCHPO 25S rRNA (adenine(645)-N(1))-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp8 PE=3 SV=1 142 338 4.0E-57
sp|P38961|RRP8_YEAST 25S rRNA (adenine(645)-N(1))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP8 PE=1 SV=2 138 354 2.0E-54
sp|Q9DB85|RRP8_MOUSE Ribosomal RNA-processing protein 8 OS=Mus musculus GN=Rrp8 PE=1 SV=1 146 343 1.0E-41
sp|O43159|RRP8_HUMAN Ribosomal RNA-processing protein 8 OS=Homo sapiens GN=RRP8 PE=1 SV=2 134 343 5.0E-41
sp|Q54CP1|RRP8_DICDI Ribosomal RNA-processing protein 8 OS=Dictyostelium discoideum GN=rrp8 PE=3 SV=1 142 343 1.0E-40
sp|Q84JC0|RRP8_ARATH Ribosomal RNA-processing protein 8 OS=Arabidopsis thaliana GN=At5g40530 PE=2 SV=1 96 340 2.0E-40
sp|Q5U4F0|RRP8_RAT Ribosomal RNA-processing protein 8 OS=Rattus norvegicus GN=Rrp8 PE=1 SV=1 146 343 5.0E-40
sp|O44410|RRP8_CAEEL Ribosomal RNA-processing protein 8 OS=Caenorhabditis elegans GN=T07A9.8 PE=3 SV=1 148 342 3.0E-32
sp|A8XI07|RRP8_CAEBR Ribosomal RNA-processing protein 8 OS=Caenorhabditis briggsae GN=CBG13492 PE=3 SV=1 139 342 8.0E-32
sp|Q7K2B0|RRP8_DROME Ribosomal RNA-processing protein 8 OS=Drosophila melanogaster GN=CG7137 PE=1 SV=1 146 342 8.0E-28
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1529
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6113 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3548
Ophiocordyceps camponoti-floridani Ophcf2|04169
Ophiocordyceps camponoti-rufipedis Ophun1|1229
Ophiocordyceps kimflemingae Ophio5|6248
Ophiocordyceps subramaniannii Hirsu2|1122

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6113
MFAVPGWSVSADSLKVEQEASTSHTSTGTKSRKRKRITEQQVTGSNVVDLYESVIETRRESKDLKTKKRKTNVER
DPNHESKGTSQVGHKNKLGTDTTRRDPVKRKSTKDRDGEQQSRESVVIKNKRLSSPNNSPLPPNSAKLTPLQASM
RDKLISARFRHLNEMLYTRPSPEALRLFQESPDMFNEYHEGFRRQVRIWPENPVDCFLADIRARAKIRTFHGPGK
KGNKTHLSTNPLPRTAGTCIIADLGCGDARLAEALQTHRAKLKLEIKSYDLQSPNSFVTKADIANLPLEDASVNV
AIFCLALMGTNWLEFIDEAHRILRWKGELWVAEIKSRFHPVRSRGTSNNSKLKGPVDHCVSSNTKDRGKKPKSTS
RNLGNVDVDDDAMHAQYLAIEVDGVEDRRRETDVSAFVEALCKRGFVLDCEYKEAVDLSNRMFVKMHFKKTDISS
KRKNVESRAPSPKDRKRLATEHRDYDTGTAGELDEASLLKPCVYKIR*
Coding >OphauG2|6113
ATGTTTGCTGTTCCAGGCTGGTCGGTATCTGCTGATAGCCTCAAGGTCGAACAAGAAGCATCCACAAGCCATACT
TCTACAGGCACAAAGTCCAGAAAGCGCAAGAGGATCACCGAACAGCAGGTTACAGGGTCTAATGTCGTTGACCTT
TACGAGTCGGTCATTGAAACTCGACGAGAATCGAAAGATCTCAAGACAAAAAAGAGGAAAACGAATGTTGAAAGA
GACCCCAACCACGAAAGCAAGGGCACGAGTCAGGTTGGCCACAAAAACAAACTCGGAACCGACACAACCAGAAGA
GACCCCGTAAAACGGAAATCCACCAAGGATAGAGATGGCGAGCAACAGTCCCGGGAAAGCGTTGTTATCAAAAAT
AAGAGGCTGTCGAGTCCAAATAATAGCCCTCTGCCACCCAATTCCGCCAAGCTTACGCCGTTGCAAGCCTCGATG
AGGGACAAGCTGATTTCGGCGCGCTTCCGGCACCTTAATGAGATGTTATATACACGTCCCTCACCTGAGGCACTC
CGGCTCTTTCAAGAATCTCCGGACATGTTTAACGAGTACCACGAGGGTTTTCGCCGGCAGGTCAGGATCTGGCCT
GAAAATCCCGTTGACTGTTTCTTGGCCGATATTCGTGCGCGGGCAAAAATAAGAACTTTTCACGGTCCAGGCAAA
AAAGGCAACAAGACTCATCTCTCGACAAACCCTCTTCCCCGGACCGCTGGAACATGCATCATTGCCGACTTGGGC
TGCGGCGACGCCCGTTTGGCCGAGGCACTGCAGACTCACAGGGCCAAGCTTAAGCTAGAGATCAAAAGCTACGAC
TTGCAGAGCCCTAATTCCTTTGTCACCAAGGCTGATATTGCCAACCTACCGCTCGAGGACGCTTCGGTCAATGTG
GCCATCTTCTGCCTCGCTCTTATGGGCACCAACTGGCTCGAGTTTATTGATGAAGCACATCGTATCCTCCGTTGG
AAAGGTGAATTGTGGGTTGCCGAAATCAAGAGCCGTTTCCACCCTGTACGCAGCCGCGGCACCAGCAACAATAGT
AAGCTCAAGGGACCAGTGGACCATTGCGTCAGCAGCAACACGAAAGATAGGGGTAAGAAGCCCAAGTCGACAAGC
CGCAATCTGGGCAATGTCGACGTTGATGATGACGCTATGCATGCCCAATATCTGGCCATAGAGGTCGACGGCGTT
GAAGATCGACGGCGTGAGACAGATGTCTCAGCCTTCGTCGAGGCTTTGTGCAAGAGAGGCTTTGTACTGGATTGT
GAGTACAAAGAAGCAGTCGATCTCTCTAATCGAATGTTTGTCAAGATGCATTTCAAAAAAACAGATATTTCATCA
AAGCGAAAGAATGTCGAGTCACGAGCGCCATCTCCAAAAGACCGCAAAAGATTGGCTACTGAGCACCGAGATTAC
GATACTGGAACGGCGGGGGAATTGGACGAGGCTTCGTTGCTAAAACCATGCGTCTATAAAATTCGTTGA
Transcript >OphauG2|6113
ATGTTTGCTGTTCCAGGCTGGTCGGTATCTGCTGATAGCCTCAAGGTCGAACAAGAAGCATCCACAAGCCATACT
TCTACAGGCACAAAGTCCAGAAAGCGCAAGAGGATCACCGAACAGCAGGTTACAGGGTCTAATGTCGTTGACCTT
TACGAGTCGGTCATTGAAACTCGACGAGAATCGAAAGATCTCAAGACAAAAAAGAGGAAAACGAATGTTGAAAGA
GACCCCAACCACGAAAGCAAGGGCACGAGTCAGGTTGGCCACAAAAACAAACTCGGAACCGACACAACCAGAAGA
GACCCCGTAAAACGGAAATCCACCAAGGATAGAGATGGCGAGCAACAGTCCCGGGAAAGCGTTGTTATCAAAAAT
AAGAGGCTGTCGAGTCCAAATAATAGCCCTCTGCCACCCAATTCCGCCAAGCTTACGCCGTTGCAAGCCTCGATG
AGGGACAAGCTGATTTCGGCGCGCTTCCGGCACCTTAATGAGATGTTATATACACGTCCCTCACCTGAGGCACTC
CGGCTCTTTCAAGAATCTCCGGACATGTTTAACGAGTACCACGAGGGTTTTCGCCGGCAGGTCAGGATCTGGCCT
GAAAATCCCGTTGACTGTTTCTTGGCCGATATTCGTGCGCGGGCAAAAATAAGAACTTTTCACGGTCCAGGCAAA
AAAGGCAACAAGACTCATCTCTCGACAAACCCTCTTCCCCGGACCGCTGGAACATGCATCATTGCCGACTTGGGC
TGCGGCGACGCCCGTTTGGCCGAGGCACTGCAGACTCACAGGGCCAAGCTTAAGCTAGAGATCAAAAGCTACGAC
TTGCAGAGCCCTAATTCCTTTGTCACCAAGGCTGATATTGCCAACCTACCGCTCGAGGACGCTTCGGTCAATGTG
GCCATCTTCTGCCTCGCTCTTATGGGCACCAACTGGCTCGAGTTTATTGATGAAGCACATCGTATCCTCCGTTGG
AAAGGTGAATTGTGGGTTGCCGAAATCAAGAGCCGTTTCCACCCTGTACGCAGCCGCGGCACCAGCAACAATAGT
AAGCTCAAGGGACCAGTGGACCATTGCGTCAGCAGCAACACGAAAGATAGGGGTAAGAAGCCCAAGTCGACAAGC
CGCAATCTGGGCAATGTCGACGTTGATGATGACGCTATGCATGCCCAATATCTGGCCATAGAGGTCGACGGCGTT
GAAGATCGACGGCGTGAGACAGATGTCTCAGCCTTCGTCGAGGCTTTGTGCAAGAGAGGCTTTGTACTGGATTGT
GAGTACAAAGAAGCAGTCGATCTCTCTAATCGAATGTTTGTCAAGATGCATTTCAAAAAAACAGATATTTCATCA
AAGCGAAAGAATGTCGAGTCACGAGCGCCATCTCCAAAAGACCGCAAAAGATTGGCTACTGAGCACCGAGATTAC
GATACTGGAACGGCGGGGGAATTGGACGAGGCTTCGTTGCTAAAACCATGCGTCTATAAAATTCGTTGA
Gene >OphauG2|6113
ATGTTTGCTGTTCCAGGCTGGTCGGTATCTGCTGATAGCCTCAAGGTCGAACAAGAAGCATCCACAAGCCATACT
TCTACAGGCACAAAGTCCAGAAAGCGCAAGAGGATCACCGAACAGCAGGTTACAGGGTCTAATGTCGTTGACCTT
TACGAGTCGGTCATTGAAACTCGACGAGAATCGAAAGATCTCAAGACAAAAAAGAGGAAAACGAATGTTGAAAGA
GACCCCAACCACGAAAGCAAGGGCACGAGTCAGGTTGGCCACAAAAACAAACTCGGAACCGACACAACCAGAAGA
GACCCCGTAAAACGGAAATCCACCAAGGATAGAGATGGCGAGCAACAGTCCCGGGAAAGCGTTGTTATCAAAAAT
AAGAGGCTGTCGAGTCCAAATAATAGCCCTCTGCCACCCAATTCCGCCAAGCTTACGCCGTTGCAAGCCTCGATG
AGGGACAAGCTGATTTCGGCGCGCTTCCGGCACCTTAATGAGATGTTATATACACGTCCCTCACCTGAGGCACTC
CGGCTCTTTCAAGAATCTCCGGACATGTTTAACGAGTACCACGAGGGTTTTCGCCGGCAGGTCAGGATCTGGCCT
GAAAATCCCGTTGACTGTTTCTTGGCCGATATTCGTGCGCGGGCAAAAATAAGAACTTTTCACGGTCCAGGCAAA
AAAGGCAACAAGACTCATCTCTCGACAAACCCTCTTCCCCGGACCGCTGGAACATGCATCATTGCCGACTTGGGC
TGCGGCGACGCCCGTTTGGCCGAGGCACTGCAGACTCACAGGGCCAAGCTTAAGCTAGAGATCAAAAGCTACGAC
TTGCAGAGCCCTAATTCCTTTGTCACCAAGGCTGATATTGCCAACCTACCGCTCGAGGACGCTTCGGTCAATGTG
GCCATCTTCTGCCTCGCTCTTATGGGCACCAACTGGCTCGAGTTTATTGATGAAGCACATCGTATCCTCCGTTGG
AAAGGTGAATTGTGGGTTGCCGAAATCAAGAGCCGTTTCCACCCTGTACGCAGCCGCGGCACCAGCAACAATAGT
AAGCTCAAGGGACCAGTGGACCATTGCGTCAGCAGCAACACGAAAGATAGGGGTAAGAAGCCCAAGTCGACAAGC
CGCAATCTGGGCAATGTCGACGTTGATGATGACGCTATGCATGCCCAATATCTGGCCATAGAGGTCGACGGCGTT
GAAGATCGACGGCGTGAGACAGATGTCTCAGCCTTCGTCGAGGCTTTGTGCAAGAGAGGCTTTGTACTGGATTGT
GAGTACAAAGAAGCAGTCGATCTCTCTAATCGAATGTTTGTCAAGATGCATTTCAAAAAAACAGATATTTCATCA
AAGCGAAAGAATGTCGAGTCACGAGCGCCATCTCCAAAAGACCGCAAAAGATTGGCTACTGAGCACCGAGATTAC
GATACTGGAACGGCGGGGGAATTGGACGAGGCTTCGTTGCTAAAACCATGCGTCTATAAAATTCGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail