Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6094
Gene name
LocationContig_60:430..1615
Strand-
Gene length (bp)1185
Transcript length (bp)1047
Coding sequence length (bp)1047
Protein length (aa) 349

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00557 Peptidase_M24 Metallopeptidase family M24 7.0E-48 88 318

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59730|MAP1_SCHPO Methionine aminopeptidase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fma1 PE=1 SV=1 25 336 3.0E-138
sp|Q01662|MAP1_YEAST Methionine aminopeptidase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAP1 PE=1 SV=2 10 334 2.0E-133
sp|Q4QRK0|MAP11_DANRE Methionine aminopeptidase 1 OS=Danio rerio GN=metap1 PE=2 SV=2 28 331 2.0E-124
sp|Q5I0A0|MAP1_XENTR Methionine aminopeptidase 1 OS=Xenopus tropicalis GN=metap1 PE=2 SV=1 28 331 2.0E-120
sp|Q7ZWV9|MAP1_XENLA Methionine aminopeptidase 1 OS=Xenopus laevis GN=metap1 PE=2 SV=2 18 331 3.0E-119
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59730|MAP1_SCHPO Methionine aminopeptidase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fma1 PE=1 SV=1 25 336 3.0E-138
sp|Q01662|MAP1_YEAST Methionine aminopeptidase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAP1 PE=1 SV=2 10 334 2.0E-133
sp|Q4QRK0|MAP11_DANRE Methionine aminopeptidase 1 OS=Danio rerio GN=metap1 PE=2 SV=2 28 331 2.0E-124
sp|Q5I0A0|MAP1_XENTR Methionine aminopeptidase 1 OS=Xenopus tropicalis GN=metap1 PE=2 SV=1 28 331 2.0E-120
sp|Q7ZWV9|MAP1_XENLA Methionine aminopeptidase 1 OS=Xenopus laevis GN=metap1 PE=2 SV=2 18 331 3.0E-119
sp|Q5ZIM5|MAP1_CHICK Methionine aminopeptidase 1 OS=Gallus gallus GN=METAP1 PE=2 SV=1 28 327 6.0E-119
sp|Q9SLN5|MAP1A_ARATH Methionine aminopeptidase 1A OS=Arabidopsis thaliana GN=MAP1A PE=1 SV=1 30 332 2.0E-118
sp|A6QLA4|MAP1_BOVIN Methionine aminopeptidase 1 OS=Bos taurus GN=METAP1 PE=2 SV=1 28 327 8.0E-118
sp|Q5RBF3|MAP1_PONAB Methionine aminopeptidase 1 OS=Pongo abelii GN=METAP1 PE=2 SV=1 28 327 1.0E-117
sp|Q8BP48|MAP11_MOUSE Methionine aminopeptidase 1 OS=Mus musculus GN=Metap1 PE=1 SV=1 28 331 2.0E-117
sp|P53582|MAP11_HUMAN Methionine aminopeptidase 1 OS=Homo sapiens GN=METAP1 PE=1 SV=2 28 327 3.0E-117
sp|Q54WU3|MAP11_DICDI Methionine aminopeptidase 1 OS=Dictyostelium discoideum GN=metap1 PE=3 SV=1 30 331 3.0E-105
sp|Q9FV50|MAP1D_ARATH Methionine aminopeptidase 1D, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=MAP1D PE=1 SV=1 39 325 3.0E-74
sp|Q4VBS4|MAP12_DANRE Methionine aminopeptidase 1D, mitochondrial OS=Danio rerio GN=metap1d PE=2 SV=1 39 330 2.0E-73
sp|P0A5J3|MAP1_MYCBO Methionine aminopeptidase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=map PE=3 SV=1 37 325 4.0E-72
sp|P9WK19|MAP12_MYCTU Methionine aminopeptidase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=map PE=1 SV=1 37 325 4.0E-72
sp|P9WK18|MAP12_MYCTO Methionine aminopeptidase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=map PE=3 SV=1 37 325 4.0E-72
sp|Q9FV52|MAP1B_ARATH Methionine aminopeptidase 1B, chloroplastic OS=Arabidopsis thaliana GN=MAP1B PE=2 SV=2 45 325 6.0E-72
sp|Q9CPW9|MAP12_MOUSE Methionine aminopeptidase 1D, mitochondrial OS=Mus musculus GN=Metap1d PE=2 SV=1 76 325 6.0E-68
sp|Q9FV51|MAP1C_ARATH Methionine aminopeptidase 1C, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=MAP1C PE=2 SV=2 45 325 2.0E-67
sp|Q6UB28|MAP12_HUMAN Methionine aminopeptidase 1D, mitochondrial OS=Homo sapiens GN=METAP1D PE=1 SV=1 45 325 4.0E-66
sp|P53579|MAP11_SYNY3 Methionine aminopeptidase A OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0918 PE=3 SV=1 76 325 4.0E-66
sp|Q54VU7|MAP12_DICDI Methionine aminopeptidase 1D, mitochondrial OS=Dictyostelium discoideum GN=metap1d PE=3 SV=1 78 325 3.0E-64
sp|P44421|MAP1_HAEIN Methionine aminopeptidase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=map PE=3 SV=1 89 337 7.0E-64
sp|Q9ZCD3|MAP1_RICPR Methionine aminopeptidase OS=Rickettsia prowazekii (strain Madrid E) GN=map PE=1 SV=1 89 325 5.0E-63
sp|P0AE21|MAP1_SHIFL Methionine aminopeptidase OS=Shigella flexneri GN=map PE=3 SV=1 87 340 1.0E-62
sp|P0AE18|MAP1_ECOLI Methionine aminopeptidase OS=Escherichia coli (strain K12) GN=map PE=1 SV=1 87 340 1.0E-62
sp|P0AE19|MAP1_ECOL6 Methionine aminopeptidase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=map PE=3 SV=1 87 340 1.0E-62
sp|P0AE20|MAP1_ECO57 Methionine aminopeptidase OS=Escherichia coli O157:H7 GN=map PE=3 SV=1 87 340 1.0E-62
sp|P0A1X6|MAP1_SALTY Methionine aminopeptidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=map PE=1 SV=2 78 331 2.0E-62
sp|P0A1X7|MAP1_SALTI Methionine aminopeptidase OS=Salmonella typhi GN=map PE=3 SV=2 78 331 2.0E-62
sp|P57324|MAP1_BUCAI Methionine aminopeptidase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=map PE=3 SV=1 87 330 1.0E-58
sp|Q8K9T1|MAP1_BUCAP Methionine aminopeptidase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=map PE=3 SV=1 87 337 3.0E-58
sp|P53580|MAP12_SYNY3 Methionine aminopeptidase B OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0786 PE=3 SV=1 72 325 2.0E-55
sp|Q9Z6Q0|MAP1_CHLPN Methionine aminopeptidase OS=Chlamydia pneumoniae GN=map PE=3 SV=1 80 329 8.0E-54
sp|Q9PL68|MAP1_CHLMU Methionine aminopeptidase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=map PE=3 SV=2 74 325 1.0E-53
sp|Q89AP3|MAP1_BUCBP Methionine aminopeptidase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=map PE=3 SV=1 89 327 2.0E-53
sp|O84859|MAP1_CHLTR Methionine aminopeptidase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=map PE=3 SV=1 74 325 4.0E-53
sp|P19994|MAP11_BACSU Methionine aminopeptidase 1 OS=Bacillus subtilis (strain 168) GN=map PE=1 SV=1 89 325 4.0E-49
sp|Q9Z9J4|MAP1_BACHD Methionine aminopeptidase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=map PE=3 SV=1 87 325 5.0E-48
sp|P53581|MAP13_SYNY3 Methionine aminopeptidase C OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0555 PE=3 SV=1 74 327 3.0E-42
sp|Q59509|MAP1_MYCCT Methionine aminopeptidase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=map PE=3 SV=2 78 325 6.0E-42
sp|P50614|MAP1_CLOPE Methionine aminopeptidase OS=Clostridium perfringens (strain 13 / Type A) GN=map PE=3 SV=2 89 325 7.0E-40
sp|P69000|MAP1_CLOAB Methionine aminopeptidase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=map PE=3 SV=1 73 325 1.0E-39
sp|O66489|MAP1_AQUAE Methionine aminopeptidase OS=Aquifex aeolicus (strain VF5) GN=map PE=3 SV=1 78 325 4.0E-38
sp|P0A079|MAP1_STAAW Methionine aminopeptidase OS=Staphylococcus aureus (strain MW2) GN=map PE=3 SV=1 87 330 7.0E-38
sp|Q6G846|MAP1_STAAS Methionine aminopeptidase OS=Staphylococcus aureus (strain MSSA476) GN=map PE=3 SV=1 87 330 7.0E-38
sp|Q6GFG9|MAP1_STAAR Methionine aminopeptidase OS=Staphylococcus aureus (strain MRSA252) GN=map PE=3 SV=1 87 330 7.0E-38
sp|P99121|MAP1_STAAN Methionine aminopeptidase OS=Staphylococcus aureus (strain N315) GN=map PE=1 SV=1 87 330 7.0E-38
sp|P0A078|MAP1_STAAM Methionine aminopeptidase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=map PE=1 SV=1 87 330 7.0E-38
sp|Q5HEN6|MAP1_STAAC Methionine aminopeptidase OS=Staphylococcus aureus (strain COL) GN=map PE=3 SV=1 87 330 7.0E-38
sp|P0A080|MAP1_STAA1 Methionine aminopeptidase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=map PE=3 SV=1 87 330 7.0E-38
sp|Q8CRU9|MAP1_STAES Methionine aminopeptidase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=map PE=3 SV=2 87 330 1.0E-37
sp|Q5HN46|MAP1_STAEQ Methionine aminopeptidase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=map PE=3 SV=1 87 330 2.0E-37
sp|P9WK21|MAP11_MYCTU Methionine aminopeptidase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=map-1 PE=1 SV=1 109 325 3.0E-36
sp|P9WK20|MAP11_MYCTO Methionine aminopeptidase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=map-1 PE=3 SV=1 109 325 3.0E-36
sp|Q9ZJT0|MAP1_HELPJ Methionine aminopeptidase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=map PE=3 SV=1 87 327 2.0E-34
sp|P56102|MAP1_HELPY Methionine aminopeptidase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=map PE=3 SV=1 87 327 3.0E-34
sp|O83814|MAP1_TREPA Methionine aminopeptidase OS=Treponema pallidum (strain Nichols) GN=map PE=3 SV=1 88 329 3.0E-34
sp|O51132|MAP1_BORBU Methionine aminopeptidase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=map PE=3 SV=1 108 326 2.0E-32
sp|O34484|MAP12_BACSU Methionine aminopeptidase 2 OS=Bacillus subtilis (strain 168) GN=mapB PE=1 SV=1 80 325 5.0E-27
sp|P47418|MAP1_MYCGE Methionine aminopeptidase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=map PE=3 SV=1 88 325 1.0E-19
sp|Q5JGD1|MAP2_THEKO Methionine aminopeptidase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=map PE=3 SV=1 86 294 3.0E-19
sp|Q11132|MAP1_MYCPN Methionine aminopeptidase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=map PE=3 SV=1 78 325 5.0E-19
sp|B6YTG0|MAP2_THEON Methionine aminopeptidase OS=Thermococcus onnurineus (strain NA1) GN=map PE=1 SV=1 86 315 4.0E-18
sp|P56218|MAP2_PYRFU Methionine aminopeptidase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=map PE=1 SV=1 87 294 1.0E-17
sp|O52353|MAP1_MYCGA Methionine aminopeptidase OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=map PE=3 SV=2 87 325 2.0E-17
sp|Q9UYT4|MAP2_PYRAB Methionine aminopeptidase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=map PE=3 SV=1 91 294 3.0E-17
sp|O58362|MAP2_PYRHO Methionine aminopeptidase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=map PE=3 SV=1 91 294 1.0E-16
sp|O27355|MAP2_METTH Methionine aminopeptidase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=map PE=3 SV=1 91 325 3.0E-13
sp|O28438|MAP2_ARCFU Methionine aminopeptidase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=map PE=3 SV=1 81 282 2.0E-12
sp|P22624|MAP2_METFE Methionine aminopeptidase (Fragment) OS=Methanothermus fervidus GN=map PE=3 SV=1 139 261 7.0E-11
sp|P33111|YADK_MICLU Uncharacterized protein in adk 3'region (Fragment) OS=Micrococcus luteus PE=4 SV=1 73 156 8.0E-10
sp|P95963|MAP2_SULSO Methionine aminopeptidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=map PE=3 SV=1 100 282 2.0E-09
sp|P9WHS7|PEPE_MYCTU Probable dipeptidase PepE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pepE PE=1 SV=1 153 320 9.0E-08
sp|P9WHS6|PEPE_MYCTO Probable dipeptidase PepE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pepE PE=3 SV=1 153 320 9.0E-08
sp|P65811|PEPE_MYCBO Probable dipeptidase PepE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pepE PE=3 SV=1 153 320 9.0E-08
sp|P81535|PEPQ_PYRFU Xaa-Pro dipeptidase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pepQ PE=1 SV=1 87 315 2.0E-07
sp|O58885|PEPQ_PYRHO Xaa-Pro dipeptidase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pepQ PE=1 SV=1 87 315 3.0E-07
sp|Q8NW55|Y1651_STAAW Uncharacterized peptidase MW1651 OS=Staphylococcus aureus (strain MW2) GN=MW1651 PE=3 SV=1 89 325 4.0E-07
sp|P54518|YQHT_BACSU Uncharacterized peptidase YqhT OS=Bacillus subtilis (strain 168) GN=yqhT PE=3 SV=1 137 307 7.0E-07
sp|Q49YD7|Y1059_STAS1 Uncharacterized peptidase SSP1059 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1059 PE=3 SV=1 87 326 1.0E-06
sp|Q58725|MAP2_METJA Methionine aminopeptidase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=map PE=3 SV=1 81 261 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6094
MHKTQSTILHHFVAPKAISPDPASGYYNPFPTFPFSGTLRPVYPLSERRTLPKSIPHPVWWEDGDPRYSRSPISR
NKVEILDAQAQQAMRKSCRLAREVLDIAAAAAVPGATTDQIDEIVHKACIDRNSYPSPLNYNHFPKSCCTSVNEV
ICHGIPDQRVLLDGDILNIDISLYHEGFHADLNETYYIGDRAKADPENVRVVEAARECLEEAIKAVKPGVPIREF
GNIIEKHAKKKNCSVIRTYCGHGINRLFHCAPNVPHYAKNKAVGECKPGMTFTIEPMIALGKYRDITWPDNWTST
TIDGKRTAQFEHTLLVTEDGVEILTARNEDSPGGAISMPEADTATPPS*
Coding >OphauG2|6094
ATGCATAAGACGCAAAGTACAATCCTCCATCACTTTGTGGCTCCGAAAGCAATCTCACCAGATCCAGCAAGCGGC
TACTACAATCCGTTTCCGACTTTTCCCTTCTCAGGCACGCTGCGCCCCGTCTATCCTCTATCCGAGCGCCGTACC
CTACCCAAGTCGATTCCTCACCCCGTGTGGTGGGAAGACGGCGATCCCAGATACAGCCGCTCTCCAATAAGCCGC
AACAAGGTTGAAATACTCGACGCCCAAGCCCAGCAAGCCATGCGAAAAAGTTGTCGACTAGCCCGCGAGGTGCTC
GATATCGCCGCTGCTGCCGCTGTTCCTGGTGCTACGACGGATCAGATCGATGAAATCGTCCACAAGGCGTGTATT
GATAGGAATTCATATCCATCGCCTCTCAACTACAACCACTTTCCAAAGTCTTGTTGCACCTCGGTCAACGAAGTC
ATTTGTCACGGAATTCCTGACCAGCGTGTCCTTCTCGATGGCGACATACTCAACATTGATATCTCGCTATACCAT
GAGGGCTTTCATGCAGACCTCAACGAAACTTACTATATTGGCGATAGGGCAAAAGCGGATCCCGAAAATGTACGC
GTTGTCGAAGCAGCACGCGAGTGTCTCGAAGAGGCCATTAAAGCAGTTAAGCCAGGTGTACCCATTCGCGAATTT
GGAAACATAATTGAAAAGCATGCCAAGAAGAAAAACTGCAGCGTAATTCGGACATACTGCGGCCATGGAATCAAC
AGACTTTTTCACTGTGCTCCTAATGTTCCTCACTACGCTAAGAATAAGGCTGTCGGCGAATGCAAGCCGGGAATG
ACCTTTACCATTGAGCCCATGATTGCTTTGGGGAAATACAGAGACATAACGTGGCCTGATAATTGGACCAGCACC
ACTATTGATGGCAAGCGCACGGCCCAGTTCGAACACACGCTTCTCGTCACCGAGGATGGTGTTGAGATACTCACA
GCCAGAAATGAGGACTCGCCTGGTGGCGCAATTTCCATGCCAGAAGCTGACACGGCGACACCGCCCTCCTAA
Transcript >OphauG2|6094
ATGCATAAGACGCAAAGTACAATCCTCCATCACTTTGTGGCTCCGAAAGCAATCTCACCAGATCCAGCAAGCGGC
TACTACAATCCGTTTCCGACTTTTCCCTTCTCAGGCACGCTGCGCCCCGTCTATCCTCTATCCGAGCGCCGTACC
CTACCCAAGTCGATTCCTCACCCCGTGTGGTGGGAAGACGGCGATCCCAGATACAGCCGCTCTCCAATAAGCCGC
AACAAGGTTGAAATACTCGACGCCCAAGCCCAGCAAGCCATGCGAAAAAGTTGTCGACTAGCCCGCGAGGTGCTC
GATATCGCCGCTGCTGCCGCTGTTCCTGGTGCTACGACGGATCAGATCGATGAAATCGTCCACAAGGCGTGTATT
GATAGGAATTCATATCCATCGCCTCTCAACTACAACCACTTTCCAAAGTCTTGTTGCACCTCGGTCAACGAAGTC
ATTTGTCACGGAATTCCTGACCAGCGTGTCCTTCTCGATGGCGACATACTCAACATTGATATCTCGCTATACCAT
GAGGGCTTTCATGCAGACCTCAACGAAACTTACTATATTGGCGATAGGGCAAAAGCGGATCCCGAAAATGTACGC
GTTGTCGAAGCAGCACGCGAGTGTCTCGAAGAGGCCATTAAAGCAGTTAAGCCAGGTGTACCCATTCGCGAATTT
GGAAACATAATTGAAAAGCATGCCAAGAAGAAAAACTGCAGCGTAATTCGGACATACTGCGGCCATGGAATCAAC
AGACTTTTTCACTGTGCTCCTAATGTTCCTCACTACGCTAAGAATAAGGCTGTCGGCGAATGCAAGCCGGGAATG
ACCTTTACCATTGAGCCCATGATTGCTTTGGGGAAATACAGAGACATAACGTGGCCTGATAATTGGACCAGCACC
ACTATTGATGGCAAGCGCACGGCCCAGTTCGAACACACGCTTCTCGTCACCGAGGATGGTGTTGAGATACTCACA
GCCAGAAATGAGGACTCGCCTGGTGGCGCAATTTCCATGCCAGAAGCTGACACGGCGACACCGCCCTCCTAA
Gene >OphauG2|6094
ATGCATAAGACGCAAAGTACAATCCTCCATCACTTTGTGGCTCCGAAAGCAATCTCACCAGATCCAGCAAGCGGC
TACTACAATCCGTTTCCGACTTTTCCCTTCTCAGGCACGCTGCGCCCCGTCTATCCTCTATCCGAGCGCCGTACC
CTACCCAAGTCGATTCCTCACCCCGTGTGGTGGGAAGACGGCGATCCCAGATACAGCCGCTCTCCAATAAGCCGC
AACAAGGTTGAAATACTCGACGCCCAAGCCCAGCAAGCCATGCGAAAAAGTTGTCGACTAGCCCGCGAGGTGCTC
GATATCGCCGCTGCTGCCGCTGTTCCTGGTGCTACGACGGATCAGATCGATGAAATCGTCCACAAGGCGTGTATT
GATAGGAATGTGTGTACTTGGGCTGGCTGTCGTGACGCCCTGGAAGCGGAGAGCCTCGGGATAGCTGACGACCAC
TCAAAATAGTCATATCCATCGCCTCTCAACTACAACCACTTTCCAAAGTCTTGTTGCACCTCGGTCAACGAAGTC
ATTTGTCACGGAATTCCTGACCAGCGTGTCCTTCTCGATGGCGACATACTCAACATTGATATCTCGCTATACCAT
GAGGGCTTTCATGCAGACCTCAACGAAACTTACTATATTGGCGATAGGGCAAAAGCGGATCCCGAAAATGTACGC
GTTGTCGAAGCAGCACGCGAGTGTCTCGAAGAGGCCATTAAAGCAGTTAAGCCAGGTGTACCCATTCGCGAATTT
GGAAACATAATTGAAAAGCATGCCAAGAAGAAAAACTGCAGCGTAATTCGGACATACTGCGGCCATGGAATCAAC
AGACTTTTTCACTGTGCTCCTAATGTTCCTCACTACGCTAAGAATAAGGCTGTCGGCGAATGCAAGCCGGGAATG
ACCTTTACCATTGAGCCCATGATTGCTTTGGGGAAATACAGAGACATAACGTGGCCTGATAATTGGACCAGCACC
ACTATTGATGGCAAGCGCACGGCCCAGTTCGGTAAGCCAAGACTCTGTCCCTTGAACAGGACTGTGCAACGCAAA
TGGTAACTGTTTTGAACAGAACACACGCTTCTCGTCACCGAGGATGGTGTTGAGATACTCACAGCCAGAAATGAG
GACTCGCCTGGTGGCGCAATTTCCATGCCAGAAGCTGACACGGCGACACCGCCCTCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail