Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6111
Gene name
LocationContig_600:3885..5944
Strand-
Gene length (bp)2059
Transcript length (bp)1908
Coding sequence length (bp)1908
Protein length (aa) 636

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17835 NOG1_N NOG1 N-terminal helical domain 3.0E-44 6 164
PF08155 NOGCT NOGCT (NUC087) domain 7.0E-26 390 443
PF06858 NOG1 Nucleolar GTP-binding protein 1 (NOG1) 8.5E-22 227 279
PF01926 MMR_HSR1 50S ribosome-binding GTPase 2.2E-11 171 277

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6FRV0|NOG1_CANGA Nucleolar GTP-binding protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NOG1 PE=3 SV=1 1 630 0.0E+00
sp|Q6CM00|NOG1_KLULA Nucleolar GTP-binding protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NOG1 PE=3 SV=1 1 630 0.0E+00
sp|Q02892|NOG1_YEAST Nucleolar GTP-binding protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOG1 PE=1 SV=1 1 630 0.0E+00
sp|O94659|NOG1_SCHPO Probable nucleolar GTP-binding protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nog1 PE=1 SV=2 4 631 0.0E+00
sp|Q74ZK6|NOG1_ASHGO Nucleolar GTP-binding protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NOG1 PE=3 SV=1 1 630 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6FRV0|NOG1_CANGA Nucleolar GTP-binding protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NOG1 PE=3 SV=1 1 630 0.0E+00
sp|Q6CM00|NOG1_KLULA Nucleolar GTP-binding protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NOG1 PE=3 SV=1 1 630 0.0E+00
sp|Q02892|NOG1_YEAST Nucleolar GTP-binding protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOG1 PE=1 SV=1 1 630 0.0E+00
sp|O94659|NOG1_SCHPO Probable nucleolar GTP-binding protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nog1 PE=1 SV=2 4 631 0.0E+00
sp|Q74ZK6|NOG1_ASHGO Nucleolar GTP-binding protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NOG1 PE=3 SV=1 1 630 0.0E+00
sp|Q9C6I8|NOG1_ARATH Nucleolar GTP-binding protein 1 OS=Arabidopsis thaliana GN=At1g50920 PE=2 SV=1 4 630 1.0E-178
sp|Q9BZE4|NOG1_HUMAN Nucleolar GTP-binding protein 1 OS=Homo sapiens GN=GTPBP4 PE=1 SV=3 4 631 3.0E-177
sp|Q99ME9|NOG1_MOUSE Nucleolar GTP-binding protein 1 OS=Mus musculus GN=Gtpbp4 PE=1 SV=3 4 631 6.0E-172
sp|Q9V411|NOG1_DROME Nucleolar GTP-binding protein 1 OS=Drosophila melanogaster GN=Non1 PE=2 SV=1 4 630 4.0E-171
sp|Q9U6A9|NOG1_TRYBB Nucleolar GTP-binding protein 1 OS=Trypanosoma brucei brucei GN=NOG1 PE=1 SV=1 5 630 2.0E-168
sp|Q99P77|NOG1_RAT Nucleolar GTP-binding protein 1 OS=Rattus norvegicus GN=Gtpbp4 PE=2 SV=3 4 631 2.0E-165
sp|O44411|NOG1_CAEEL Nucleolar GTP-binding protein 1 OS=Caenorhabditis elegans GN=nog-1 PE=1 SV=1 4 630 1.0E-151
sp|Q54N72|NOG1_DICDI Probable nucleolar GTP-binding protein 1 OS=Dictyostelium discoideum GN=nog1 PE=1 SV=1 4 630 8.0E-148
sp|Q8SVJ8|NOG1_ENCCU Nucleolar GTP-binding protein 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=NOG1 PE=3 SV=1 1 443 1.0E-122
sp|Q58803|Y1408_METJA Uncharacterized protein MJ1408 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1408 PE=3 SV=2 26 320 3.0E-35
sp|B7IGK8|OBG_THEAB GTPase Obg OS=Thermosipho africanus (strain TCF52B) GN=obg PE=3 SV=1 172 319 4.0E-08
sp|Q1IW72|OBG_DEIGD GTPase Obg OS=Deinococcus geothermalis (strain DSM 11300) GN=obg PE=3 SV=1 172 331 3.0E-06
sp|A6LJZ0|OBG_THEM4 GTPase Obg OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=obg PE=3 SV=1 172 372 4.0E-06
sp|Q054P6|OBG_LEPBL GTPase Obg OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=obg PE=3 SV=1 172 338 6.0E-06
sp|Q04Q90|OBG_LEPBJ GTPase Obg OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=obg PE=3 SV=1 172 338 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0019001 guanyl nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4121
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6111 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3550
Ophiocordyceps camponoti-floridani Ophcf2|04167
Ophiocordyceps camponoti-rufipedis Ophun1|1231
Ophiocordyceps kimflemingae Ophio5|6250
Ophiocordyceps subramaniannii Hirsu2|835

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6111
MKTTWKDIPPVPTQQEFLDIVLSRTQRKLPTQIRAGFKTSRIRAFYTRKVKFTQETFSEKFGSILESFPRLADIH
PFHKDLLNTLYDADHFRIALGQLSTAKHLIETVSRDYVRLLKHGQSLFQCKQLKRAALGRMATIVKRLKDPLLYL
DQVRQHLGRLPAIDPNTRTLLICGYPNVGKSSFLRSITRADVDVQPYAFTTKSLFVGHFDYKYLRFQAIDTPAAF
GSITAIAHLRSAILYFMDLSEQCGYSVRAQIQLFRSIKPLFANKLVFLVINKIDIARPEDMTAELQTELETLLRS
GEVELLQLSCNTQEGVQNVKNSACERLIADRVSQKLKAGTSSSGTVGGRLANVMARIHVAQPMGGQTSETFIPDG
IKSLKKYDKEDPARRQLARDVEVENGGAGVYNVDMRADYLLSSSQWKYDKIPEIFDGKNVFDFVDPDIDAKLLAL
EQEEEKLEQEGFYHSDGLDEDEEEADILHKAELIREKQQLIRNEARMKKRLKNQAIIPRKALKKPFSELEDAMDK
LGVDTTNLAKTAQPKARSRGRSLSRSRLGTSDLDAMDVDESRGRSDQMRSRGRAPTSNRRTDGVQDETMRTKAER
LAKLNQKKMNRMARQGEADRHTPASLPKHLVRTYF*
Coding >OphauG2|6111
ATGAAGACTACATGGAAGGATATCCCACCGGTGCCGACTCAGCAGGAGTTTCTCGACATTGTGCTGAGTCGAACC
CAGCGCAAGCTGCCGACGCAGATTCGCGCAGGCTTCAAGACTAGCAGAATTCGAGCTTTTTACACTCGAAAGGTC
AAATTCACACAAGAGACCTTTTCAGAAAAGTTCGGCTCCATCCTTGAGAGCTTTCCTCGCTTGGCCGACATCCAT
CCTTTTCACAAAGACTTGCTCAACACCCTCTACGATGCCGACCACTTCCGTATTGCCCTTGGACAACTATCCACA
GCCAAACACTTGATAGAGACCGTTTCTAGAGACTATGTCCGTCTTCTCAAACACGGCCAGTCTCTGTTTCAGTGC
AAGCAGCTCAAGAGGGCTGCACTCGGCCGCATGGCCACAATAGTCAAGCGCTTGAAGGATCCTCTTCTTTACCTG
GATCAAGTCCGCCAACATCTTGGTCGTTTGCCCGCAATCGATCCTAATACCCGGACTCTTCTTATATGCGGCTAC
CCAAATGTTGGTAAGTCGAGCTTCTTGCGCAGCATCACCCGAGCGGATGTCGACGTTCAACCCTATGCCTTCACC
ACCAAGAGTTTGTTTGTTGGCCATTTCGACTACAAGTATCTGCGGTTTCAAGCAATCGATACTCCTGCTGCATTC
GGTAGTATCACTGCTATTGCGCATTTACGGTCCGCCATACTCTACTTTATGGACTTGTCAGAGCAGTGTGGTTAC
TCGGTTCGGGCCCAGATCCAGCTTTTTAGAAGCATAAAACCCTTGTTCGCCAATAAACTCGTCTTTCTCGTCATC
AACAAAATCGACATCGCTCGTCCGGAAGACATGACTGCTGAGTTGCAAACTGAACTTGAAACATTGCTCAGGTCT
GGAGAGGTAGAGCTACTTCAATTGTCCTGCAACACTCAGGAGGGCGTGCAGAACGTCAAGAATTCGGCATGCGAG
CGTCTCATAGCCGACCGGGTAAGCCAGAAGTTAAAAGCAGGCACGTCGAGTAGCGGCACTGTCGGCGGTCGTCTG
GCAAATGTCATGGCTCGAATACACGTGGCTCAGCCTATGGGCGGCCAGACTAGCGAGACATTTATCCCAGACGGT
ATCAAGAGCCTGAAAAAGTACGACAAAGAAGATCCAGCACGTCGTCAATTGGCTCGTGACGTGGAAGTTGAGAAT
GGCGGCGCCGGTGTCTACAATGTGGACATGCGTGCCGATTATCTTCTCAGCAGTTCTCAGTGGAAGTACGACAAA
ATTCCGGAAATATTCGACGGCAAAAATGTTTTCGATTTTGTTGACCCTGATATTGATGCCAAGCTTCTGGCATTG
GAGCAGGAGGAGGAGAAGCTAGAACAAGAGGGGTTTTACCATTCCGATGGCTTGGACGAGGACGAAGAGGAAGCC
GATATTCTTCACAAGGCCGAACTCATACGCGAAAAGCAGCAGTTGATACGTAACGAGGCTCGGATGAAGAAGAGA
CTTAAAAACCAAGCCATTATTCCTCGCAAAGCCCTCAAGAAGCCATTTTCAGAACTTGAGGATGCAATGGATAAG
CTTGGTGTCGACACGACAAATCTGGCCAAGACGGCACAGCCCAAGGCCCGAAGTCGGGGCCGCTCTTTGTCCAGA
AGTCGCCTTGGTACCAGCGACCTCGATGCCATGGATGTTGACGAGTCTCGCGGCCGTAGCGACCAAATGCGGTCT
CGTGGTCGGGCTCCGACGTCGAACCGGCGCACCGATGGCGTGCAGGATGAGACCATGAGGACAAAGGCTGAACGC
CTGGCAAAACTGAACCAGAAGAAGATGAACAGAATGGCAAGACAGGGTGAAGCAGACAGGCACACTCCGGCCTCA
CTACCCAAGCATCTGGTAAGAACATATTTCTAG
Transcript >OphauG2|6111
ATGAAGACTACATGGAAGGATATCCCACCGGTGCCGACTCAGCAGGAGTTTCTCGACATTGTGCTGAGTCGAACC
CAGCGCAAGCTGCCGACGCAGATTCGCGCAGGCTTCAAGACTAGCAGAATTCGAGCTTTTTACACTCGAAAGGTC
AAATTCACACAAGAGACCTTTTCAGAAAAGTTCGGCTCCATCCTTGAGAGCTTTCCTCGCTTGGCCGACATCCAT
CCTTTTCACAAAGACTTGCTCAACACCCTCTACGATGCCGACCACTTCCGTATTGCCCTTGGACAACTATCCACA
GCCAAACACTTGATAGAGACCGTTTCTAGAGACTATGTCCGTCTTCTCAAACACGGCCAGTCTCTGTTTCAGTGC
AAGCAGCTCAAGAGGGCTGCACTCGGCCGCATGGCCACAATAGTCAAGCGCTTGAAGGATCCTCTTCTTTACCTG
GATCAAGTCCGCCAACATCTTGGTCGTTTGCCCGCAATCGATCCTAATACCCGGACTCTTCTTATATGCGGCTAC
CCAAATGTTGGTAAGTCGAGCTTCTTGCGCAGCATCACCCGAGCGGATGTCGACGTTCAACCCTATGCCTTCACC
ACCAAGAGTTTGTTTGTTGGCCATTTCGACTACAAGTATCTGCGGTTTCAAGCAATCGATACTCCTGCTGCATTC
GGTAGTATCACTGCTATTGCGCATTTACGGTCCGCCATACTCTACTTTATGGACTTGTCAGAGCAGTGTGGTTAC
TCGGTTCGGGCCCAGATCCAGCTTTTTAGAAGCATAAAACCCTTGTTCGCCAATAAACTCGTCTTTCTCGTCATC
AACAAAATCGACATCGCTCGTCCGGAAGACATGACTGCTGAGTTGCAAACTGAACTTGAAACATTGCTCAGGTCT
GGAGAGGTAGAGCTACTTCAATTGTCCTGCAACACTCAGGAGGGCGTGCAGAACGTCAAGAATTCGGCATGCGAG
CGTCTCATAGCCGACCGGGTAAGCCAGAAGTTAAAAGCAGGCACGTCGAGTAGCGGCACTGTCGGCGGTCGTCTG
GCAAATGTCATGGCTCGAATACACGTGGCTCAGCCTATGGGCGGCCAGACTAGCGAGACATTTATCCCAGACGGT
ATCAAGAGCCTGAAAAAGTACGACAAAGAAGATCCAGCACGTCGTCAATTGGCTCGTGACGTGGAAGTTGAGAAT
GGCGGCGCCGGTGTCTACAATGTGGACATGCGTGCCGATTATCTTCTCAGCAGTTCTCAGTGGAAGTACGACAAA
ATTCCGGAAATATTCGACGGCAAAAATGTTTTCGATTTTGTTGACCCTGATATTGATGCCAAGCTTCTGGCATTG
GAGCAGGAGGAGGAGAAGCTAGAACAAGAGGGGTTTTACCATTCCGATGGCTTGGACGAGGACGAAGAGGAAGCC
GATATTCTTCACAAGGCCGAACTCATACGCGAAAAGCAGCAGTTGATACGTAACGAGGCTCGGATGAAGAAGAGA
CTTAAAAACCAAGCCATTATTCCTCGCAAAGCCCTCAAGAAGCCATTTTCAGAACTTGAGGATGCAATGGATAAG
CTTGGTGTCGACACGACAAATCTGGCCAAGACGGCACAGCCCAAGGCCCGAAGTCGGGGCCGCTCTTTGTCCAGA
AGTCGCCTTGGTACCAGCGACCTCGATGCCATGGATGTTGACGAGTCTCGCGGCCGTAGCGACCAAATGCGGTCT
CGTGGTCGGGCTCCGACGTCGAACCGGCGCACCGATGGCGTGCAGGATGAGACCATGAGGACAAAGGCTGAACGC
CTGGCAAAACTGAACCAGAAGAAGATGAACAGAATGGCAAGACAGGGTGAAGCAGACAGGCACACTCCGGCCTCA
CTACCCAAGCATCTGGTAAGAACATATTTCTAG
Gene >OphauG2|6111
ATGAAGACTACATGGAAGGATATCCCACCGGTGCCGACTCAGCAGGAGTTTCTCGACATTGTGCTGAGTCGAACC
CAGCGCAAGCTGCCGACGCAGATTCGCGCAGGCTTCAAGACTAGCAGAATTCGAGGTAGGCGCCAAACTTCTATG
TGCCCGACTCCCTAAGCACTGACGTTGGCTGCAGCTTTTTACACTCGAAAGGTCAAATTCACACAAGAGACCTTT
TCAGAAAAGTTCGGCTCCATCCTTGAGAGCTTTCCTCGCTTGGCCGACATCCATCCTTTTCACAAAGACTTGCTC
AACACCCTCTACGATGCCGACCACTTCCGTATTGCCCTTGGACAACTATCCACAGCCAAACACTTGATAGAGACC
GTTTCTAGAGACTATGTCCGTCTTCTCAAACACGGCCAGTCTCTGTTTCAGTGCAAGCAGCTCAAGAGGGCTGCA
CTCGGCCGCATGGCCACAATAGTCAAGCGCTTGAAGGATCCTCTTCTTTACCTGGATCAAGTCCGCCAACATCTT
GGTCGTTTGCCCGCAATCGATCCTAATACCCGGACTCTTCTTATATGCGGCTACCCAAATGTTGGTAAGTCGAGC
TTCTTGCGCAGCATCACCCGAGCGGATGTCGACGTTCAACCCTATGCCTTCACCACCAAGAGTTTGTTTGTTGGC
CATTTCGACTACAAGTATCTGCGGTTTCAAGCAATCGATACTCCTGGTATTTTGGATCATCCTTTGGAAGATATG
AACACAATTGAGATGCAGAGGTACGTCTCCTAGGCTTGCCATTACTAATCTTTATGCCGTGCTAACAGCTGCATT
CGGTAGTATCACTGCTATTGCGCATTTACGGTCCGCCATACTCTACTTTATGGACTTGTCAGAGCAGTGTGGTTA
CTCGGTTCGGGCCCAGATCCAGCTTTTTAGAAGCATAAAACCCTTGTTCGCCAATAAACTCGTCTTTCTCGTCAT
CAACAAAATCGACATCGCTCGTCCGGAAGACATGACTGCTGAGTTGCAAACTGAACTTGAAACATTGCTCAGGTC
TGGAGAGGTAGAGCTACTTCAATTGTCCTGCAACACTCAGGAGGGCGTGCAGAACGTCAAGAATTCGGCATGCGA
GCGTCTCATAGCCGACCGGGTAAGCCAGAAGTTAAAAGCAGGCACGTCGAGTAGCGGCACTGTCGGCGGTCGTCT
GGCAAATGTCATGGCTCGAATACACGTGGCTCAGCCTATGGGCGGCCAGACTAGCGAGACATTTATCCCAGACGG
TATCAAGAGCCTGAAAAAGTACGACAAAGAAGATCCAGCACGTCGTCAATTGGCTCGTGACGTGGAAGTTGAGAA
TGGCGGCGCCGGTGTCTACAATGTGGACATGCGTGCCGATTATCTTCTCAGCAGTTCTCAGTGGAAGTACGACAA
AATTCCGGAAATATTCGACGGCAAAAATGTTTTCGATTTTGTTGACCCTGATATTGATGCCAAGCTTCTGGCATT
GGAGCAGGAGGAGGAGAAGCTAGAACAAGAGGGGTTTTACCATTCCGATGGCTTGGACGAGGACGAAGAGGAAGC
CGATATTCTTCACAAGGCCGAACTCATACGCGAAAAGCAGCAGTTGATACGTAACGAGGCTCGGATGAAGAAGAG
ACTTAAAAACCAAGCCATTATTCCTCGCAAAGCCCTCAAGAAGCCATTTTCAGAACTTGAGGATGCAATGGATAA
GCTTGGTGTCGACACGACAAATCTGGCCAAGACGGCACAGCCCAAGGCCCGAAGTCGGGGCCGCTCTTTGTCCAG
AAGTCGCCTTGGTACCAGCGACCTCGATGCCATGGATGTTGACGAGTCTCGCGGCCGTAGCGACCAAATGCGGTC
TCGTGGTCGGGCTCCGACGTCGAACCGGCGCACCGATGGCGTGCAGGATGAGACCATGAGGACAAAGGCTGAACG
CCTGGCAAAACTGAACCAGAAGAAGATGAACAGAATGGCAAGACAGGGTGAAGCAGACAGGCACACTCCGGCCTC
ACTACCCAAGCATCTGGTAAGAACATATTTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail