Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6108
Gene name
LocationContig_60:36736..39115
Strand-
Gene length (bp)2379
Transcript length (bp)2379
Coding sequence length (bp)2379
Protein length (aa) 793

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain 2.7E-79 107 299
PF02844 GARS_N Phosphoribosylglycinamide synthetase, N domain 3.0E-35 5 106
PF02769 AIRS_C AIR synthase related protein, C-terminal domain 2.1E-31 609 776
PF02843 GARS_C Phosphoribosylglycinamide synthetase, C domain 7.6E-25 337 426
PF00586 AIRS AIR synthase related protein, N-terminal domain 4.7E-17 492 595

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q99148|PUR2_YARLI Bifunctional purine biosynthetic protein ADE1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ADE1 PE=3 SV=1 4 790 0.0E+00
sp|P20772|PUR2_SCHPO Bifunctional purine biosynthetic protein ADE1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ade1 PE=3 SV=1 1 791 0.0E+00
sp|P07244|PUR2_YEAST Bifunctional purine biosynthetic protein ADE5,7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE5,7 PE=1 SV=1 4 784 0.0E+00
sp|Q54GJ2|PUR2_DICDI Bifunctional purine biosynthetic protein purD OS=Dictyostelium discoideum GN=purD PE=1 SV=1 5 774 0.0E+00
sp|P22102|PUR2_HUMAN Trifunctional purine biosynthetic protein adenosine-3 OS=Homo sapiens GN=GART PE=1 SV=1 5 778 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q99148|PUR2_YARLI Bifunctional purine biosynthetic protein ADE1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ADE1 PE=3 SV=1 4 790 0.0E+00
sp|P20772|PUR2_SCHPO Bifunctional purine biosynthetic protein ADE1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ade1 PE=3 SV=1 1 791 0.0E+00
sp|P07244|PUR2_YEAST Bifunctional purine biosynthetic protein ADE5,7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE5,7 PE=1 SV=1 4 784 0.0E+00
sp|Q54GJ2|PUR2_DICDI Bifunctional purine biosynthetic protein purD OS=Dictyostelium discoideum GN=purD PE=1 SV=1 5 774 0.0E+00
sp|P22102|PUR2_HUMAN Trifunctional purine biosynthetic protein adenosine-3 OS=Homo sapiens GN=GART PE=1 SV=1 5 778 0.0E+00
sp|P21872|PUR2_CHICK Trifunctional purine biosynthetic protein adenosine-3 OS=Gallus gallus GN=GART PE=2 SV=1 5 787 0.0E+00
sp|Q59A32|PUR2_BOVIN Trifunctional purine biosynthetic protein adenosine-3 OS=Bos taurus GN=GART PE=2 SV=1 5 773 0.0E+00
sp|Q64737|PUR2_MOUSE Trifunctional purine biosynthetic protein adenosine-3 OS=Mus musculus GN=Gart PE=1 SV=3 5 773 0.0E+00
sp|Q26255|PUR2_CHITE Trifunctional purine biosynthetic protein adenosine-3 OS=Chironomus tentans GN=GART PE=3 SV=1 1 746 0.0E+00
sp|P00967|PUR2_DROME Trifunctional purine biosynthetic protein adenosine-3 OS=Drosophila melanogaster GN=ade3 PE=1 SV=2 1 746 8.0E-177
sp|P16340|PUR2_DROPS Trifunctional purine biosynthetic protein adenosine-3 OS=Drosophila pseudoobscura pseudoobscura GN=ade3 PE=3 SV=2 1 748 1.0E-173
sp|Q9KV81|PUR2_VIBCH Phosphoribosylamine--glycine ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=purD PE=3 SV=1 4 433 9.0E-126
sp|Q87KS8|PUR2_VIBPA Phosphoribosylamine--glycine ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=purD PE=3 SV=1 4 433 5.0E-121
sp|Q7MGT4|PUR2_VIBVY Phosphoribosylamine--glycine ligase OS=Vibrio vulnificus (strain YJ016) GN=purD PE=3 SV=2 4 433 5.0E-120
sp|A7HYF2|PUR5_PARL1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=purM PE=3 SV=1 437 786 6.0E-120
sp|Q8YGB9|PUR5_BRUME Phosphoribosylformylglycinamidine cyclo-ligase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=purM PE=3 SV=1 429 776 6.0E-120
sp|C0RI52|PUR5_BRUMB Phosphoribosylformylglycinamidine cyclo-ligase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=purM PE=3 SV=1 429 776 6.0E-120
sp|Q8DD07|PUR2_VIBVU Phosphoribosylamine--glycine ligase OS=Vibrio vulnificus (strain CMCP6) GN=purD PE=3 SV=1 4 433 1.0E-119
sp|O66949|PUR2_AQUAE Phosphoribosylamine--glycine ligase OS=Aquifex aeolicus (strain VF5) GN=purD PE=1 SV=1 4 429 2.0E-119
sp|Q92RL0|PUR2_RHIME Phosphoribosylamine--glycine ligase OS=Rhizobium meliloti (strain 1021) GN=purD PE=3 SV=1 4 432 7.0E-119
sp|Q8G1K5|PUR5_BRUSU Phosphoribosylformylglycinamidine cyclo-ligase OS=Brucella suis biovar 1 (strain 1330) GN=purM PE=3 SV=1 429 776 7.0E-119
sp|B0CL36|PUR5_BRUSI Phosphoribosylformylglycinamidine cyclo-ligase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=purM PE=3 SV=1 429 776 7.0E-119
sp|A5VPP4|PUR5_BRUO2 Phosphoribosylformylglycinamidine cyclo-ligase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=purM PE=3 SV=1 429 776 7.0E-119
sp|A9MA84|PUR5_BRUC2 Phosphoribosylformylglycinamidine cyclo-ligase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=purM PE=3 SV=1 429 776 7.0E-119
sp|Q57E30|PUR5_BRUAB Phosphoribosylformylglycinamidine cyclo-ligase OS=Brucella abortus biovar 1 (strain 9-941) GN=purM PE=3 SV=1 429 776 7.0E-119
sp|Q2YN59|PUR5_BRUA2 Phosphoribosylformylglycinamidine cyclo-ligase OS=Brucella abortus (strain 2308) GN=purM PE=3 SV=1 429 776 7.0E-119
sp|B2S4W8|PUR5_BRUA1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Brucella abortus (strain S19) GN=purM PE=3 SV=1 429 776 7.0E-119
sp|Q984K6|PUR5_RHILO Phosphoribosylformylglycinamidine cyclo-ligase OS=Rhizobium loti (strain MAFF303099) GN=purM PE=3 SV=1 433 776 2.0E-118
sp|Q8UHN3|PUR2_AGRFC Phosphoribosylamine--glycine ligase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=purD PE=3 SV=2 4 432 1.0E-117
sp|Q8ZAR2|PUR2_YERPE Phosphoribosylamine--glycine ligase OS=Yersinia pestis GN=purD PE=1 SV=1 4 428 1.0E-117
sp|Q8FB69|PUR2_ECOL6 Phosphoribosylamine--glycine ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=purD PE=3 SV=1 4 433 7.0E-117
sp|Q8YRD8|PUR2_NOSS1 Phosphoribosylamine--glycine ligase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=purD PE=3 SV=1 4 426 7.0E-117
sp|P57829|PUR2_PASMU Phosphoribosylamine--glycine ligase OS=Pasteurella multocida (strain Pm70) GN=purD PE=3 SV=1 4 435 1.0E-116
sp|Q8X612|PUR2_ECO57 Phosphoribosylamine--glycine ligase OS=Escherichia coli O157:H7 GN=purD PE=3 SV=1 4 433 4.0E-116
sp|Q8XXC4|PUR2_RALSO Phosphoribosylamine--glycine ligase OS=Ralstonia solanacearum (strain GMI1000) GN=purD PE=3 SV=1 4 430 4.0E-116
sp|Q1MIW9|PUR5_RHIL3 Phosphoribosylformylglycinamidine cyclo-ligase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=purM PE=3 SV=1 430 786 4.0E-116
sp|P15640|PUR2_ECOLI Phosphoribosylamine--glycine ligase OS=Escherichia coli (strain K12) GN=purD PE=1 SV=2 4 433 5.0E-116
sp|Q8UG98|PUR5_AGRFC Phosphoribosylformylglycinamidine cyclo-ligase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=purM PE=3 SV=2 430 786 7.0E-116
sp|B9JCV0|PUR5_AGRRK Phosphoribosylformylglycinamidine cyclo-ligase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=purM PE=3 SV=1 430 786 1.0E-115
sp|A6X235|PUR5_OCHA4 Phosphoribosylformylglycinamidine cyclo-ligase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=purM PE=3 SV=1 433 776 2.0E-115
sp|Q9HUV8|PUR2_PSEAE Phosphoribosylamine--glycine ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=purD PE=3 SV=1 4 428 2.0E-115
sp|Q8Z334|PUR2_SALTI Phosphoribosylamine--glycine ligase OS=Salmonella typhi GN=purD PE=3 SV=1 4 433 3.0E-115
sp|P26977|PUR2_SALTY Phosphoribosylamine--glycine ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=purD PE=3 SV=1 4 433 6.0E-115
sp|P43845|PUR2_HAEIN Phosphoribosylamine--glycine ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=purD PE=3 SV=1 4 433 8.0E-115
sp|B5ZX12|PUR5_RHILW Phosphoribosylformylglycinamidine cyclo-ligase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=purM PE=3 SV=1 430 786 4.0E-114
sp|Q87VR8|PUR2_PSESM Phosphoribosylamine--glycine ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=purD PE=3 SV=1 4 428 5.0E-114
sp|B3PV93|PUR5_RHIE6 Phosphoribosylformylglycinamidine cyclo-ligase OS=Rhizobium etli (strain CIAT 652) GN=purM PE=3 SV=1 430 786 6.0E-114
sp|Q2KA45|PUR5_RHIEC Phosphoribosylformylglycinamidine cyclo-ligase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=purM PE=3 SV=1 430 786 2.0E-113
sp|B9JUY3|PUR5_AGRVS Phosphoribosylformylglycinamidine cyclo-ligase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=purM PE=3 SV=1 430 786 2.0E-113
sp|Q88DK2|PUR2_PSEPK Phosphoribosylamine--glycine ligase OS=Pseudomonas putida (strain KT2440) GN=purD PE=3 SV=1 4 428 5.0E-113
sp|Q8PQ21|PUR2_XANAC Phosphoribosylamine--glycine ligase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=purD PE=3 SV=1 4 434 8.0E-113
sp|Q6G5R9|PUR5_BARHE Phosphoribosylformylglycinamidine cyclo-ligase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=purM PE=3 SV=1 428 776 2.0E-112
sp|Q8PD48|PUR2_XANCP Phosphoribosylamine--glycine ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=purD PE=3 SV=1 4 435 2.0E-112
sp|Q46482|PUR2_ALLVD Phosphoribosylamine--glycine ligase OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=purD PE=3 SV=2 4 432 2.0E-112
sp|Q986A5|PUR2_RHILO Phosphoribosylamine--glycine ligase OS=Rhizobium loti (strain MAFF303099) GN=purD PE=3 SV=1 4 427 2.0E-112
sp|Q8KBV8|PUR2_CHLTE Phosphoribosylamine--glycine ligase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=purD PE=3 SV=1 4 428 4.0E-112
sp|B8IP71|PUR5_METNO Phosphoribosylformylglycinamidine cyclo-ligase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=purM PE=3 SV=1 431 775 6.0E-112
sp|Q8G2B1|PUR2_BRUSU Phosphoribosylamine--glycine ligase OS=Brucella suis biovar 1 (strain 1330) GN=purD PE=3 SV=1 4 434 6.0E-112
sp|Q6FZK1|PUR5_BARQU Phosphoribosylformylglycinamidine cyclo-ligase OS=Bartonella quintana (strain Toulouse) GN=purM PE=3 SV=1 431 777 2.0E-111
sp|Q8YFK1|PUR2_BRUME Phosphoribosylamine--glycine ligase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=purD PE=3 SV=1 4 434 2.0E-111
sp|Q92QW2|PUR5_RHIME Phosphoribosylformylglycinamidine cyclo-ligase OS=Rhizobium meliloti (strain 1021) GN=purM PE=3 SV=1 430 786 2.0E-111
sp|C3M9F7|PUR5_RHISN Phosphoribosylformylglycinamidine cyclo-ligase OS=Rhizobium sp. (strain NGR234) GN=purM PE=3 SV=1 430 786 3.0E-111
sp|A9IVF6|PUR5_BART1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=purM PE=3 SV=1 428 776 3.0E-111
sp|Q6N5C8|PUR5_RHOPA Phosphoribosylformylglycinamidine cyclo-ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=purM PE=3 SV=1 433 773 6.0E-111
sp|Q8RC54|PUR2_CALS4 Phosphoribosylamine--glycine ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=purD PE=3 SV=1 4 424 7.0E-111
sp|Q2RSC8|PUR5_RHORT Phosphoribosylformylglycinamidine cyclo-ligase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=purM PE=3 SV=2 431 783 3.0E-110
sp|Q9KF52|PUR2_BACHD Phosphoribosylamine--glycine ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=purD PE=3 SV=1 4 437 3.0E-110
sp|P74232|PUR2_SYNY3 Phosphoribosylamine--glycine ligase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=purD PE=3 SV=1 4 428 1.0E-109
sp|Q9FDL5|PUR2_ZYMMO Phosphoribosylamine--glycine ligase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=purD PE=3 SV=2 4 423 2.0E-109
sp|A6U7L8|PUR5_SINMW Phosphoribosylformylglycinamidine cyclo-ligase OS=Sinorhizobium medicae (strain WSM419) GN=purM PE=3 SV=1 430 776 3.0E-109
sp|Q3SS83|PUR5_NITWN Phosphoribosylformylglycinamidine cyclo-ligase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=purM PE=3 SV=1 435 773 1.0E-108
sp|B8EJY5|PUR5_METSB Phosphoribosylformylglycinamidine cyclo-ligase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=purM PE=3 SV=1 431 772 2.0E-108
sp|B0UKC4|PUR5_METS4 Phosphoribosylformylglycinamidine cyclo-ligase OS=Methylobacterium sp. (strain 4-46) GN=purM PE=3 SV=1 431 775 3.0E-108
sp|Q7UPZ8|PUR2_RHOBA Phosphoribosylamine--glycine ligase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=purD PE=3 SV=2 1 433 6.0E-108
sp|Q28RA9|PUR5_JANSC Phosphoribosylformylglycinamidine cyclo-ligase OS=Jannaschia sp. (strain CCS1) GN=purM PE=3 SV=1 430 772 1.0E-107
sp|P12039|PUR2_BACSU Phosphoribosylamine--glycine ligase OS=Bacillus subtilis (strain 168) GN=purD PE=1 SV=1 4 433 2.0E-107
sp|Q9JWU6|PUR2_NEIMA Phosphoribosylamine--glycine ligase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=purD PE=3 SV=1 4 429 2.0E-107
sp|Q9JXA3|PUR2_NEIMB Phosphoribosylamine--glycine ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=purD PE=3 SV=1 4 429 3.0E-107
sp|Q11GW6|PUR5_CHESB Phosphoribosylformylglycinamidine cyclo-ligase OS=Chelativorans sp. (strain BNC1) GN=purM PE=3 SV=1 432 745 3.0E-107
sp|Q97J90|PUR2_CLOAB Phosphoribosylamine--glycine ligase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=purD PE=3 SV=1 4 423 3.0E-107
sp|Q1QLI2|PUR5_NITHX Phosphoribosylformylglycinamidine cyclo-ligase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=purM PE=3 SV=1 433 774 1.0E-106
sp|Q167K4|PUR5_ROSDO Phosphoribosylformylglycinamidine cyclo-ligase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=purM PE=3 SV=1 433 776 4.0E-106
sp|A3PHH4|PUR5_RHOS1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=purM PE=3 SV=1 431 773 2.0E-105
sp|P52420|PUR2_ARATH Phosphoribosylamine--glycine ligase, chloroplastic OS=Arabidopsis thaliana GN=PUR2 PE=2 SV=2 3 440 4.0E-105
sp|Q3J517|PUR5_RHOS4 Phosphoribosylformylglycinamidine cyclo-ligase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=purM PE=3 SV=1 431 773 8.0E-105
sp|Q5LRF9|PUR5_RUEPO Phosphoribosylformylglycinamidine cyclo-ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=purM PE=3 SV=1 431 780 1.0E-104
sp|Q9PC09|PUR2_XYLFA Phosphoribosylamine--glycine ligase OS=Xylella fastidiosa (strain 9a5c) GN=purD PE=3 SV=1 4 432 2.0E-104
sp|B9KMR6|PUR5_RHOSK Phosphoribosylformylglycinamidine cyclo-ligase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=purM PE=3 SV=1 431 773 3.0E-104
sp|Q8REV7|PUR2_FUSNN Phosphoribosylamine--glycine ligase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=purD PE=3 SV=1 4 423 3.0E-104
sp|Q8EZT7|PUR2_LEPIN Phosphoribosylamine--glycine ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=purD PE=3 SV=1 3 427 9.0E-104
sp|Q72V31|PUR2_LEPIC Phosphoribosylamine--glycine ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=purD PE=3 SV=1 3 427 1.0E-103
sp|Q215Q6|PUR5_RHOPB Phosphoribosylformylglycinamidine cyclo-ligase OS=Rhodopseudomonas palustris (strain BisB18) GN=purM PE=3 SV=1 433 776 1.0E-103
sp|B2IJR2|PUR5_BEII9 Phosphoribosylformylglycinamidine cyclo-ligase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=purM PE=3 SV=1 432 773 1.0E-103
sp|Q1GGK7|PUR5_RUEST Phosphoribosylformylglycinamidine cyclo-ligase OS=Ruegeria sp. (strain TM1040) GN=purM PE=3 SV=1 431 776 2.0E-103
sp|Q87D59|PUR2_XYLFT Phosphoribosylamine--glycine ligase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=purD PE=3 SV=1 4 432 3.0E-103
sp|Q1G9G0|PUR5_LACDA Phosphoribosylformylglycinamidine cyclo-ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=purM PE=3 SV=1 438 778 3.0E-102
sp|Q049L9|PUR5_LACDB Phosphoribosylformylglycinamidine cyclo-ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=purM PE=3 SV=1 438 778 5.0E-102
sp|A8LNB8|PUR5_DINSH Phosphoribosylformylglycinamidine cyclo-ligase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=purM PE=3 SV=1 433 774 2.0E-101
sp|Q9XAT2|PUR5_RHILE Phosphoribosylformylglycinamidine cyclo-ligase OS=Rhizobium leguminosarum GN=purM PE=3 SV=1 430 786 6.0E-101
sp|A4WX36|PUR5_RHOS5 Phosphoribosylformylglycinamidine cyclo-ligase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=purM PE=3 SV=1 431 776 1.0E-100
sp|Q9ABD2|PUR2_CAUCR Phosphoribosylamine--glycine ligase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=purD PE=3 SV=1 1 430 1.0E-100
sp|B3E3K3|PUR5_GEOLS Phosphoribosylformylglycinamidine cyclo-ligase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=purM PE=3 SV=1 432 772 1.0E-100
sp|Q1H4W1|PUR5_METFK Phosphoribosylformylglycinamidine cyclo-ligase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=purM PE=3 SV=1 431 784 3.0E-100
sp|Q1GSA2|PUR5_SPHAL Phosphoribosylformylglycinamidine cyclo-ligase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=purM PE=3 SV=1 429 792 7.0E-100
sp|B4REI0|PUR2_PHEZH Phosphoribosylamine--glycine ligase OS=Phenylobacterium zucineum (strain HLK1) GN=purD PE=3 SV=1 4 428 2.0E-99
sp|Q1QVP5|PUR5_CHRSD Phosphoribosylformylglycinamidine cyclo-ligase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=purM PE=3 SV=1 431 776 2.0E-99
sp|A6VMA4|PUR5_ACTSZ Phosphoribosylformylglycinamidine cyclo-ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=purM PE=3 SV=1 432 784 3.0E-99
sp|Q3IIQ2|PUR5_PSEHT Phosphoribosylformylglycinamidine cyclo-ligase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=purM PE=3 SV=1 431 786 5.0E-99
sp|Q63R55|PUR5_BURPS Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia pseudomallei (strain K96243) GN=purM PE=3 SV=1 434 784 5.0E-99
sp|Q3JP21|PUR5_BURP1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia pseudomallei (strain 1710b) GN=purM PE=3 SV=1 434 784 5.0E-99
sp|B8DTT6|PUR5_BIFA0 Phosphoribosylformylglycinamidine cyclo-ligase OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=purM PE=3 SV=1 438 775 6.0E-99
sp|A7FG37|PUR5_YERP3 Phosphoribosylformylglycinamidine cyclo-ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=purM PE=3 SV=1 431 784 9.0E-99
sp|A4TMP3|PUR5_YERPP Phosphoribosylformylglycinamidine cyclo-ligase OS=Yersinia pestis (strain Pestoides F) GN=purM PE=3 SV=1 431 784 1.0E-98
sp|Q1CK40|PUR5_YERPN Phosphoribosylformylglycinamidine cyclo-ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=purM PE=3 SV=1 431 784 1.0E-98
sp|A9QZW5|PUR5_YERPG Phosphoribosylformylglycinamidine cyclo-ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=purM PE=3 SV=1 431 784 1.0E-98
sp|Q8ZCX8|PUR5_YERPE Phosphoribosylformylglycinamidine cyclo-ligase OS=Yersinia pestis GN=purM PE=3 SV=1 431 784 1.0E-98
sp|Q1C5P2|PUR5_YERPA Phosphoribosylformylglycinamidine cyclo-ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=purM PE=3 SV=1 431 784 1.0E-98
sp|Q2SKT3|PUR5_HAHCH Phosphoribosylformylglycinamidine cyclo-ligase OS=Hahella chejuensis (strain KCTC 2396) GN=purM PE=3 SV=1 431 772 1.0E-98
sp|B1JSF4|PUR5_YERPY Phosphoribosylformylglycinamidine cyclo-ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=purM PE=3 SV=1 431 784 2.0E-98
sp|Q668E5|PUR5_YERPS Phosphoribosylformylglycinamidine cyclo-ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=purM PE=3 SV=1 431 784 2.0E-98
sp|B2K9K0|PUR5_YERPB Phosphoribosylformylglycinamidine cyclo-ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=purM PE=3 SV=1 431 784 2.0E-98
sp|A3NYW6|PUR5_BURP0 Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia pseudomallei (strain 1106a) GN=purM PE=3 SV=1 434 784 2.0E-98
sp|A1V0V7|PUR5_BURMS Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia mallei (strain SAVP1) GN=purM PE=3 SV=1 434 784 2.0E-98
sp|Q62HE4|PUR5_BURMA Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia mallei (strain ATCC 23344) GN=purM PE=3 SV=1 434 784 2.0E-98
sp|A2S554|PUR5_BURM9 Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia mallei (strain NCTC 10229) GN=purM PE=3 SV=1 434 784 2.0E-98
sp|A3MN88|PUR5_BURM7 Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia mallei (strain NCTC 10247) GN=purM PE=3 SV=1 434 784 2.0E-98
sp|C6DBR0|PUR5_PECCP Phosphoribosylformylglycinamidine cyclo-ligase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=purM PE=3 SV=1 431 783 3.0E-98
sp|Q9KF55|PUR5_BACHD Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=purM PE=3 SV=1 438 772 4.0E-98
sp|Q2SYY5|PUR5_BURTA Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=purM PE=3 SV=1 434 784 5.0E-98
sp|A1JKZ7|PUR5_YERE8 Phosphoribosylformylglycinamidine cyclo-ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=purM PE=3 SV=1 431 784 1.0E-97
sp|Q6D7S1|PUR5_PECAS Phosphoribosylformylglycinamidine cyclo-ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=purM PE=3 SV=1 431 783 1.0E-97
sp|Q92AP4|PUR2_LISIN Phosphoribosylamine--glycine ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=purD PE=3 SV=1 4 427 2.0E-97
sp|Q8P308|PUR2_STRP8 Phosphoribosylamine--glycine ligase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=purD PE=3 SV=1 4 430 2.0E-97
sp|B5XNQ0|PUR5_KLEP3 Phosphoribosylformylglycinamidine cyclo-ligase OS=Klebsiella pneumoniae (strain 342) GN=purM PE=3 SV=1 431 772 2.0E-97
sp|Q126R8|PUR5_POLSJ Phosphoribosylformylglycinamidine cyclo-ligase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=purM PE=3 SV=1 431 783 4.0E-97
sp|A3ND57|PUR5_BURP6 Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia pseudomallei (strain 668) GN=purM PE=3 SV=1 434 784 4.0E-97
sp|Q5HTL1|PUR2_CAMJR Phosphoribosylamine--glycine ligase OS=Campylobacter jejuni (strain RM1221) GN=purD PE=3 SV=1 4 429 5.0E-97
sp|Q9PN47|PUR2_CAMJE Phosphoribosylamine--glycine ligase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=purD PE=1 SV=1 4 429 5.0E-97
sp|Q3JBW2|PUR5_NITOC Phosphoribosylformylglycinamidine cyclo-ligase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=purM PE=3 SV=1 423 773 5.0E-97
sp|Q2G9X9|PUR5_NOVAD Phosphoribosylformylglycinamidine cyclo-ligase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=purM PE=3 SV=1 429 792 5.0E-97
sp|A5G3H3|PUR5_GEOUR Phosphoribosylformylglycinamidine cyclo-ligase OS=Geobacter uraniireducens (strain Rf4) GN=purM PE=3 SV=1 432 783 6.0E-97
sp|Q47Z78|PUR5_COLP3 Phosphoribosylformylglycinamidine cyclo-ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=purM PE=3 SV=1 431 785 8.0E-97
sp|A0LA23|PUR5_MAGMM Phosphoribosylformylglycinamidine cyclo-ligase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=purM PE=3 SV=1 431 784 9.0E-97
sp|C5D4I2|PUR5_GEOSW Phosphoribosylformylglycinamidine cyclo-ligase OS=Geobacillus sp. (strain WCH70) GN=purM PE=3 SV=1 435 772 9.0E-97
sp|Q1WU57|PUR5_LACS1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Lactobacillus salivarius (strain UCC118) GN=purM PE=3 SV=1 438 785 1.0E-96
sp|Q0ADT8|PUR5_NITEC Phosphoribosylformylglycinamidine cyclo-ligase OS=Nitrosomonas eutropha (strain C91) GN=purM PE=3 SV=1 430 784 1.0E-96
sp|Q5XEF0|PUR2_STRP6 Phosphoribosylamine--glycine ligase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=purD PE=3 SV=2 4 430 1.0E-96
sp|Q82Y02|PUR5_NITEU Phosphoribosylformylglycinamidine cyclo-ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=purM PE=3 SV=1 433 785 1.0E-96
sp|Q9JUA2|PUR5_NEIMA Phosphoribosylformylglycinamidine cyclo-ligase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=purM PE=3 SV=1 435 776 2.0E-96
sp|A9LZD2|PUR5_NEIM0 Phosphoribosylformylglycinamidine cyclo-ligase OS=Neisseria meningitidis serogroup C (strain 053442) GN=purM PE=3 SV=1 435 776 2.0E-96
sp|A3CJZ4|PUR5_STRSV Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus sanguinis (strain SK36) GN=purM PE=3 SV=1 438 776 2.0E-96
sp|A6TCB3|PUR5_KLEP7 Phosphoribosylformylglycinamidine cyclo-ligase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=purM PE=3 SV=1 431 772 2.0E-96
sp|B4EY89|PUR5_PROMH Phosphoribosylformylglycinamidine cyclo-ligase OS=Proteus mirabilis (strain HI4320) GN=purM PE=3 SV=1 431 784 2.0E-96
sp|Q8D245|PUR2_WIGBR Phosphoribosylamine--glycine ligase OS=Wigglesworthia glossinidia brevipalpis GN=purD PE=3 SV=1 4 426 2.0E-96
sp|Q5F973|PUR5_NEIG1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=purM PE=3 SV=1 435 776 2.0E-96
sp|Q9A1Y7|PUR2_STRP1 Phosphoribosylamine--glycine ligase OS=Streptococcus pyogenes serotype M1 GN=purD PE=3 SV=1 4 430 3.0E-96
sp|A7ML12|PUR5_CROS8 Phosphoribosylformylglycinamidine cyclo-ligase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=purM PE=3 SV=1 431 772 3.0E-96
sp|Q3A515|PUR5_PELCD Phosphoribosylformylglycinamidine cyclo-ligase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=purM PE=3 SV=1 431 774 3.0E-96
sp|Q9JZ80|PUR5_NEIMB Phosphoribosylformylglycinamidine cyclo-ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=purM PE=3 SV=1 435 776 4.0E-96
sp|Q6LN73|PUR5_PHOPR Phosphoribosylformylglycinamidine cyclo-ligase OS=Photobacterium profundum GN=purM PE=3 SV=1 432 778 4.0E-96
sp|A1KU60|PUR5_NEIMF Phosphoribosylformylglycinamidine cyclo-ligase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=purM PE=3 SV=1 435 776 4.0E-96
sp|Q5NXR0|PUR5_AROAE Phosphoribosylformylglycinamidine cyclo-ligase OS=Aromatoleum aromaticum (strain EbN1) GN=purM PE=3 SV=1 431 784 4.0E-96
sp|C5BP01|PUR5_TERTT Phosphoribosylformylglycinamidine cyclo-ligase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=purM PE=3 SV=1 438 772 5.0E-96
sp|B7VIN4|PUR5_VIBTL Phosphoribosylformylglycinamidine cyclo-ligase OS=Vibrio tasmaniensis (strain LGP32) GN=purM PE=3 SV=1 432 778 5.0E-96
sp|A4WD72|PUR5_ENT38 Phosphoribosylformylglycinamidine cyclo-ligase OS=Enterobacter sp. (strain 638) GN=purM PE=3 SV=1 431 770 6.0E-96
sp|P0DD59|PUR2_STRPQ Phosphoribosylamine--glycine ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=purD PE=3 SV=1 4 430 6.0E-96
sp|P0DD58|PUR2_STRP3 Phosphoribosylamine--glycine ligase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=purD PE=3 SV=1 4 430 6.0E-96
sp|Q7NS12|PUR5_CHRVO Phosphoribosylformylglycinamidine cyclo-ligase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=purM PE=3 SV=1 435 785 7.0E-96
sp|A1S7E6|PUR5_SHEAM Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=purM PE=3 SV=1 431 776 9.0E-96
sp|Q87MH0|PUR5_VIBPA Phosphoribosylformylglycinamidine cyclo-ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=purM PE=3 SV=1 432 776 9.0E-96
sp|Q71YQ4|PUR2_LISMF Phosphoribosylamine--glycine ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=purD PE=3 SV=1 4 427 1.0E-95
sp|Q1LJ92|PUR5_CUPMC Phosphoribosylformylglycinamidine cyclo-ligase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=purM PE=3 SV=1 436 784 1.0E-95
sp|A6WM34|PUR5_SHEB8 Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella baltica (strain OS185) GN=purM PE=3 SV=1 431 776 1.0E-95
sp|A8AU99|PUR5_STRGC Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=purM PE=3 SV=1 438 776 1.0E-95
sp|Q97T98|PUR2_STRPN Phosphoribosylamine--glycine ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=purD PE=3 SV=1 4 429 1.0E-95
sp|Q97TA2|PUR5_STRPN Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=purM PE=1 SV=1 438 776 2.0E-95
sp|B2VE71|PUR5_ERWT9 Phosphoribosylformylglycinamidine cyclo-ligase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=purM PE=3 SV=1 431 770 2.0E-95
sp|C1CBM4|PUR5_STRZJ Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pneumoniae (strain JJA) GN=purM PE=3 SV=1 438 776 2.0E-95
sp|B8ZJN0|PUR5_STRPJ Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=purM PE=3 SV=1 438 776 2.0E-95
sp|B1I7V5|PUR5_STRPI Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=purM PE=3 SV=1 438 776 2.0E-95
sp|C1C9V1|PUR5_STRP7 Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pneumoniae (strain 70585) GN=purM PE=3 SV=1 438 776 2.0E-95
sp|B2IR37|PUR5_STRPS Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pneumoniae (strain CGSP14) GN=purM PE=3 SV=1 438 776 2.0E-95
sp|C4K4D1|PUR5_HAMD5 Phosphoribosylformylglycinamidine cyclo-ligase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=purM PE=3 SV=1 435 772 2.0E-95
sp|Q5FIV3|PUR5_LACAC Phosphoribosylformylglycinamidine cyclo-ligase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=purM PE=3 SV=1 438 784 2.0E-95
sp|B2GF76|PUR5_LACF3 Phosphoribosylformylglycinamidine cyclo-ligase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=purM PE=3 SV=1 438 784 4.0E-95
sp|C1CNS6|PUR5_STRZT Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=purM PE=3 SV=1 438 776 4.0E-95
sp|Q8Y6C6|PUR2_LISMO Phosphoribosylamine--glycine ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=purD PE=3 SV=1 4 427 5.0E-95
sp|Q21MC3|PUR5_SACD2 Phosphoribosylformylglycinamidine cyclo-ligase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=purM PE=3 SV=2 431 773 5.0E-95
sp|B5E5J6|PUR5_STRP4 Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=purM PE=3 SV=1 438 776 6.0E-95
sp|Q8DRM4|PUR5_STRR6 Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=purM PE=3 SV=1 438 776 7.0E-95
sp|Q04N22|PUR5_STRP2 Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=purM PE=3 SV=1 438 776 7.0E-95
sp|C4LC65|PUR5_TOLAT Phosphoribosylformylglycinamidine cyclo-ligase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=purM PE=3 SV=1 431 778 7.0E-95
sp|Q8DRM0|PUR2_STRR6 Phosphoribosylamine--glycine ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=purD PE=3 SV=1 4 429 7.0E-95
sp|Q46XJ9|PUR5_CUPPJ Phosphoribosylformylglycinamidine cyclo-ligase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=purM PE=3 SV=1 436 784 7.0E-95
sp|B6EJU3|PUR5_ALISL Phosphoribosylformylglycinamidine cyclo-ligase OS=Aliivibrio salmonicida (strain LFI1238) GN=purM PE=3 SV=1 432 778 9.0E-95
sp|Q74CB6|PUR5_GEOSL Phosphoribosylformylglycinamidine cyclo-ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=purM PE=3 SV=1 432 778 9.0E-95
sp|Q8Z4R2|PUR5_SALTI Phosphoribosylformylglycinamidine cyclo-ligase OS=Salmonella typhi GN=purM PE=3 SV=3 431 770 1.0E-94
sp|Q9ZF44|PUR2_LACLA Phosphoribosylamine--glycine ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=purD PE=3 SV=2 4 427 1.0E-94
sp|Q7N3F7|PUR5_PHOLL Phosphoribosylformylglycinamidine cyclo-ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=purM PE=3 SV=1 431 784 1.0E-94
sp|C1CHV9|PUR5_STRZP Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pneumoniae (strain P1031) GN=purM PE=3 SV=1 438 776 2.0E-94
sp|B5FGY5|PUR5_VIBFM Phosphoribosylformylglycinamidine cyclo-ligase OS=Vibrio fischeri (strain MJ11) GN=purM PE=3 SV=1 432 778 2.0E-94
sp|Q5E3H3|PUR5_VIBF1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=purM PE=3 SV=1 432 778 2.0E-94
sp|A1KA97|PUR5_AZOSB Phosphoribosylformylglycinamidine cyclo-ligase OS=Azoarcus sp. (strain BH72) GN=purM PE=3 SV=1 438 785 2.0E-94
sp|B9M1P4|PUR5_GEODF Phosphoribosylformylglycinamidine cyclo-ligase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=purM PE=3 SV=1 432 783 2.0E-94
sp|Q8E2G1|PUR5_STRA5 Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=purM PE=3 SV=1 431 775 3.0E-94
sp|C0PYQ6|PUR5_SALPC Phosphoribosylformylglycinamidine cyclo-ligase OS=Salmonella paratyphi C (strain RKS4594) GN=purM PE=3 SV=1 431 770 3.0E-94
sp|Q57LL0|PUR5_SALCH Phosphoribosylformylglycinamidine cyclo-ligase OS=Salmonella choleraesuis (strain SC-B67) GN=purM PE=3 SV=3 431 770 3.0E-94
sp|Q6AK63|PUR5_DESPS Phosphoribosylformylglycinamidine cyclo-ligase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=purM PE=3 SV=1 438 775 3.0E-94
sp|Q7MIK1|PUR5_VIBVY Phosphoribosylformylglycinamidine cyclo-ligase OS=Vibrio vulnificus (strain YJ016) GN=purM PE=3 SV=1 432 778 3.0E-94
sp|Q8DBC2|PUR5_VIBVU Phosphoribosylformylglycinamidine cyclo-ligase OS=Vibrio vulnificus (strain CMCP6) GN=purM PE=3 SV=1 432 778 3.0E-94
sp|C6E6M9|PUR5_GEOSM Phosphoribosylformylglycinamidine cyclo-ligase OS=Geobacter sp. (strain M21) GN=purM PE=3 SV=1 432 783 3.0E-94
sp|A7MY25|PUR5_VIBCB Phosphoribosylformylglycinamidine cyclo-ligase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=purM PE=3 SV=1 432 776 4.0E-94
sp|P74883|PUR5_SALTY Phosphoribosylformylglycinamidine cyclo-ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=purM PE=3 SV=3 431 770 6.0E-94
sp|B4TR76|PUR5_SALSV Phosphoribosylformylglycinamidine cyclo-ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=purM PE=3 SV=1 431 770 6.0E-94
sp|B5BB05|PUR5_SALPK Phosphoribosylformylglycinamidine cyclo-ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=purM PE=3 SV=1 431 770 6.0E-94
sp|Q5PNJ8|PUR5_SALPA Phosphoribosylformylglycinamidine cyclo-ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=purM PE=3 SV=3 431 770 6.0E-94
sp|B4TD75|PUR5_SALHS Phosphoribosylformylglycinamidine cyclo-ligase OS=Salmonella heidelberg (strain SL476) GN=purM PE=3 SV=1 431 770 6.0E-94
sp|B5FQJ2|PUR5_SALDC Phosphoribosylformylglycinamidine cyclo-ligase OS=Salmonella dublin (strain CT_02021853) GN=purM PE=3 SV=1 431 770 6.0E-94
sp|Q31GT2|PUR5_THICR Phosphoribosylformylglycinamidine cyclo-ligase OS=Thiomicrospira crunogena (strain XCL-2) GN=purM PE=3 SV=1 431 772 9.0E-94
sp|Q8G595|PUR5_BIFLO Phosphoribosylformylglycinamidine cyclo-ligase OS=Bifidobacterium longum (strain NCC 2705) GN=purM PE=3 SV=1 438 778 1.0E-93
sp|B3DT56|PUR5_BIFLD Phosphoribosylformylglycinamidine cyclo-ligase OS=Bifidobacterium longum (strain DJO10A) GN=purM PE=3 SV=1 438 778 1.0E-93
sp|B9DSR4|PUR5_STRU0 Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=purM PE=3 SV=1 438 776 1.0E-93
sp|B7LKE3|PUR5_ESCF3 Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=purM PE=3 SV=1 431 770 1.0E-93
sp|Q8CT26|PUR2_STAES Phosphoribosylamine--glycine ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=purD PE=3 SV=2 4 428 1.0E-93
sp|Q5HQ96|PUR2_STAEQ Phosphoribosylamine--glycine ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=purD PE=3 SV=1 4 428 1.0E-93
sp|Q2Y5R7|PUR5_NITMU Phosphoribosylformylglycinamidine cyclo-ligase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=purM PE=3 SV=2 430 776 1.0E-93
sp|A8FUD3|PUR5_SHESH Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella sediminis (strain HAW-EB3) GN=purM PE=3 SV=1 431 776 1.0E-93
sp|B5Z036|PUR5_ECO5E Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=purM PE=3 SV=1 431 770 1.0E-93
sp|Q8XAC5|PUR5_ECO57 Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli O157:H7 GN=purM PE=3 SV=3 431 770 1.0E-93
sp|A9AGA9|PUR5_BURM1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=purM PE=3 SV=1 434 784 2.0E-93
sp|Q0K769|PUR5_CUPNH Phosphoribosylformylglycinamidine cyclo-ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=purM PE=3 SV=1 436 784 2.0E-93
sp|Q32D69|PUR5_SHIDS Phosphoribosylformylglycinamidine cyclo-ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=purM PE=3 SV=3 431 770 2.0E-93
sp|B5EFU7|PUR5_GEOBB Phosphoribosylformylglycinamidine cyclo-ligase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=purM PE=3 SV=1 432 783 2.0E-93
sp|C3LPN0|PUR5_VIBCM Phosphoribosylformylglycinamidine cyclo-ligase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=purM PE=3 SV=1 435 772 2.0E-93
sp|Q9KPY6|PUR5_VIBCH Phosphoribosylformylglycinamidine cyclo-ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=purM PE=1 SV=1 435 772 2.0E-93
sp|A5F643|PUR5_VIBC3 Phosphoribosylformylglycinamidine cyclo-ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=purM PE=3 SV=1 435 772 2.0E-93
sp|Q8E7W9|PUR5_STRA3 Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=purM PE=3 SV=1 431 775 2.0E-93
sp|Q1R8N9|PUR5_ECOUT Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=purM PE=3 SV=3 431 770 2.0E-93
sp|B7MHY0|PUR5_ECO45 Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=purM PE=3 SV=1 431 770 2.0E-93
sp|Q1JJ82|PUR5_STRPD Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=purM PE=3 SV=1 431 775 2.0E-93
sp|P08178|PUR5_ECOLI Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli (strain K12) GN=purM PE=1 SV=3 431 770 2.0E-93
sp|B1XAX4|PUR5_ECODH Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli (strain K12 / DH10B) GN=purM PE=3 SV=1 431 770 2.0E-93
sp|C4ZX74|PUR5_ECOBW Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=purM PE=3 SV=1 431 770 2.0E-93
sp|Q0TEY9|PUR5_ECOL5 Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=purM PE=3 SV=3 431 770 3.0E-93
sp|Q3YZ53|PUR5_SHISS Phosphoribosylformylglycinamidine cyclo-ligase OS=Shigella sonnei (strain Ss046) GN=purM PE=3 SV=3 431 770 3.0E-93
sp|Q83QL4|PUR5_SHIFL Phosphoribosylformylglycinamidine cyclo-ligase OS=Shigella flexneri GN=purM PE=3 SV=3 431 770 3.0E-93
sp|Q0T221|PUR5_SHIF8 Phosphoribosylformylglycinamidine cyclo-ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=purM PE=3 SV=1 431 770 3.0E-93
sp|Q31XZ3|PUR5_SHIBS Phosphoribosylformylglycinamidine cyclo-ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=purM PE=3 SV=3 431 770 3.0E-93
sp|B2TXS4|PUR5_SHIB3 Phosphoribosylformylglycinamidine cyclo-ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=purM PE=3 SV=1 431 770 3.0E-93
sp|B1LNF0|PUR5_ECOSM Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=purM PE=3 SV=1 431 770 3.0E-93
sp|B7N681|PUR5_ECOLU Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=purM PE=3 SV=1 431 770 3.0E-93
sp|B1IWG1|PUR5_ECOLC Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=purM PE=3 SV=1 431 770 3.0E-93
sp|Q8FF72|PUR5_ECOL6 Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=purM PE=3 SV=3 431 770 3.0E-93
sp|A8A2Z1|PUR5_ECOHS Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli O9:H4 (strain HS) GN=purM PE=3 SV=1 431 770 3.0E-93
sp|B7M7K3|PUR5_ECO8A Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli O8 (strain IAI1) GN=purM PE=3 SV=1 431 770 3.0E-93
sp|B7LCN9|PUR5_ECO55 Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli (strain 55989 / EAEC) GN=purM PE=3 SV=1 431 770 3.0E-93
sp|Q9RUF5|PUR2_DEIRA Phosphoribosylamine--glycine ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=purD PE=3 SV=2 4 426 3.0E-93
sp|B7MYC7|PUR5_ECO81 Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli O81 (strain ED1a) GN=purM PE=3 SV=1 431 770 3.0E-93
sp|Q9A1Z0|PUR5_STRP1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pyogenes serotype M1 GN=purM PE=3 SV=1 431 775 3.0E-93
sp|C5BHQ4|PUR5_EDWI9 Phosphoribosylformylglycinamidine cyclo-ligase OS=Edwardsiella ictaluri (strain 93-146) GN=purM PE=3 SV=1 431 776 3.0E-93
sp|B7UGN7|PUR5_ECO27 Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=purM PE=3 SV=1 431 770 3.0E-93
sp|Q65UX7|PUR5_MANSM Phosphoribosylformylglycinamidine cyclo-ligase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=purM PE=3 SV=1 432 784 4.0E-93
sp|B3R6D1|PUR5_CUPTR Phosphoribosylformylglycinamidine cyclo-ligase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=purM PE=3 SV=1 436 784 4.0E-93
sp|A9KY38|PUR5_SHEB9 Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella baltica (strain OS195) GN=purM PE=3 SV=1 431 776 4.0E-93
sp|A3D3D1|PUR5_SHEB5 Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=purM PE=3 SV=1 431 776 4.0E-93
sp|B8EAL4|PUR5_SHEB2 Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella baltica (strain OS223) GN=purM PE=3 SV=1 431 776 4.0E-93
sp|Q9CFF4|PUR5_LACLA Phosphoribosylformylglycinamidine cyclo-ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=purM PE=3 SV=1 438 776 4.0E-93
sp|B1YTV3|PUR5_BURA4 Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia ambifaria (strain MC40-6) GN=purM PE=3 SV=1 434 785 4.0E-93
sp|B7NQN8|PUR5_ECO7I Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=purM PE=3 SV=1 431 770 5.0E-93
sp|A7ZPU2|PUR5_ECO24 Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=purM PE=3 SV=1 431 770 5.0E-93
sp|B6I571|PUR5_ECOSE Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli (strain SE11) GN=purM PE=3 SV=1 431 770 6.0E-93
sp|A1TZ73|PUR5_MARHV Phosphoribosylformylglycinamidine cyclo-ligase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=purM PE=3 SV=1 431 770 7.0E-93
sp|Q1Q9M0|PUR5_PSYCK Phosphoribosylformylglycinamidine cyclo-ligase OS=Psychrobacter cryohalolentis (strain K5) GN=purM PE=3 SV=1 431 776 7.0E-93
sp|A8H5R0|PUR5_SHEPA Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=purM PE=3 SV=1 436 776 7.0E-93
sp|A1RKQ5|PUR5_SHESW Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella sp. (strain W3-18-1) GN=purM PE=3 SV=1 431 776 8.0E-93
sp|Q12MF0|PUR5_SHEDO Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=purM PE=3 SV=1 431 776 9.0E-93
sp|Q4FR86|PUR5_PSYA2 Phosphoribosylformylglycinamidine cyclo-ligase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=purM PE=3 SV=1 431 776 1.0E-92
sp|Q5QUP9|PUR5_IDILO Phosphoribosylformylglycinamidine cyclo-ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=purM PE=3 SV=1 432 778 1.0E-92
sp|Q48VX3|PUR5_STRPM Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=purM PE=3 SV=1 431 775 1.0E-92
sp|B7GU81|PUR5_BIFLS Phosphoribosylformylglycinamidine cyclo-ligase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=purM PE=3 SV=1 438 778 1.0E-92
sp|A0K4T7|PUR5_BURCH Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia cenocepacia (strain HI2424) GN=purM PE=3 SV=1 434 784 1.0E-92
sp|B1JW28|PUR5_BURCC Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia cenocepacia (strain MC0-3) GN=purM PE=3 SV=1 434 784 1.0E-92
sp|Q1BYW4|PUR5_BURCA Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia cenocepacia (strain AU 1054) GN=purM PE=3 SV=1 434 784 1.0E-92
sp|A4Y5T8|PUR5_SHEPC Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=purM PE=3 SV=1 431 776 2.0E-92
sp|B5XJ18|PUR5_STRPZ Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=purM PE=3 SV=1 431 775 2.0E-92
sp|P0DD63|PUR5_STRPQ Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=purM PE=3 SV=1 431 775 2.0E-92
sp|P0DD62|PUR5_STRP3 Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=purM PE=3 SV=1 431 775 2.0E-92
sp|Q0BI09|PUR5_BURCM Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=purM PE=3 SV=1 434 784 2.0E-92
sp|B0TPW7|PUR5_SHEHH Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=purM PE=3 SV=1 436 776 2.0E-92
sp|Q71YQ1|PUR5_LISMF Phosphoribosylformylglycinamidine cyclo-ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=purM PE=3 SV=1 438 776 2.0E-92
sp|C1KW66|PUR5_LISMC Phosphoribosylformylglycinamidine cyclo-ligase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=purM PE=3 SV=1 438 776 2.0E-92
sp|Q0I5D1|PUR5_HAES1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Haemophilus somnus (strain 129Pt) GN=purM PE=3 SV=1 432 772 2.0E-92
sp|Q1J936|PUR5_STRPF Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=purM PE=3 SV=1 431 775 2.0E-92
sp|Q8P312|PUR5_STRP8 Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=purM PE=3 SV=1 431 775 2.0E-92
sp|Q1JE80|PUR5_STRPB Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=purM PE=3 SV=1 431 775 2.0E-92
sp|Q084L1|PUR5_SHEFN Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella frigidimarina (strain NCIMB 400) GN=purM PE=3 SV=1 436 776 2.0E-92
sp|Q3K400|PUR5_STRA1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=purM PE=3 SV=1 431 775 2.0E-92
sp|A7Z251|PUR5_BACMF Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=purM PE=3 SV=1 438 780 3.0E-92
sp|B0URN5|PUR5_HISS2 Phosphoribosylformylglycinamidine cyclo-ligase OS=Histophilus somni (strain 2336) GN=purM PE=3 SV=1 432 772 4.0E-92
sp|Q0HHL6|PUR5_SHESM Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella sp. (strain MR-4) GN=purM PE=3 SV=1 431 776 4.0E-92
sp|A0KYA3|PUR5_SHESA Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella sp. (strain ANA-3) GN=purM PE=3 SV=1 431 776 4.0E-92
sp|P12043|PUR5_BACSU Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus subtilis (strain 168) GN=purM PE=3 SV=2 438 776 4.0E-92
sp|Q5XEF4|PUR5_STRP6 Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=purM PE=3 SV=1 431 775 5.0E-92
sp|Q0HTW8|PUR5_SHESR Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella sp. (strain MR-7) GN=purM PE=3 SV=1 431 776 5.0E-92
sp|B8CN80|PUR5_SHEPW Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=purM PE=3 SV=1 436 775 5.0E-92
sp|B8I492|PUR5_CLOCE Phosphoribosylformylglycinamidine cyclo-ligase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=purM PE=3 SV=1 437 782 5.0E-92
sp|B4EDH7|PUR5_BURCJ Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=purM PE=3 SV=1 434 784 6.0E-92
sp|Q8Y6C3|PUR5_LISMO Phosphoribosylformylglycinamidine cyclo-ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=purM PE=3 SV=1 438 786 6.0E-92
sp|B8DDZ0|PUR5_LISMH Phosphoribosylformylglycinamidine cyclo-ligase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=purM PE=3 SV=1 438 776 6.0E-92
sp|Q2KX26|PUR5_BORA1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Bordetella avium (strain 197N) GN=purM PE=3 SV=1 436 784 6.0E-92
sp|Q8XW52|PUR5_RALSO Phosphoribosylformylglycinamidine cyclo-ligase OS=Ralstonia solanacearum (strain GMI1000) GN=purM PE=3 SV=1 431 784 7.0E-92
sp|Q15SY3|PUR5_PSEA6 Phosphoribosylformylglycinamidine cyclo-ligase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=purM PE=3 SV=1 432 772 8.0E-92
sp|Q39JB9|PUR5_BURL3 Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=purM PE=3 SV=1 434 784 8.0E-92
sp|A1A0R8|PUR5_BIFAA Phosphoribosylformylglycinamidine cyclo-ligase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=purM PE=3 SV=1 438 775 1.0E-91
sp|Q8RC57|PUR5_CALS4 Phosphoribosylformylglycinamidine cyclo-ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=purM PE=3 SV=1 436 779 1.0E-91
sp|Q8EDI8|PUR5_SHEON Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella oneidensis (strain MR-1) GN=purM PE=3 SV=2 431 776 1.0E-91
sp|Q311C7|PUR5_DESAG Phosphoribosylformylglycinamidine cyclo-ligase OS=Desulfovibrio alaskensis (strain G20) GN=purM PE=3 SV=1 432 772 1.0E-91
sp|Q48FI4|PUR5_PSE14 Phosphoribosylformylglycinamidine cyclo-ligase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=purM PE=3 SV=1 431 789 2.0E-91
sp|Q2N8X9|PUR5_ERYLH Phosphoribosylformylglycinamidine cyclo-ligase OS=Erythrobacter litoralis (strain HTCC2594) GN=purM PE=3 SV=1 431 792 2.0E-91
sp|A2RBZ5|PUR5_STRPG Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=purM PE=3 SV=1 431 775 3.0E-91
sp|C4L2A1|PUR5_EXISA Phosphoribosylformylglycinamidine cyclo-ligase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=purM PE=3 SV=1 435 788 3.0E-91
sp|Q2NS68|PUR5_SODGM Phosphoribosylformylglycinamidine cyclo-ligase OS=Sodalis glossinidius (strain morsitans) GN=purM PE=3 SV=1 431 772 4.0E-91
sp|Q9CPL6|PUR5_PASMU Phosphoribosylformylglycinamidine cyclo-ligase OS=Pasteurella multocida (strain Pm70) GN=purM PE=3 SV=1 432 784 5.0E-91
sp|O68186|PUR5_LACLM Phosphoribosylformylglycinamidine cyclo-ligase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=purM PE=3 SV=1 438 776 6.0E-91
sp|A8YW83|PUR5_LACH4 Phosphoribosylformylglycinamidine cyclo-ligase OS=Lactobacillus helveticus (strain DPC 4571) GN=purM PE=3 SV=1 438 786 6.0E-91
sp|Q9F1T6|PUR5_STRSU Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus suis GN=purM PE=3 SV=1 438 776 6.0E-91
sp|Q885Y1|PUR5_PSESM Phosphoribosylformylglycinamidine cyclo-ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=purM PE=3 SV=1 431 789 1.0E-90
sp|A0AJM1|PUR5_LISW6 Phosphoribosylformylglycinamidine cyclo-ligase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=purM PE=3 SV=1 438 776 1.0E-90
sp|Q4ZQ51|PUR5_PSEU2 Phosphoribosylformylglycinamidine cyclo-ligase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=purM PE=3 SV=1 431 789 2.0E-90
sp|Q92AP1|PUR5_LISIN Phosphoribosylformylglycinamidine cyclo-ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=purM PE=3 SV=1 438 775 2.0E-90
sp|A0KM24|PUR5_AERHH Phosphoribosylformylglycinamidine cyclo-ligase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=purM PE=3 SV=1 431 784 2.0E-90
sp|B2G5C0|PUR5_LACRJ Phosphoribosylformylglycinamidine cyclo-ligase OS=Lactobacillus reuteri (strain JCM 1112) GN=purM PE=3 SV=1 438 784 2.0E-90
sp|A5VHU0|PUR5_LACRD Phosphoribosylformylglycinamidine cyclo-ligase OS=Lactobacillus reuteri (strain DSM 20016) GN=purM PE=3 SV=1 438 784 2.0E-90
sp|B1KIG9|PUR5_SHEWM Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=purM PE=3 SV=1 431 775 2.0E-90
sp|A3QD32|PUR5_SHELP Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=purM PE=3 SV=1 431 776 2.0E-90
sp|Q8DWL1|PUR5_STRMU Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=purM PE=3 SV=1 438 775 2.0E-90
sp|B8DNV5|PUR5_DESVM Phosphoribosylformylglycinamidine cyclo-ligase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=purM PE=3 SV=1 431 776 4.0E-90
sp|Q9F1S9|PUR2_STRSU Phosphoribosylamine--glycine ligase OS=Streptococcus suis GN=purD PE=3 SV=1 4 429 7.0E-90
sp|B2JGD2|PUR5_BURP8 Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=purM PE=3 SV=1 432 784 7.0E-90
sp|Q2RGU7|PUR5_MOOTA Phosphoribosylformylglycinamidine cyclo-ligase OS=Moorella thermoacetica (strain ATCC 39073) GN=purM PE=3 SV=1 434 776 8.0E-90
sp|Q9RKL4|PUR2_STRCO Phosphoribosylamine--glycine ligase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=purD PE=3 SV=1 4 427 1.0E-89
sp|A4SL28|PUR5_AERS4 Phosphoribosylformylglycinamidine cyclo-ligase OS=Aeromonas salmonicida (strain A449) GN=purM PE=3 SV=1 431 784 1.0E-89
sp|C1DRW0|PUR5_AZOVD Phosphoribosylformylglycinamidine cyclo-ligase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=purM PE=3 SV=1 431 772 1.0E-89
sp|A8FAM9|PUR5_BACP2 Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus pumilus (strain SAFR-032) GN=purM PE=3 SV=1 438 774 1.0E-89
sp|Q1JP36|PUR5_STRPC Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=purM PE=3 SV=1 431 775 2.0E-89
sp|Q21VH4|PUR5_RHOFT Phosphoribosylformylglycinamidine cyclo-ligase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=purM PE=3 SV=1 431 775 2.0E-89
sp|Q4K8A5|PUR5_PSEF5 Phosphoribosylformylglycinamidine cyclo-ligase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=purM PE=3 SV=1 431 789 3.0E-89
sp|A9FYZ4|PUR5_SORC5 Phosphoribosylformylglycinamidine cyclo-ligase OS=Sorangium cellulosum (strain So ce56) GN=purM PE=3 SV=1 434 773 3.0E-89
sp|A5UEU3|PUR5_HAEIG Phosphoribosylformylglycinamidine cyclo-ligase OS=Haemophilus influenzae (strain PittGG) GN=purM PE=3 SV=1 432 784 4.0E-89
sp|P43848|PUR5_HAEIN Phosphoribosylformylglycinamidine cyclo-ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=purM PE=3 SV=1 432 772 5.0E-89
sp|A4JBT0|PUR5_BURVG Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=purM PE=3 SV=1 434 784 5.0E-89
sp|P52424|PUR5_VIGUN Phosphoribosylformylglycinamidine cyclo-ligase, chloroplastic/mitochondrial OS=Vigna unguiculata GN=PUR5 PE=2 SV=1 420 773 5.0E-89
sp|A6TLS5|PUR5_ALKMQ Phosphoribosylformylglycinamidine cyclo-ligase OS=Alkaliphilus metalliredigens (strain QYMF) GN=purM PE=3 SV=1 436 782 5.0E-89
sp|B4RZX7|PUR5_ALTMD Phosphoribosylformylglycinamidine cyclo-ligase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=purM PE=3 SV=1 431 775 5.0E-89
sp|Q9I513|PUR5_PSEAE Phosphoribosylformylglycinamidine cyclo-ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=purM PE=3 SV=1 431 772 5.0E-89
sp|Q7W0A7|PUR5_BORPE Phosphoribosylformylglycinamidine cyclo-ligase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=purM PE=3 SV=1 436 784 6.0E-89
sp|Q7WG60|PUR5_BORBR Phosphoribosylformylglycinamidine cyclo-ligase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=purM PE=3 SV=1 436 784 6.0E-89
sp|Q02IA6|PUR5_PSEAB Phosphoribosylformylglycinamidine cyclo-ligase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=purM PE=3 SV=1 431 772 6.0E-89
sp|B7UXY9|PUR5_PSEA8 Phosphoribosylformylglycinamidine cyclo-ligase OS=Pseudomonas aeruginosa (strain LESB58) GN=purM PE=3 SV=1 431 772 6.0E-89
sp|B2T067|PUR5_BURPP Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=purM PE=3 SV=1 432 784 8.0E-89
sp|C3K102|PUR5_PSEFS Phosphoribosylformylglycinamidine cyclo-ligase OS=Pseudomonas fluorescens (strain SBW25) GN=purM PE=3 SV=1 431 789 8.0E-89
sp|Q5WJ84|PUR5_BACSK Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus clausii (strain KSM-K16) GN=purM PE=3 SV=1 438 772 9.0E-89
sp|Q39UK1|PUR5_GEOMG Phosphoribosylformylglycinamidine cyclo-ligase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=purM PE=3 SV=1 434 778 1.0E-88
sp|C0ZKC8|PUR5_BREBN Phosphoribosylformylglycinamidine cyclo-ligase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=purM PE=3 SV=1 438 790 1.0E-88
sp|A5UC39|PUR5_HAEIE Phosphoribosylformylglycinamidine cyclo-ligase OS=Haemophilus influenzae (strain PittEE) GN=purM PE=3 SV=1 432 784 1.0E-88
sp|Q3AD62|PUR5_CARHZ Phosphoribosylformylglycinamidine cyclo-ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=purM PE=3 SV=1 434 762 2.0E-88
sp|Q7W4N4|PUR5_BORPA Phosphoribosylformylglycinamidine cyclo-ligase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=purM PE=3 SV=1 436 784 2.0E-88
sp|C1DC84|PUR5_LARHH Phosphoribosylformylglycinamidine cyclo-ligase OS=Laribacter hongkongensis (strain HLHK9) GN=purM PE=3 SV=1 434 776 3.0E-88
sp|B8F5E6|PUR5_HAEPS Phosphoribosylformylglycinamidine cyclo-ligase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=purM PE=3 SV=1 436 772 3.0E-88
sp|Q145C6|PUR5_BURXL Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia xenovorans (strain LB400) GN=purM PE=3 SV=1 432 784 3.0E-88
sp|B0BQ30|PUR5_ACTPJ Phosphoribosylformylglycinamidine cyclo-ligase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=purM PE=3 SV=1 432 772 5.0E-88
sp|A3N1A1|PUR5_ACTP2 Phosphoribosylformylglycinamidine cyclo-ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=purM PE=3 SV=1 432 772 5.0E-88
sp|Q6GAD9|PUR2_STAAS Phosphoribosylamine--glycine ligase OS=Staphylococcus aureus (strain MSSA476) GN=purD PE=3 SV=1 4 429 6.0E-88
sp|Q2LTT5|PUR5_SYNAS Phosphoribosylformylglycinamidine cyclo-ligase OS=Syntrophus aciditrophicus (strain SB) GN=purM PE=3 SV=1 433 772 6.0E-88
sp|B0K3Q6|PUR5_THEPX Phosphoribosylformylglycinamidine cyclo-ligase OS=Thermoanaerobacter sp. (strain X514) GN=purM PE=3 SV=1 436 779 7.0E-88
sp|B1YJ07|PUR5_EXIS2 Phosphoribosylformylglycinamidine cyclo-ligase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=purM PE=3 SV=1 432 779 8.0E-88
sp|Q93MM7|PUR5_LACSS Phosphoribosylformylglycinamidine cyclo-ligase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=purM PE=3 SV=1 438 785 8.0E-88
sp|Q03MZ8|PUR5_STRTD Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=purM PE=3 SV=1 432 775 9.0E-88
sp|Q6GI10|PUR2_STAAR Phosphoribosylamine--glycine ligase OS=Staphylococcus aureus (strain MRSA252) GN=purD PE=3 SV=1 4 429 9.0E-88
sp|Q5HH10|PUR2_STAAC Phosphoribosylamine--glycine ligase OS=Staphylococcus aureus (strain COL) GN=purD PE=3 SV=1 4 429 1.0E-87
sp|Q833Z1|PUR5_ENTFA Phosphoribosylformylglycinamidine cyclo-ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=purM PE=3 SV=1 438 776 1.0E-87
sp|Q8ES94|PUR5_OCEIH Phosphoribosylformylglycinamidine cyclo-ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=purM PE=3 SV=1 437 776 1.0E-87
sp|Q5M6J5|PUR5_STRT2 Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=purM PE=3 SV=1 432 775 1.0E-87
sp|Q5M203|PUR5_STRT1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=purM PE=3 SV=1 432 775 1.0E-87
sp|Q55422|PUR5_SYNY3 Phosphoribosylformylglycinamidine cyclo-ligase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=purM PE=3 SV=1 436 748 1.0E-87
sp|A9I602|PUR5_BORPD Phosphoribosylformylglycinamidine cyclo-ligase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=purM PE=3 SV=1 436 784 2.0E-87
sp|Q6F973|PUR5_ACIAD Phosphoribosylformylglycinamidine cyclo-ligase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=purM PE=3 SV=1 436 772 2.0E-87
sp|Q8NX87|PUR2_STAAW Phosphoribosylamine--glycine ligase OS=Staphylococcus aureus (strain MW2) GN=purD PE=3 SV=1 4 429 2.0E-87
sp|Q1MRM4|PUR5_LAWIP Phosphoribosylformylglycinamidine cyclo-ligase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=purM PE=3 SV=1 434 785 2.0E-87
sp|Q47B77|PUR5_DECAR Phosphoribosylformylglycinamidine cyclo-ligase OS=Dechloromonas aromatica (strain RCB) GN=purM PE=3 SV=1 431 775 4.0E-87
sp|Q4QKF3|PUR5_HAEI8 Phosphoribosylformylglycinamidine cyclo-ligase OS=Haemophilus influenzae (strain 86-028NP) GN=purM PE=3 SV=1 432 784 7.0E-87
sp|B0KBQ3|PUR5_THEP3 Phosphoribosylformylglycinamidine cyclo-ligase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=purM PE=3 SV=1 436 779 8.0E-87
sp|Q6HPA2|PUR5_BACHK Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=purM PE=3 SV=1 435 774 8.0E-87
sp|A4XWN5|PUR5_PSEMY Phosphoribosylformylglycinamidine cyclo-ligase OS=Pseudomonas mendocina (strain ymp) GN=purM PE=3 SV=1 431 780 1.0E-86
sp|B7IUV5|PUR5_BACC2 Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus cereus (strain G9842) GN=purM PE=3 SV=1 435 774 1.0E-86
sp|Q60BU2|PUR5_METCA Phosphoribosylformylglycinamidine cyclo-ligase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=purM PE=3 SV=1 428 779 1.0E-86
sp|A7GKI0|PUR5_BACCN Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=purM PE=3 SV=1 435 774 1.0E-86
sp|C1EV65|PUR5_BACC3 Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus cereus (strain 03BB102) GN=purM PE=3 SV=1 435 774 2.0E-86
sp|B7JM87|PUR5_BACC0 Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus cereus (strain AH820) GN=purM PE=3 SV=1 435 774 2.0E-86
sp|Q81ZH0|PUR5_BACAN Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus anthracis GN=purM PE=1 SV=1 435 774 2.0E-86
sp|A0R8Z8|PUR5_BACAH Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=purM PE=3 SV=1 435 774 2.0E-86
sp|C3L534|PUR5_BACAC Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=purM PE=3 SV=1 435 774 2.0E-86
sp|C3PBN2|PUR5_BACAA Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus anthracis (strain A0248) GN=purM PE=3 SV=1 435 774 2.0E-86
sp|Q81IQ1|PUR5_BACCR Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=purM PE=3 SV=1 435 774 2.0E-86
sp|B7H4T8|PUR5_BACC4 Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus cereus (strain B4264) GN=purM PE=3 SV=1 435 774 2.0E-86
sp|Q63GT1|PUR5_BACCZ Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus cereus (strain ZK / E33L) GN=purM PE=3 SV=1 435 774 2.0E-86
sp|Q3KFT0|PUR5_PSEPF Phosphoribosylformylglycinamidine cyclo-ligase OS=Pseudomonas fluorescens (strain Pf0-1) GN=purM PE=3 SV=1 431 772 3.0E-86
sp|B9EAZ0|PUR5_MACCJ Phosphoribosylformylglycinamidine cyclo-ligase OS=Macrococcus caseolyticus (strain JCSC5402) GN=purM PE=3 SV=1 435 774 3.0E-86
sp|A9VRF3|PUR5_BACWK Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=purM PE=3 SV=1 435 774 3.0E-86
sp|A3DEV1|PUR5_CLOTH Phosphoribosylformylglycinamidine cyclo-ligase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=purM PE=3 SV=1 437 782 5.0E-86
sp|P65896|PUR2_STAAN Phosphoribosylamine--glycine ligase OS=Staphylococcus aureus (strain N315) GN=purD PE=1 SV=1 4 429 7.0E-86
sp|P65895|PUR2_STAAM Phosphoribosylamine--glycine ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=purD PE=3 SV=1 4 429 7.0E-86
sp|B9J1K7|PUR5_BACCQ Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus cereus (strain Q1) GN=purM PE=3 SV=1 435 774 1.0E-85
sp|Q73EN3|PUR5_BACC1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=purM PE=3 SV=1 435 774 1.0E-85
sp|A9KHX3|PUR5_CLOPH Phosphoribosylformylglycinamidine cyclo-ligase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=purM PE=3 SV=1 436 782 1.0E-85
sp|Q5L3D0|PUR5_GEOKA Phosphoribosylformylglycinamidine cyclo-ligase OS=Geobacillus kaustophilus (strain HTA426) GN=purM PE=1 SV=1 435 774 2.0E-85
sp|B7HS34|PUR5_BACC7 Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus cereus (strain AH187) GN=purM PE=3 SV=1 435 774 2.0E-85
sp|Q67KG0|PUR5_SYMTH Phosphoribosylformylglycinamidine cyclo-ligase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=purM PE=3 SV=1 432 748 2.0E-85
sp|B0VDJ1|PUR5_ACIBY Phosphoribosylformylglycinamidine cyclo-ligase OS=Acinetobacter baumannii (strain AYE) GN=purM PE=3 SV=1 436 772 3.0E-85
sp|A3M7X8|PUR5_ACIBT Phosphoribosylformylglycinamidine cyclo-ligase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=purM PE=3 SV=2 436 772 3.0E-85
sp|B0VT70|PUR5_ACIBS Phosphoribosylformylglycinamidine cyclo-ligase OS=Acinetobacter baumannii (strain SDF) GN=purM PE=3 SV=1 436 772 3.0E-85
sp|B2HWV2|PUR5_ACIBC Phosphoribosylformylglycinamidine cyclo-ligase OS=Acinetobacter baumannii (strain ACICU) GN=purM PE=3 SV=1 436 772 3.0E-85
sp|B7I5C6|PUR5_ACIB5 Phosphoribosylformylglycinamidine cyclo-ligase OS=Acinetobacter baumannii (strain AB0057) GN=purM PE=3 SV=1 436 772 3.0E-85
sp|B7GY98|PUR5_ACIB3 Phosphoribosylformylglycinamidine cyclo-ligase OS=Acinetobacter baumannii (strain AB307-0294) GN=purM PE=3 SV=1 436 772 3.0E-85
sp|Q65MS6|PUR5_BACLD Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=purM PE=3 SV=2 437 772 7.0E-85
sp|Q0VP77|PUR5_ALCBS Phosphoribosylformylglycinamidine cyclo-ligase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=purM PE=3 SV=1 431 772 1.0E-84
sp|B1HTV6|PUR5_LYSSC Phosphoribosylformylglycinamidine cyclo-ligase OS=Lysinibacillus sphaericus (strain C3-41) GN=purM PE=3 SV=1 438 774 2.0E-84
sp|B1J1M3|PUR5_PSEPW Phosphoribosylformylglycinamidine cyclo-ligase OS=Pseudomonas putida (strain W619) GN=purM PE=3 SV=1 431 789 2.0E-84
sp|B8FJY6|PUR5_DESAA Phosphoribosylformylglycinamidine cyclo-ligase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=purM PE=3 SV=1 434 775 2.0E-84
sp|Q7NMP5|PUR5_GLOVI Phosphoribosylformylglycinamidine cyclo-ligase OS=Gloeobacter violaceus (strain PCC 7421) GN=purM PE=3 SV=1 436 774 2.0E-84
sp|B7K0I0|PUR5_CYAP8 Phosphoribosylformylglycinamidine cyclo-ligase OS=Cyanothece sp. (strain PCC 8801) GN=purM PE=3 SV=1 436 774 4.0E-84
sp|A4IJX5|PUR5_GEOTN Phosphoribosylformylglycinamidine cyclo-ligase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=purM PE=3 SV=1 438 774 6.0E-84
sp|C4Z478|PUR5_EUBE2 Phosphoribosylformylglycinamidine cyclo-ligase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=purM PE=3 SV=1 436 782 6.0E-84
sp|Q88MA9|PUR5_PSEPK Phosphoribosylformylglycinamidine cyclo-ligase OS=Pseudomonas putida (strain KT2440) GN=purM PE=3 SV=1 431 789 8.0E-84
sp|B0KT52|PUR5_PSEPG Phosphoribosylformylglycinamidine cyclo-ligase OS=Pseudomonas putida (strain GB-1) GN=purM PE=3 SV=1 431 789 8.0E-84
sp|A5W7R7|PUR5_PSEP1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=purM PE=3 SV=1 431 789 8.0E-84
sp|Q5N490|PUR5_SYNP6 Phosphoribosylformylglycinamidine cyclo-ligase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=purM PE=3 SV=2 436 773 2.0E-83
sp|Q31PY7|PUR5_SYNE7 Phosphoribosylformylglycinamidine cyclo-ligase OS=Synechococcus elongatus (strain PCC 7942) GN=purM PE=3 SV=1 436 773 2.0E-83
sp|Q1IDL2|PUR5_PSEE4 Phosphoribosylformylglycinamidine cyclo-ligase OS=Pseudomonas entomophila (strain L48) GN=purM PE=3 SV=1 431 772 2.0E-83
sp|Q83AZ0|PUR5_COXBU Phosphoribosylformylglycinamidine cyclo-ligase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=purM PE=3 SV=1 436 772 3.0E-83
sp|A9NA98|PUR5_COXBR Phosphoribosylformylglycinamidine cyclo-ligase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=purM PE=3 SV=1 436 772 3.0E-83
sp|A9KBZ3|PUR5_COXBN Phosphoribosylformylglycinamidine cyclo-ligase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=purM PE=3 SV=1 436 772 4.0E-83
sp|Q26255|PUR2_CHITE Trifunctional purine biosynthetic protein adenosine-3 OS=Chironomus tentans GN=GART PE=3 SV=1 420 777 5.0E-83
sp|B1WPZ0|PUR5_CYAA5 Phosphoribosylformylglycinamidine cyclo-ligase OS=Cyanothece sp. (strain ATCC 51142) GN=purM PE=3 SV=1 436 774 5.0E-83
sp|Q0AW29|PUR5_SYNWW Phosphoribosylformylglycinamidine cyclo-ligase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=purM PE=3 SV=1 433 774 6.0E-83
sp|Q8CT29|PUR5_STAES Phosphoribosylformylglycinamidine cyclo-ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=purM PE=3 SV=1 438 774 1.0E-82
sp|Q5HQ99|PUR5_STAEQ Phosphoribosylformylglycinamidine cyclo-ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=purM PE=3 SV=1 438 774 1.0E-82
sp|A8F8I1|PUR5_PSELT Phosphoribosylformylglycinamidine cyclo-ligase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=purM PE=3 SV=1 436 784 3.0E-82
sp|B2FRX8|PUR5_STRMK Phosphoribosylformylglycinamidine cyclo-ligase OS=Stenotrophomonas maltophilia (strain K279a) GN=purM PE=3 SV=1 431 759 7.0E-82
sp|P99163|PUR5_STAAN Phosphoribosylformylglycinamidine cyclo-ligase OS=Staphylococcus aureus (strain N315) GN=purM PE=1 SV=1 438 776 1.0E-81
sp|P67721|PUR5_STAAM Phosphoribosylformylglycinamidine cyclo-ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=purM PE=3 SV=1 438 776 1.0E-81
sp|A5IRV8|PUR5_STAA9 Phosphoribosylformylglycinamidine cyclo-ligase OS=Staphylococcus aureus (strain JH9) GN=purM PE=3 SV=1 438 776 1.0E-81
sp|A6U0N9|PUR5_STAA2 Phosphoribosylformylglycinamidine cyclo-ligase OS=Staphylococcus aureus (strain JH1) GN=purM PE=3 SV=1 438 776 1.0E-81
sp|A7X0W4|PUR5_STAA1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=purM PE=3 SV=1 438 776 1.0E-81
sp|Q8NX90|PUR5_STAAW Phosphoribosylformylglycinamidine cyclo-ligase OS=Staphylococcus aureus (strain MW2) GN=purM PE=3 SV=1 438 776 1.0E-81
sp|Q6GAE2|PUR5_STAAS Phosphoribosylformylglycinamidine cyclo-ligase OS=Staphylococcus aureus (strain MSSA476) GN=purM PE=3 SV=1 438 776 1.0E-81
sp|B4SN29|PUR5_STRM5 Phosphoribosylformylglycinamidine cyclo-ligase OS=Stenotrophomonas maltophilia (strain R551-3) GN=purM PE=3 SV=1 431 766 2.0E-81
sp|Q05728|PUR5_ARATH Phosphoribosylformylglycinamidine cyclo-ligase, chloroplastic OS=Arabidopsis thaliana GN=PUR5 PE=1 SV=2 426 773 2.0E-81
sp|Q3BQX8|PUR5_XANC5 Phosphoribosylformylglycinamidine cyclo-ligase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=purM PE=3 SV=1 436 773 2.0E-81
sp|Q2YX52|PUR5_STAAB Phosphoribosylformylglycinamidine cyclo-ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=purM PE=3 SV=1 438 776 2.0E-81
sp|Q6GI13|PUR5_STAAR Phosphoribosylformylglycinamidine cyclo-ligase OS=Staphylococcus aureus (strain MRSA252) GN=purM PE=3 SV=1 438 776 3.0E-81
sp|Q49WJ5|PUR5_STAS1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=purM PE=3 SV=1 438 774 4.0E-81
sp|Q8P725|PUR5_XANCP Phosphoribosylformylglycinamidine cyclo-ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=purM PE=3 SV=1 436 776 4.0E-81
sp|Q4UX30|PUR5_XANC8 Phosphoribosylformylglycinamidine cyclo-ligase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=purM PE=3 SV=1 436 776 4.0E-81
sp|Q892X1|PUR5_CLOTE Phosphoribosylformylglycinamidine cyclo-ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=purM PE=3 SV=1 437 774 4.0E-81
sp|A8MLI7|PUR5_ALKOO Phosphoribosylformylglycinamidine cyclo-ligase OS=Alkaliphilus oremlandii (strain OhILAs) GN=purM PE=3 SV=1 436 774 5.0E-81
sp|A8Z1L3|PUR5_STAAT Phosphoribosylformylglycinamidine cyclo-ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=purM PE=3 SV=1 438 776 5.0E-81
sp|A6QFS9|PUR5_STAAE Phosphoribosylformylglycinamidine cyclo-ligase OS=Staphylococcus aureus (strain Newman) GN=purM PE=3 SV=1 438 776 5.0E-81
sp|Q5HH13|PUR5_STAAC Phosphoribosylformylglycinamidine cyclo-ligase OS=Staphylococcus aureus (strain COL) GN=purM PE=3 SV=1 438 776 5.0E-81
sp|Q2FZI8|PUR5_STAA8 Phosphoribosylformylglycinamidine cyclo-ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=purM PE=3 SV=1 438 776 5.0E-81
sp|Q2FI07|PUR5_STAA3 Phosphoribosylformylglycinamidine cyclo-ligase OS=Staphylococcus aureus (strain USA300) GN=purM PE=3 SV=1 438 776 5.0E-81
sp|B0RQI6|PUR5_XANCB Phosphoribosylformylglycinamidine cyclo-ligase OS=Xanthomonas campestris pv. campestris (strain B100) GN=purM PE=3 SV=1 436 776 1.0E-80
sp|A7HDB7|PUR5_ANADF Phosphoribosylformylglycinamidine cyclo-ligase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=purM PE=3 SV=1 435 748 1.0E-80
sp|C4ZH75|PUR5_EUBR3 Phosphoribosylformylglycinamidine cyclo-ligase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=purM PE=3 SV=1 436 779 1.0E-80
sp|Q24QH4|PUR5_DESHY Phosphoribosylformylglycinamidine cyclo-ligase OS=Desulfitobacterium hafniense (strain Y51) GN=purM PE=3 SV=1 437 780 2.0E-80
sp|B8FP03|PUR5_DESHD Phosphoribosylformylglycinamidine cyclo-ligase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=purM PE=3 SV=1 437 780 2.0E-80
sp|C3L2V1|PUR5_CLOB6 Phosphoribosylformylglycinamidine cyclo-ligase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=purM PE=3 SV=1 436 774 2.0E-80
sp|Q8PID9|PUR5_XANAC Phosphoribosylformylglycinamidine cyclo-ligase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=purM PE=3 SV=1 436 773 2.0E-80
sp|A0Q1J2|PUR5_CLONN Phosphoribosylformylglycinamidine cyclo-ligase OS=Clostridium novyi (strain NT) GN=purM PE=3 SV=1 437 772 4.0E-80
sp|Q9RHX4|PUR2_CORAM Phosphoribosylamine--glycine ligase OS=Corynebacterium ammoniagenes GN=purD PE=3 SV=1 4 427 5.0E-80
sp|Q9PFS0|PUR5_XYLFA Phosphoribosylformylglycinamidine cyclo-ligase OS=Xylella fastidiosa (strain 9a5c) GN=purM PE=3 SV=1 438 746 5.0E-80
sp|Q4L580|PUR5_STAHJ Phosphoribosylformylglycinamidine cyclo-ligase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=purM PE=3 SV=1 438 776 7.0E-80
sp|Q5H3C0|PUR5_XANOR Phosphoribosylformylglycinamidine cyclo-ligase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=purM PE=3 SV=2 436 746 7.0E-80
sp|B2SJY0|PUR5_XANOP Phosphoribosylformylglycinamidine cyclo-ligase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=purM PE=3 SV=1 436 746 7.0E-80
sp|Q2P674|PUR5_XANOM Phosphoribosylformylglycinamidine cyclo-ligase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=purM PE=3 SV=1 436 746 7.0E-80
sp|Q87B94|PUR5_XYLFT Phosphoribosylformylglycinamidine cyclo-ligase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=purM PE=3 SV=1 438 773 2.0E-79
sp|B9DQ40|PUR5_STACT Phosphoribosylformylglycinamidine cyclo-ligase OS=Staphylococcus carnosus (strain TM300) GN=purM PE=3 SV=1 435 774 2.0E-79
sp|B1KZ57|PUR5_CLOBM Phosphoribosylformylglycinamidine cyclo-ligase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=purM PE=3 SV=1 436 774 4.0E-79
sp|Q0ABB7|PUR5_ALKEH Phosphoribosylformylglycinamidine cyclo-ligase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=purM PE=3 SV=1 432 778 5.0E-79
sp|A4XKZ4|PUR5_CALS8 Phosphoribosylformylglycinamidine cyclo-ligase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=purM PE=3 SV=1 437 760 6.0E-79
sp|B1IL59|PUR5_CLOBK Phosphoribosylformylglycinamidine cyclo-ligase OS=Clostridium botulinum (strain Okra / Type B1) GN=purM PE=3 SV=1 436 774 9.0E-79
sp|A7GH98|PUR5_CLOBL Phosphoribosylformylglycinamidine cyclo-ligase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=purM PE=3 SV=1 436 774 1.0E-78
sp|A5N0Q2|PUR5_CLOK5 Phosphoribosylformylglycinamidine cyclo-ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=purM PE=3 SV=1 436 776 1.0E-78
sp|B9E4K8|PUR5_CLOK1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Clostridium kluyveri (strain NBRC 12016) GN=purM PE=3 SV=1 436 776 1.0E-78
sp|C1FV78|PUR5_CLOBJ Phosphoribosylformylglycinamidine cyclo-ligase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=purM PE=3 SV=1 436 774 2.0E-78
sp|A7FXD5|PUR5_CLOB1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=purM PE=3 SV=1 436 774 2.0E-78
sp|B7KJK8|PUR5_CYAP7 Phosphoribosylformylglycinamidine cyclo-ligase OS=Cyanothece sp. (strain PCC 7424) GN=purM PE=3 SV=1 436 754 2.0E-78
sp|B0JTF5|PUR5_MICAN Phosphoribosylformylglycinamidine cyclo-ligase OS=Microcystis aeruginosa (strain NIES-843) GN=purM PE=3 SV=1 436 773 4.0E-78
sp|Q8DHY2|PUR5_THEEB Phosphoribosylformylglycinamidine cyclo-ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=purM PE=3 SV=1 436 751 5.0E-78
sp|Q7V9S9|PUR5_PROMA Phosphoribosylformylglycinamidine cyclo-ligase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=purM PE=3 SV=1 436 787 5.0E-78
sp|Q88U30|PUR2_LACPL Phosphoribosylamine--glycine ligase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=purD PE=3 SV=1 5 423 8.0E-78
sp|P16340|PUR2_DROPS Trifunctional purine biosynthetic protein adenosine-3 OS=Drosophila pseudoobscura pseudoobscura GN=ade3 PE=3 SV=2 489 789 2.0E-63
sp|P00967|PUR2_DROME Trifunctional purine biosynthetic protein adenosine-3 OS=Drosophila melanogaster GN=ade3 PE=1 SV=2 489 789 4.0E-59
[Show less]

GO

GO Term Description Terminal node
GO:0004637 phosphoribosylamine-glycine ligase activity Yes
GO:0009113 purine nucleobase biosynthetic process Yes
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0016874 ligase activity No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:1901576 organic substance biosynthetic process No
GO:0009112 nucleobase metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0046483 heterocycle metabolic process No
GO:0009058 biosynthetic process No
GO:0008150 biological_process No
GO:0006144 purine nucleobase metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0044281 small molecule metabolic process No
GO:0044238 primary metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0072521 purine-containing compound metabolic process No
GO:0046112 nucleobase biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0003674 molecular_function No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0072522 purine-containing compound biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2434
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6108 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4592
Ophiocordyceps camponoti-floridani Ophcf2|06096
Ophiocordyceps camponoti-rufipedis Ophun1|3881
Ophiocordyceps kimflemingae Ophio5|5882
Ophiocordyceps subramaniannii Hirsu2|3455

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6108
MAHLRVLLIGNGGREHALAWKLGQSPLVQHIYALPGNGGTASCPKVTNVTSVSPDDFDAIVQFAQSNGVSLAVPG
PEAPLVGGIEAYLRRAGIPCFGPSKEAARLEGSKTYSKDFMLKYGIPTATYRNFSDYQQALDYLDLVGHNVVIKA
TGLAAGKGVLIPTSLLEAQDALRHIMVDKAFGDAGNEVVIEEFLQGDELSVLTFCDGYSFKSLPLAQDHKRILDG
DQGPNTGGMGCYAPTNIATKDLVERIDGEILEATFRGMRREKQPFRGVLFTGLMVTSDGPKVLEYNVRFGDPETQ
TLLPLLSPETDLAEIMMACTQGYLDNCHVGVQNKFSATVVVAAGGYPGSYAKGTPMTVQPCPAGSTIFHAGTAVD
GSQLKTSGGRVISINSVGSSLRTAVDAAYAALASNMIEFEGMFYRKDIAHRAFRESSKQAMTYAQAGVDIQAGND
FVEKIRRAVASTSRAGADAQIGGFGGELDLSQCGFPGAPVLVGAIDGVGTKLMIAQAIGKHDTVGIDLVAMNVND
LIVQGATPLMFLDYYGCSKLDLPSAADFVQGVADGCRQAACALVGGETAEMPGMYRGQDYDAAGCAVGAVAHHAR
LPKLDQMAEGDVLLGLASSGIHSNGFSLVRRIIQAANLDYTSPAPWVEASGSSSATTPTIGHSLLTPTRIYVASL
LPALPHIKGLAHITGGGLVENVPRMLPDGLSASVEFGSWPRPPVFDWLRDAGNVCPAEMCRTFNLGIGMVVAVDA
ARADQVTRILAASESVFRIGRLVRRQPGMAACVIAGLDSWKA*
Coding >OphauG2|6108
ATGGCTCATCTTCGCGTGCTGCTCATTGGCAATGGCGGACGCGAGCATGCGCTGGCCTGGAAACTTGGCCAGTCG
CCGCTAGTGCAACACATCTATGCCCTCCCAGGCAACGGCGGCACCGCATCGTGTCCCAAAGTAACAAACGTCACA
TCAGTATCGCCAGATGACTTTGACGCCATTGTACAGTTTGCCCAGAGCAATGGGGTCAGCCTGGCGGTGCCTGGA
CCCGAGGCCCCTCTTGTCGGTGGCATCGAGGCGTATTTACGTCGCGCCGGCATCCCTTGCTTTGGCCCGTCCAAG
GAGGCAGCTCGGCTCGAGGGAAGTAAGACGTACTCGAAAGACTTTATGCTAAAATACGGCATCCCGACGGCAACA
TATCGCAACTTTTCGGATTATCAGCAAGCGCTCGATTACCTCGACTTGGTTGGCCACAATGTGGTGATCAAAGCC
ACTGGCTTGGCAGCTGGCAAGGGCGTTCTCATTCCTACCTCGCTCCTAGAAGCTCAAGATGCATTGCGGCACATC
ATGGTGGACAAGGCGTTTGGCGATGCAGGCAACGAGGTGGTGATTGAAGAATTCTTGCAAGGAGACGAGCTAAGC
GTGCTCACCTTCTGCGATGGCTACTCGTTCAAGTCGCTGCCACTGGCCCAGGACCACAAGAGAATTCTGGATGGA
GACCAAGGCCCCAACACAGGCGGCATGGGCTGCTACGCACCTACAAACATTGCAACCAAGGACCTGGTGGAAAGA
ATCGATGGCGAGATTCTCGAAGCTACATTTCGGGGTATGCGCCGCGAAAAACAGCCCTTTCGTGGCGTCCTCTTT
ACCGGCCTCATGGTGACGAGCGACGGCCCAAAGGTGCTCGAGTACAACGTTCGCTTTGGCGATCCCGAGACGCAG
ACGTTGCTGCCGCTCTTGTCGCCCGAAACAGACCTGGCCGAAATCATGATGGCCTGCACCCAGGGCTATCTCGAC
AATTGCCATGTTGGAGTCCAAAACAAGTTCAGCGCAACGGTGGTGGTGGCTGCTGGCGGGTATCCAGGCTCGTAT
GCAAAGGGCACGCCTATGACGGTGCAGCCCTGTCCTGCGGGCAGCACGATATTCCATGCGGGCACCGCAGTGGAC
GGAAGCCAGCTCAAGACGTCGGGAGGCCGGGTGATATCCATCAACTCGGTTGGCAGCTCGTTGAGAACCGCCGTC
GACGCAGCGTATGCAGCCCTGGCATCCAACATGATTGAATTCGAGGGCATGTTCTACCGCAAGGACATTGCCCAT
CGCGCCTTTAGAGAGTCCAGCAAACAGGCCATGACATACGCACAGGCTGGAGTAGATATCCAAGCCGGCAACGAC
TTTGTCGAGAAAATCCGCAGAGCCGTGGCCAGCACCAGCCGTGCGGGGGCCGACGCACAGATTGGCGGCTTCGGC
GGCGAGCTCGACCTCTCGCAATGCGGCTTCCCCGGCGCCCCCGTCCTGGTGGGAGCCATTGACGGCGTCGGCACC
AAGCTCATGATTGCCCAGGCCATTGGCAAGCACGACACGGTTGGTATCGACCTGGTGGCCATGAATGTCAACGAC
CTGATTGTCCAAGGCGCCACGCCCCTCATGTTTCTCGACTACTATGGCTGCAGTAAACTCGACCTGCCCTCGGCC
GCTGACTTTGTCCAAGGCGTTGCCGACGGCTGTCGTCAGGCCGCATGTGCTCTGGTGGGCGGCGAGACGGCCGAG
ATGCCGGGCATGTATCGCGGCCAAGACTATGATGCTGCTGGCTGCGCCGTCGGAGCCGTCGCTCATCATGCCCGC
CTGCCCAAACTCGACCAAATGGCCGAGGGCGATGTGCTTCTTGGCCTGGCATCGAGCGGCATCCACTCCAACGGC
TTCTCCCTTGTCCGCCGCATCATCCAGGCCGCTAACCTCGACTACACGTCTCCCGCGCCCTGGGTTGAAGCCTCG
GGCTCATCCTCCGCTACAACCCCCACTATTGGCCACTCCCTCTTGACTCCCACGCGCATCTACGTTGCCAGTCTC
CTCCCCGCGCTCCCCCATATCAAGGGCCTCGCACACATCACTGGCGGCGGCCTTGTCGAAAATGTGCCCCGTATG
CTTCCTGACGGCCTCTCCGCTTCGGTTGAATTTGGCTCCTGGCCTCGCCCCCCCGTTTTTGACTGGCTGCGCGAC
GCCGGCAATGTCTGCCCTGCAGAAATGTGTCGCACTTTTAATCTCGGTATCGGTATGGTGGTCGCTGTCGACGCC
GCGCGCGCAGACCAGGTGACTCGTATCCTTGCCGCTTCAGAGTCTGTCTTTCGCATCGGCCGTCTTGTCCGCCGC
CAGCCTGGCATGGCTGCCTGCGTTATTGCTGGCTTGGATTCATGGAAAGCTTGA
Transcript >OphauG2|6108
ATGGCTCATCTTCGCGTGCTGCTCATTGGCAATGGCGGACGCGAGCATGCGCTGGCCTGGAAACTTGGCCAGTCG
CCGCTAGTGCAACACATCTATGCCCTCCCAGGCAACGGCGGCACCGCATCGTGTCCCAAAGTAACAAACGTCACA
TCAGTATCGCCAGATGACTTTGACGCCATTGTACAGTTTGCCCAGAGCAATGGGGTCAGCCTGGCGGTGCCTGGA
CCCGAGGCCCCTCTTGTCGGTGGCATCGAGGCGTATTTACGTCGCGCCGGCATCCCTTGCTTTGGCCCGTCCAAG
GAGGCAGCTCGGCTCGAGGGAAGTAAGACGTACTCGAAAGACTTTATGCTAAAATACGGCATCCCGACGGCAACA
TATCGCAACTTTTCGGATTATCAGCAAGCGCTCGATTACCTCGACTTGGTTGGCCACAATGTGGTGATCAAAGCC
ACTGGCTTGGCAGCTGGCAAGGGCGTTCTCATTCCTACCTCGCTCCTAGAAGCTCAAGATGCATTGCGGCACATC
ATGGTGGACAAGGCGTTTGGCGATGCAGGCAACGAGGTGGTGATTGAAGAATTCTTGCAAGGAGACGAGCTAAGC
GTGCTCACCTTCTGCGATGGCTACTCGTTCAAGTCGCTGCCACTGGCCCAGGACCACAAGAGAATTCTGGATGGA
GACCAAGGCCCCAACACAGGCGGCATGGGCTGCTACGCACCTACAAACATTGCAACCAAGGACCTGGTGGAAAGA
ATCGATGGCGAGATTCTCGAAGCTACATTTCGGGGTATGCGCCGCGAAAAACAGCCCTTTCGTGGCGTCCTCTTT
ACCGGCCTCATGGTGACGAGCGACGGCCCAAAGGTGCTCGAGTACAACGTTCGCTTTGGCGATCCCGAGACGCAG
ACGTTGCTGCCGCTCTTGTCGCCCGAAACAGACCTGGCCGAAATCATGATGGCCTGCACCCAGGGCTATCTCGAC
AATTGCCATGTTGGAGTCCAAAACAAGTTCAGCGCAACGGTGGTGGTGGCTGCTGGCGGGTATCCAGGCTCGTAT
GCAAAGGGCACGCCTATGACGGTGCAGCCCTGTCCTGCGGGCAGCACGATATTCCATGCGGGCACCGCAGTGGAC
GGAAGCCAGCTCAAGACGTCGGGAGGCCGGGTGATATCCATCAACTCGGTTGGCAGCTCGTTGAGAACCGCCGTC
GACGCAGCGTATGCAGCCCTGGCATCCAACATGATTGAATTCGAGGGCATGTTCTACCGCAAGGACATTGCCCAT
CGCGCCTTTAGAGAGTCCAGCAAACAGGCCATGACATACGCACAGGCTGGAGTAGATATCCAAGCCGGCAACGAC
TTTGTCGAGAAAATCCGCAGAGCCGTGGCCAGCACCAGCCGTGCGGGGGCCGACGCACAGATTGGCGGCTTCGGC
GGCGAGCTCGACCTCTCGCAATGCGGCTTCCCCGGCGCCCCCGTCCTGGTGGGAGCCATTGACGGCGTCGGCACC
AAGCTCATGATTGCCCAGGCCATTGGCAAGCACGACACGGTTGGTATCGACCTGGTGGCCATGAATGTCAACGAC
CTGATTGTCCAAGGCGCCACGCCCCTCATGTTTCTCGACTACTATGGCTGCAGTAAACTCGACCTGCCCTCGGCC
GCTGACTTTGTCCAAGGCGTTGCCGACGGCTGTCGTCAGGCCGCATGTGCTCTGGTGGGCGGCGAGACGGCCGAG
ATGCCGGGCATGTATCGCGGCCAAGACTATGATGCTGCTGGCTGCGCCGTCGGAGCCGTCGCTCATCATGCCCGC
CTGCCCAAACTCGACCAAATGGCCGAGGGCGATGTGCTTCTTGGCCTGGCATCGAGCGGCATCCACTCCAACGGC
TTCTCCCTTGTCCGCCGCATCATCCAGGCCGCTAACCTCGACTACACGTCTCCCGCGCCCTGGGTTGAAGCCTCG
GGCTCATCCTCCGCTACAACCCCCACTATTGGCCACTCCCTCTTGACTCCCACGCGCATCTACGTTGCCAGTCTC
CTCCCCGCGCTCCCCCATATCAAGGGCCTCGCACACATCACTGGCGGCGGCCTTGTCGAAAATGTGCCCCGTATG
CTTCCTGACGGCCTCTCCGCTTCGGTTGAATTTGGCTCCTGGCCTCGCCCCCCCGTTTTTGACTGGCTGCGCGAC
GCCGGCAATGTCTGCCCTGCAGAAATGTGTCGCACTTTTAATCTCGGTATCGGTATGGTGGTCGCTGTCGACGCC
GCGCGCGCAGACCAGGTGACTCGTATCCTTGCCGCTTCAGAGTCTGTCTTTCGCATCGGCCGTCTTGTCCGCCGC
CAGCCTGGCATGGCTGCCTGCGTTATTGCTGGCTTGGATTCATGGAAAGCTTGA
Gene >OphauG2|6108
ATGGCTCATCTTCGCGTGCTGCTCATTGGCAATGGCGGACGCGAGCATGCGCTGGCCTGGAAACTTGGCCAGTCG
CCGCTAGTGCAACACATCTATGCCCTCCCAGGCAACGGCGGCACCGCATCGTGTCCCAAAGTAACAAACGTCACA
TCAGTATCGCCAGATGACTTTGACGCCATTGTACAGTTTGCCCAGAGCAATGGGGTCAGCCTGGCGGTGCCTGGA
CCCGAGGCCCCTCTTGTCGGTGGCATCGAGGCGTATTTACGTCGCGCCGGCATCCCTTGCTTTGGCCCGTCCAAG
GAGGCAGCTCGGCTCGAGGGAAGTAAGACGTACTCGAAAGACTTTATGCTAAAATACGGCATCCCGACGGCAACA
TATCGCAACTTTTCGGATTATCAGCAAGCGCTCGATTACCTCGACTTGGTTGGCCACAATGTGGTGATCAAAGCC
ACTGGCTTGGCAGCTGGCAAGGGCGTTCTCATTCCTACCTCGCTCCTAGAAGCTCAAGATGCATTGCGGCACATC
ATGGTGGACAAGGCGTTTGGCGATGCAGGCAACGAGGTGGTGATTGAAGAATTCTTGCAAGGAGACGAGCTAAGC
GTGCTCACCTTCTGCGATGGCTACTCGTTCAAGTCGCTGCCACTGGCCCAGGACCACAAGAGAATTCTGGATGGA
GACCAAGGCCCCAACACAGGCGGCATGGGCTGCTACGCACCTACAAACATTGCAACCAAGGACCTGGTGGAAAGA
ATCGATGGCGAGATTCTCGAAGCTACATTTCGGGGTATGCGCCGCGAAAAACAGCCCTTTCGTGGCGTCCTCTTT
ACCGGCCTCATGGTGACGAGCGACGGCCCAAAGGTGCTCGAGTACAACGTTCGCTTTGGCGATCCCGAGACGCAG
ACGTTGCTGCCGCTCTTGTCGCCCGAAACAGACCTGGCCGAAATCATGATGGCCTGCACCCAGGGCTATCTCGAC
AATTGCCATGTTGGAGTCCAAAACAAGTTCAGCGCAACGGTGGTGGTGGCTGCTGGCGGGTATCCAGGCTCGTAT
GCAAAGGGCACGCCTATGACGGTGCAGCCCTGTCCTGCGGGCAGCACGATATTCCATGCGGGCACCGCAGTGGAC
GGAAGCCAGCTCAAGACGTCGGGAGGCCGGGTGATATCCATCAACTCGGTTGGCAGCTCGTTGAGAACCGCCGTC
GACGCAGCGTATGCAGCCCTGGCATCCAACATGATTGAATTCGAGGGCATGTTCTACCGCAAGGACATTGCCCAT
CGCGCCTTTAGAGAGTCCAGCAAACAGGCCATGACATACGCACAGGCTGGAGTAGATATCCAAGCCGGCAACGAC
TTTGTCGAGAAAATCCGCAGAGCCGTGGCCAGCACCAGCCGTGCGGGGGCCGACGCACAGATTGGCGGCTTCGGC
GGCGAGCTCGACCTCTCGCAATGCGGCTTCCCCGGCGCCCCCGTCCTGGTGGGAGCCATTGACGGCGTCGGCACC
AAGCTCATGATTGCCCAGGCCATTGGCAAGCACGACACGGTTGGTATCGACCTGGTGGCCATGAATGTCAACGAC
CTGATTGTCCAAGGCGCCACGCCCCTCATGTTTCTCGACTACTATGGCTGCAGTAAACTCGACCTGCCCTCGGCC
GCTGACTTTGTCCAAGGCGTTGCCGACGGCTGTCGTCAGGCCGCATGTGCTCTGGTGGGCGGCGAGACGGCCGAG
ATGCCGGGCATGTATCGCGGCCAAGACTATGATGCTGCTGGCTGCGCCGTCGGAGCCGTCGCTCATCATGCCCGC
CTGCCCAAACTCGACCAAATGGCCGAGGGCGATGTGCTTCTTGGCCTGGCATCGAGCGGCATCCACTCCAACGGC
TTCTCCCTTGTCCGCCGCATCATCCAGGCCGCTAACCTCGACTACACGTCTCCCGCGCCCTGGGTTGAAGCCTCG
GGCTCATCCTCCGCTACAACCCCCACTATTGGCCACTCCCTCTTGACTCCCACGCGCATCTACGTTGCCAGTCTC
CTCCCCGCGCTCCCCCATATCAAGGGCCTCGCACACATCACTGGCGGCGGCCTTGTCGAAAATGTGCCCCGTATG
CTTCCTGACGGCCTCTCCGCTTCGGTTGAATTTGGCTCCTGGCCTCGCCCCCCCGTTTTTGACTGGCTGCGCGAC
GCCGGCAATGTCTGCCCTGCAGAAATGTGTCGCACTTTTAATCTCGGTATCGGTATGGTGGTCGCTGTCGACGCC
GCGCGCGCAGACCAGGTGACTCGTATCCTTGCCGCTTCAGAGTCTGTCTTTCGCATCGGCCGTCTTGTCCGCCGC
CAGCCTGGCATGGCTGCCTGCGTTATTGCTGGCTTGGATTCATGGAAAGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail