Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6089
Gene name
LocationContig_6:66846..68513
Strand+
Gene length (bp)1667
Transcript length (bp)1542
Coding sequence length (bp)1542
Protein length (aa) 514

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal 3.8E-31 414 502
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 3.5E-20 85 288
PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2 4.5E-09 320 402

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32481|IF2G_YEAST Eukaryotic translation initiation factor 2 subunit gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCD11 PE=1 SV=1 58 510 0.0E+00
sp|Q09130|IF2G_SCHPO Eukaryotic translation initiation factor 2 subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif213 PE=2 SV=1 65 509 0.0E+00
sp|Q24208|IF2G_DROME Eukaryotic translation initiation factor 2 subunit 3 OS=Drosophila melanogaster GN=eIF-2gamma PE=2 SV=1 61 512 0.0E+00
sp|Q54XD8|IF2G_DICDI Eukaryotic translation initiation factor 2 subunit 3 OS=Dictyostelium discoideum GN=eif2s3 PE=2 SV=1 52 508 0.0E+00
sp|Q9Z0N2|IF2H_MOUSE Eukaryotic translation initiation factor 2 subunit 3, Y-linked OS=Mus musculus GN=Eif2s3y PE=1 SV=2 52 512 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32481|IF2G_YEAST Eukaryotic translation initiation factor 2 subunit gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCD11 PE=1 SV=1 58 510 0.0E+00
sp|Q09130|IF2G_SCHPO Eukaryotic translation initiation factor 2 subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif213 PE=2 SV=1 65 509 0.0E+00
sp|Q24208|IF2G_DROME Eukaryotic translation initiation factor 2 subunit 3 OS=Drosophila melanogaster GN=eIF-2gamma PE=2 SV=1 61 512 0.0E+00
sp|Q54XD8|IF2G_DICDI Eukaryotic translation initiation factor 2 subunit 3 OS=Dictyostelium discoideum GN=eif2s3 PE=2 SV=1 52 508 0.0E+00
sp|Q9Z0N2|IF2H_MOUSE Eukaryotic translation initiation factor 2 subunit 3, Y-linked OS=Mus musculus GN=Eif2s3y PE=1 SV=2 52 512 0.0E+00
sp|Q5ZMS3|IF2G_CHICK Eukaryotic translation initiation factor 2 subunit 3 OS=Gallus gallus GN=EIF2S3 PE=1 SV=1 52 512 0.0E+00
sp|Q2KHU8|IF2G_BOVIN Eukaryotic translation initiation factor 2 subunit 3 OS=Bos taurus GN=EIF2S3 PE=2 SV=1 52 512 0.0E+00
sp|P41091|IF2G_HUMAN Eukaryotic translation initiation factor 2 subunit 3 OS=Homo sapiens GN=EIF2S3 PE=1 SV=3 52 512 0.0E+00
sp|P81795|IF2G_RAT Eukaryotic translation initiation factor 2 subunit 3 OS=Rattus norvegicus GN=Eif2s3 PE=1 SV=2 52 512 0.0E+00
sp|Q9Z0N1|IF2G_MOUSE Eukaryotic translation initiation factor 2 subunit 3, X-linked OS=Mus musculus GN=Eif2s3x PE=1 SV=2 52 512 0.0E+00
sp|Q5R797|IF2G_PONAB Eukaryotic translation initiation factor 2 subunit 3 OS=Pongo abelii GN=EIF2S3 PE=2 SV=1 52 512 0.0E+00
sp|Q2VIR3|IF2GL_HUMAN Putative eukaryotic translation initiation factor 2 subunit 3-like protein OS=Homo sapiens GN=EIF2S3L PE=5 SV=2 52 512 0.0E+00
sp|O96719|IF2G_ENCCU Eukaryotic translation initiation factor 2 subunit gamma OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU01_0700 PE=3 SV=2 78 510 1.0E-157
sp|Q58657|IF2G_METJA Translation initiation factor 2 subunit gamma OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=eif2g PE=1 SV=2 81 502 5.0E-132
sp|A6UPK8|IF2G_METVS Translation initiation factor 2 subunit gamma OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=eif2g PE=3 SV=1 79 502 2.0E-126
sp|Q6LXY6|IF2G_METMP Translation initiation factor 2 subunit gamma OS=Methanococcus maripaludis (strain S2 / LL) GN=eif2g PE=3 SV=1 81 502 3.0E-125
sp|A4FWW9|IF2G_METM5 Translation initiation factor 2 subunit gamma OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=eif2g PE=3 SV=1 81 502 3.0E-124
sp|A6VGE8|IF2G_METM7 Translation initiation factor 2 subunit gamma OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=eif2g PE=3 SV=1 81 502 3.0E-124
sp|A9AAA4|IF2G_METM6 Translation initiation factor 2 subunit gamma OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=eif2g PE=3 SV=1 81 502 2.0E-123
sp|Q9Y9C1|IF2G_AERPE Translation initiation factor 2 subunit gamma OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=eif2g PE=3 SV=2 82 502 1.0E-121
sp|Q8U082|IF2G_PYRFU Translation initiation factor 2 subunit gamma OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=eif2g PE=1 SV=1 81 502 2.0E-120
sp|Q9V1G0|IF2G_PYRAB Translation initiation factor 2 subunit gamma OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=eif2g PE=1 SV=1 81 502 6.0E-119
sp|Q8TJT7|IF2G_METAC Translation initiation factor 2 subunit gamma OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=eif2g PE=3 SV=1 83 504 1.0E-118
sp|O59410|IF2G_PYRHO Translation initiation factor 2 subunit gamma OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=eif2g PE=3 SV=1 81 502 6.0E-118
sp|Q8PZA0|IF2G_METMA Translation initiation factor 2 subunit gamma OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=eif2g PE=3 SV=1 83 504 5.0E-117
sp|Q975N8|IF2G_SULTO Translation initiation factor 2 subunit gamma OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=eif2g PE=3 SV=2 83 502 2.0E-114
sp|O29663|IF2G_ARCFU Translation initiation factor 2 subunit gamma OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=eif2g PE=3 SV=1 53 502 4.0E-114
sp|A6UTL4|IF2G_META3 Translation initiation factor 2 subunit gamma OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=eif2g PE=3 SV=1 82 502 8.0E-112
sp|Q5JDL3|IF2G_THEKO Translation initiation factor 2 subunit gamma OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=eif2g PE=3 SV=1 82 502 2.0E-111
sp|B6YW69|IF2G_THEON Translation initiation factor 2 subunit gamma OS=Thermococcus onnurineus (strain NA1) GN=eif2g PE=3 SV=1 82 502 2.0E-111
sp|Q8TVE5|IF2G_METKA Translation initiation factor 2 subunit gamma OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=eif2g PE=3 SV=1 82 502 6.0E-111
sp|Q980A5|IF2G_SULSO Translation initiation factor 2 subunit gamma OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=eif2g PE=1 SV=1 83 502 1.0E-110
sp|O26361|IF2G_METTH Translation initiation factor 2 subunit gamma OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=eif2g PE=3 SV=1 83 502 8.0E-108
sp|Q978W8|IF2G_THEVO Translation initiation factor 2 subunit gamma OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=eif2g PE=3 SV=1 83 504 7.0E-102
sp|Q9HNK9|IF2G_HALSA Translation initiation factor 2 subunit gamma OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=eif2g PE=3 SV=1 82 502 6.0E-101
sp|B0R6Y7|IF2G_HALS3 Translation initiation factor 2 subunit gamma OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=eif2g PE=3 SV=1 82 502 6.0E-101
sp|Q18KI6|IF2G_HALWD Translation initiation factor 2 subunit gamma OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=eif2g PE=3 SV=1 82 502 2.0E-99
sp|B9LSM6|IF2G_HALLT Translation initiation factor 2 subunit gamma OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=eif2g PE=3 SV=1 83 503 3.0E-99
sp|Q9HLA7|IF2G_THEAC Translation initiation factor 2 subunit gamma OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=eif2g PE=3 SV=1 83 504 5.0E-99
sp|Q5UYS2|IF2G_HALMA Translation initiation factor 2 subunit gamma OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=eif2g PE=3 SV=1 82 502 7.0E-96
sp|Q3IMM5|IF2G_NATPD Translation initiation factor 2 subunit gamma OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=eif2g PE=3 SV=1 82 502 3.0E-95
sp|O36041|IF2G_SPIVO Eukaryotic translation initiation factor 2 subunit gamma (Fragment) OS=Spironucleus vortens PE=3 SV=1 91 305 8.0E-59
sp|Q46455|SELB_MOOTH Selenocysteine-specific elongation factor OS=Moorella thermoacetica GN=selB PE=1 SV=1 86 347 3.0E-24
sp|Q294B9|SUV39_DROPS Histone-lysine N-methyltransferase Su(var)3-9 OS=Drosophila pseudoobscura pseudoobscura GN=Su(var)3-9 PE=3 SV=1 43 125 3.0E-24
sp|P45975|SUV39_DROME Histone-lysine N-methyltransferase Su(var)3-9 OS=Drosophila melanogaster GN=Su(var)3-9 PE=1 SV=2 61 125 5.0E-24
sp|B6YQ04|EFTU_AZOPC Elongation factor Tu OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=tuf PE=3 SV=1 86 340 1.0E-21
sp|B3PMU1|EFTU_MYCA5 Elongation factor Tu OS=Mycoplasma arthritidis (strain 158L3-1) GN=tuf PE=3 SV=1 86 340 5.0E-21
sp|B2RL52|EFTU_PORG3 Elongation factor Tu OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=tuf PE=3 SV=1 86 340 2.0E-20
sp|Q2NJ20|EFTU_AYWBP Elongation factor Tu OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=tuf PE=3 SV=1 78 340 7.0E-20
sp|Q6YQV8|EFTU_ONYPE Elongation factor Tu OS=Onion yellows phytoplasma (strain OY-M) GN=tuf PE=3 SV=1 78 340 8.0E-20
sp|Q1IHG6|EFTU_KORVE Elongation factor Tu OS=Koribacter versatilis (strain Ellin345) GN=tuf1 PE=3 SV=1 86 340 1.0E-19
sp|P33165|EFTU_BACFR Elongation factor Tu OS=Bacteroides fragilis (strain YCH46) GN=tuf PE=3 SV=1 86 340 1.0E-19
sp|Q5L890|EFTU_BACFN Elongation factor Tu OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=tuf PE=3 SV=1 86 340 1.0E-19
sp|B3QY22|EFTU_CHLT3 Elongation factor Tu OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=tuf PE=3 SV=1 86 342 2.0E-19
sp|Q1H4N9|EFTU2_METFK Elongation factor Tu 2 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=tuf2 PE=3 SV=1 86 340 2.0E-19
sp|C4KZP9|EFTU_EXISA Elongation factor Tu OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=tuf PE=3 SV=1 86 429 2.0E-19
sp|A5FIJ9|EFTU_FLAJ1 Elongation factor Tu OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=tuf PE=3 SV=1 86 340 3.0E-19
sp|Q9TMM9|EFTU_TOXGO Elongation factor Tu, apicoplast OS=Toxoplasma gondii GN=tufA PE=3 SV=1 75 348 3.0E-19
sp|Q6MU81|EFTU_MYCMS Elongation factor Tu OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=tuf PE=3 SV=1 86 382 5.0E-19
sp|Q2SSW8|EFTU_MYCCT Elongation factor Tu OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=tuf PE=3 SV=1 86 382 5.0E-19
sp|Q1H4Q1|EFTU1_METFK Elongation factor Tu 1 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=tuf1 PE=3 SV=1 86 340 5.0E-19
sp|P22679|EFTU_MYCHP Elongation factor Tu OS=Mycoplasma hominis (strain ATCC 23114 / NBRC 14850 / NCTC 10111 / PG21) GN=tuf PE=1 SV=1 86 340 6.0E-19
sp|Q12SW1|EFTU_SHEDO Elongation factor Tu OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=tuf PE=3 SV=1 82 340 9.0E-19
sp|Q0I0B9|EFTU1_SHESR Elongation factor Tu 1 OS=Shewanella sp. (strain MR-7) GN=tuf1 PE=3 SV=1 86 340 9.0E-19
sp|Q0HNV1|EFTU1_SHESM Elongation factor Tu 1 OS=Shewanella sp. (strain MR-4) GN=tuf1 PE=3 SV=1 86 340 9.0E-19
sp|Q98QG1|EFTU_MYCPU Elongation factor Tu OS=Mycoplasma pulmonis (strain UAB CTIP) GN=tuf PE=3 SV=1 86 340 1.0E-18
sp|Q0I0A7|EFTU2_SHESR Elongation factor Tu 2 OS=Shewanella sp. (strain MR-7) GN=tuf2 PE=3 SV=1 86 340 1.0E-18
sp|A5EX84|EFTU_DICNV Elongation factor Tu OS=Dichelobacter nodosus (strain VCS1703A) GN=tuf PE=3 SV=1 86 358 1.0E-18
sp|Q8EX18|EFTU_MYCPE Elongation factor Tu OS=Mycoplasma penetrans (strain HF-2) GN=tuf PE=3 SV=1 83 340 2.0E-18
sp|Q5HVZ7|EFTU_CAMJR Elongation factor Tu OS=Campylobacter jejuni (strain RM1221) GN=tuf PE=3 SV=1 86 340 2.0E-18
sp|A1VYI6|EFTU_CAMJJ Elongation factor Tu OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=tuf PE=3 SV=1 86 340 2.0E-18
sp|O69303|EFTU_CAMJE Elongation factor Tu OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=tuf PE=3 SV=1 86 340 2.0E-18
sp|A7H4R3|EFTU_CAMJD Elongation factor Tu OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=tuf PE=3 SV=1 86 340 2.0E-18
sp|A8FKQ5|EFTU_CAMJ8 Elongation factor Tu OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=tuf PE=3 SV=1 86 340 2.0E-18
sp|Q3BWY6|EFTU_XANC5 Elongation factor Tu OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=tuf1 PE=3 SV=1 86 340 2.0E-18
sp|Q8NL22|EFTU_XANAC Elongation factor Tu OS=Xanthomonas axonopodis pv. citri (strain 306) GN=tufA PE=3 SV=1 86 340 2.0E-18
sp|A6Q1L5|EFTU_NITSB Elongation factor Tu OS=Nitratiruptor sp. (strain SB155-2) GN=tuf PE=3 SV=1 86 340 2.0E-18
sp|A5GW14|EFTU_SYNR3 Elongation factor Tu OS=Synechococcus sp. (strain RCC307) GN=tuf PE=3 SV=1 86 340 2.0E-18
sp|Q46497|SELB_DESBA Selenocysteine-specific elongation factor OS=Desulfomicrobium baculatum GN=selB PE=3 SV=1 88 342 3.0E-18
sp|Q21M86|EFTU_SACD2 Elongation factor Tu OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=tuf1 PE=3 SV=1 86 358 3.0E-18
sp|B9KFF9|EFTU_CAMLR Elongation factor Tu OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=tuf PE=3 SV=1 86 340 4.0E-18
sp|A9ETD1|EFTU_SORC5 Elongation factor Tu OS=Sorangium cellulosum (strain So ce56) GN=tuf1 PE=3 SV=1 86 340 4.0E-18
sp|A5GIP0|EFTU_SYNPW Elongation factor Tu OS=Synechococcus sp. (strain WH7803) GN=tuf PE=3 SV=1 86 340 4.0E-18
sp|Q6F0J5|EFTU_MESFL Elongation factor Tu OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=tuf PE=3 SV=1 86 365 5.0E-18
sp|A0KRL0|EFTU_SHESA Elongation factor Tu OS=Shewanella sp. (strain ANA-3) GN=tuf1 PE=3 SV=1 86 340 6.0E-18
sp|A7ZCN0|EFTU_CAMC1 Elongation factor Tu OS=Campylobacter concisus (strain 13826) GN=tuf PE=3 SV=1 86 340 6.0E-18
sp|Q492B2|EFTU_BLOPB Elongation factor Tu OS=Blochmannia pennsylvanicus (strain BPEN) GN=tuf PE=3 SV=1 86 340 6.0E-18
sp|Q0HNT9|EFTU2_SHESM Elongation factor Tu 2 OS=Shewanella sp. (strain MR-4) GN=tuf2 PE=3 SV=1 86 340 7.0E-18
sp|Q8EK81|EFTU1_SHEON Elongation factor Tu 1 OS=Shewanella oneidensis (strain MR-1) GN=tuf1 PE=3 SV=1 86 340 7.0E-18
sp|Q661E5|EFTU_BORBP Elongation factor Tu OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=tuf PE=3 SV=1 75 340 7.0E-18
sp|Q8EK70|EFTU2_SHEON Elongation factor Tu 2 OS=Shewanella oneidensis (strain MR-1) GN=tuf2 PE=3 SV=1 86 340 8.0E-18
sp|A7GZK6|EFTU_CAMC5 Elongation factor Tu OS=Campylobacter curvus (strain 525.92) GN=tuf PE=3 SV=1 86 340 8.0E-18
sp|C5BQ44|EFTU_TERTT Elongation factor Tu OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=tuf PE=3 SV=1 86 340 8.0E-18
sp|Q5GWR8|EFTU_XANOR Elongation factor Tu OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=tuf1 PE=3 SV=1 86 340 9.0E-18
sp|Q2NZX1|EFTU_XANOM Elongation factor Tu OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=tuf1 PE=3 SV=1 86 340 9.0E-18
sp|Q4A9G1|EFTU_MYCHJ Elongation factor Tu OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=tuf PE=3 SV=1 86 340 9.0E-18
sp|Q089R8|EFTU1_SHEFN Elongation factor Tu 1 OS=Shewanella frigidimarina (strain NCIMB 400) GN=tuf1 PE=3 SV=1 86 340 9.0E-18
sp|B7J241|EFTU_BORBZ Elongation factor Tu OS=Borrelia burgdorferi (strain ZS7) GN=tuf PE=3 SV=1 75 340 1.0E-17
sp|P50062|EFTU_BORBU Elongation factor Tu OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=tuf PE=3 SV=1 75 340 1.0E-17
sp|Q089Q6|EFTU2_SHEFN Elongation factor Tu 2 OS=Shewanella frigidimarina (strain NCIMB 400) GN=tuf2 PE=3 SV=1 86 340 1.0E-17
sp|B1YGU8|EFTU_EXIS2 Elongation factor Tu OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=tuf PE=3 SV=1 86 340 1.0E-17
sp|Q2S1P8|EFTU_SALRD Elongation factor Tu OS=Salinibacter ruber (strain DSM 13855 / M31) GN=tuf1 PE=3 SV=1 75 340 1.0E-17
sp|B3WE38|EFTU_LACCB Elongation factor Tu OS=Lactobacillus casei (strain BL23) GN=tuf PE=3 SV=1 86 340 1.0E-17
sp|Q039K9|EFTU_LACC3 Elongation factor Tu OS=Lactobacillus casei (strain ATCC 334) GN=tuf PE=3 SV=1 86 340 1.0E-17
sp|B5RPI0|EFTU_BORRA Elongation factor Tu OS=Borrelia recurrentis (strain A1) GN=tuf PE=3 SV=1 75 340 1.0E-17
sp|B5RM34|EFTU_BORDL Elongation factor Tu OS=Borrelia duttonii (strain Ly) GN=tuf PE=3 SV=1 75 340 1.0E-17
sp|Q4A7K0|EFTU_MYCH7 Elongation factor Tu OS=Mycoplasma hyopneumoniae (strain 7448) GN=tuf PE=3 SV=1 86 340 1.0E-17
sp|Q600B6|EFTU_MYCH2 Elongation factor Tu OS=Mycoplasma hyopneumoniae (strain 232) GN=tuf PE=3 SV=1 86 340 1.0E-17
sp|Q8PC51|EFTU2_XANCP Elongation factor Tu-B OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=tufB PE=3 SV=1 86 340 1.0E-17
sp|Q4URD7|EFTU1_XANC8 Elongation factor Tu 1 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=tuf1 PE=3 SV=1 86 340 1.0E-17
sp|A6KYK9|EFTU_BACV8 Elongation factor Tu OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=tuf PE=3 SV=1 86 340 1.0E-17
sp|B0RU96|EFTU2_XANCB Elongation factor Tu 2 OS=Xanthomonas campestris pv. campestris (strain B100) GN=tuf2 PE=3 SV=1 86 340 1.0E-17
sp|Q4URC5|EFTU2_XANC8 Elongation factor Tu 2 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=tuf2 PE=3 SV=1 86 340 1.0E-17
sp|Q8PC59|EFTU1_XANCP Elongation factor Tu-A OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=tufA PE=3 SV=1 86 340 1.0E-17
sp|Q6A6L7|EFTU_PROAC Elongation factor Tu OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=tuf PE=3 SV=1 87 429 2.0E-17
sp|B8I5N8|EFTU_CLOCE Elongation factor Tu OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=tuf PE=3 SV=1 86 340 2.0E-17
sp|Q9ZK19|EFTU_HELPJ Elongation factor Tu OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=tuf PE=3 SV=1 86 340 2.0E-17
sp|Q0SN31|EFTU_BORAP Elongation factor Tu OS=Borrelia afzelii (strain PKo) GN=tuf PE=3 SV=1 75 340 2.0E-17
sp|A6LE88|EFTU_PARD8 Elongation factor Tu OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=tuf PE=3 SV=1 86 340 2.0E-17
sp|Q3AMT6|EFTU_SYNSC Elongation factor Tu OS=Synechococcus sp. (strain CC9605) GN=tuf PE=3 SV=1 86 340 2.0E-17
sp|A7I3U7|EFTU_CAMHC Elongation factor Tu OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=tuf PE=3 SV=1 86 340 3.0E-17
sp|Q7N9B1|EFTU1_PHOLL Elongation factor Tu 1 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=tuf1 PE=3 SV=1 82 358 3.0E-17
sp|B0RU84|EFTU1_XANCB Elongation factor Tu 1 OS=Xanthomonas campestris pv. campestris (strain B100) GN=tuf1 PE=3 SV=1 86 340 3.0E-17
sp|Q2LQA3|EFTU_SYNAS Elongation factor Tu OS=Syntrophus aciditrophicus (strain SB) GN=tuf PE=3 SV=1 86 340 3.0E-17
sp|Q3B6G3|EFTU_CHLL7 Elongation factor Tu OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=tuf PE=3 SV=1 86 340 4.0E-17
sp|P50371|EFTU_CHACO Elongation factor Tu, chloroplastic OS=Chara connivens GN=tufA PE=3 SV=1 75 429 4.0E-17
sp|B5Z8K3|EFTU_HELPG Elongation factor Tu OS=Helicobacter pylori (strain G27) GN=tuf PE=3 SV=1 86 340 4.0E-17
sp|A1S204|EFTU_SHEAM Elongation factor Tu OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=tuf1 PE=3 SV=1 86 358 4.0E-17
sp|A6W394|EFTU_MARMS Elongation factor Tu OS=Marinomonas sp. (strain MWYL1) GN=tuf PE=3 SV=1 86 429 4.0E-17
sp|B6JN44|EFTU_HELP2 Elongation factor Tu OS=Helicobacter pylori (strain P12) GN=tuf PE=3 SV=1 86 340 4.0E-17
sp|A9KW88|EFTU1_SHEB9 Elongation factor Tu 1 OS=Shewanella baltica (strain OS195) GN=tuf1 PE=3 SV=1 86 340 4.0E-17
sp|Q01SX2|EFTU_SOLUE Elongation factor Tu OS=Solibacter usitatus (strain Ellin6076) GN=tuf1 PE=3 SV=1 86 340 4.0E-17
sp|A0RQJ3|EFTU_CAMFF Elongation factor Tu OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=tuf PE=3 SV=1 86 340 4.0E-17
sp|P02992|EFTU_YEAST Elongation factor Tu, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUF1 PE=1 SV=1 86 429 4.0E-17
sp|Q8A463|EFTU_BACTN Elongation factor Tu OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=tuf PE=3 SV=1 86 340 4.0E-17
sp|P60338|EFTU1_THETH Elongation factor Tu-A OS=Thermus thermophilus GN=tufA PE=1 SV=2 78 429 5.0E-17
sp|Q5SHN6|EFTU1_THET8 Elongation factor Tu-A OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=tufA PE=1 SV=3 78 429 5.0E-17
sp|A6WHR4|EFTU_SHEB8 Elongation factor Tu OS=Shewanella baltica (strain OS185) GN=tuf1 PE=3 SV=1 86 340 5.0E-17
sp|A9KWA0|EFTU2_SHEB9 Elongation factor Tu 2 OS=Shewanella baltica (strain OS195) GN=tuf2 PE=3 SV=1 86 340 5.0E-17
sp|A3DBA0|EFTU2_SHEB5 Elongation factor Tu 2 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=tuf2 PE=3 SV=2 86 340 5.0E-17
sp|A3DA74|EFTU1_SHEB5 Elongation factor Tu 1 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=tuf1 PE=3 SV=1 86 340 5.0E-17
sp|Q6KI66|EFTU_MYCMO Elongation factor Tu OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=tuf PE=3 SV=1 86 340 5.0E-17
sp|A3Q968|EFTU1_SHELP Elongation factor Tu 1 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=tuf1 PE=3 SV=1 86 358 5.0E-17
sp|A0ALY8|EFTU_LISW6 Elongation factor Tu OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=tuf PE=3 SV=1 86 336 5.0E-17
sp|Q8Y422|EFTU_LISMO Elongation factor Tu OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=tuf PE=1 SV=1 86 336 5.0E-17
sp|Q71WB9|EFTU_LISMF Elongation factor Tu OS=Listeria monocytogenes serotype 4b (strain F2365) GN=tuf PE=3 SV=1 86 336 5.0E-17
sp|C1KZK6|EFTU_LISMC Elongation factor Tu OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=tuf PE=3 SV=1 86 336 5.0E-17
sp|P50068|EFTU_UREPA Elongation factor Tu OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=tuf PE=3 SV=1 86 340 5.0E-17
sp|B1AJG3|EFTU_UREP2 Elongation factor Tu OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=tuf PE=3 SV=1 86 340 5.0E-17
sp|Q7V500|EFTU_PROMM Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9313) GN=tuf PE=3 SV=1 86 340 5.0E-17
sp|P42473|EFTU_CHLP8 Elongation factor Tu OS=Chlorobaculum parvum (strain NCIB 8327) GN=tuf PE=3 SV=1 86 340 5.0E-17
sp|P42474|EFTU_CELLY Elongation factor Tu OS=Cellulophaga lytica GN=tuf PE=3 SV=1 86 340 5.0E-17
sp|P60339|EFTU2_THET8 Elongation factor Tu-B OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=tufB PE=1 SV=2 78 340 5.0E-17
sp|Q72GW4|EFTU_THET2 Elongation factor Tu OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=tuf1 PE=3 SV=1 78 340 6.0E-17
sp|Q2L2G6|EFTU_BORA1 Elongation factor Tu OS=Bordetella avium (strain 197N) GN=tuf1 PE=3 SV=1 86 340 6.0E-17
sp|Q01698|EFTU_THEAQ Elongation factor Tu OS=Thermus aquaticus GN=tuf PE=1 SV=2 78 340 6.0E-17
sp|P56003|EFTU_HELPY Elongation factor Tu OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=tuf PE=3 SV=1 86 340 6.0E-17
sp|B9E8Q0|EFTU_MACCJ Elongation factor Tu OS=Macrococcus caseolyticus (strain JCSC5402) GN=tuf PE=3 SV=1 87 429 6.0E-17
sp|A5IYA9|EFTU_MYCAP Elongation factor Tu OS=Mycoplasma agalactiae (strain PG2) GN=tuf PE=3 SV=1 86 340 6.0E-17
sp|Q04B37|EFTU_LACDB Elongation factor Tu OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=tuf PE=3 SV=1 86 372 7.0E-17
sp|Q1GAQ0|EFTU_LACDA Elongation factor Tu OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=tuf PE=3 SV=1 86 372 7.0E-17
sp|B2UUW8|EFTU_HELPS Elongation factor Tu OS=Helicobacter pylori (strain Shi470) GN=tuf PE=3 SV=1 86 340 7.0E-17
sp|Q7MYE8|EFTU2_PHOLL Elongation factor Tu 2 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=tuf2 PE=3 SV=1 86 358 7.0E-17
sp|B3ETZ7|EFTU_AMOA5 Elongation factor Tu OS=Amoebophilus asiaticus (strain 5a2) GN=tuf PE=3 SV=1 86 340 8.0E-17
sp|P42477|EFTU_HERAU Elongation factor Tu OS=Herpetosiphon aurantiacus GN=tuf PE=3 SV=1 86 340 8.0E-17
sp|A8G1F0|EFTU_SHESH Elongation factor Tu OS=Shewanella sediminis (strain HAW-EB3) GN=tuf PE=3 SV=1 86 358 8.0E-17
sp|Q748X8|EFTU_GEOSL Elongation factor Tu OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=tuf1 PE=3 SV=1 86 340 8.0E-17
sp|A3Q980|EFTU2_SHELP Elongation factor Tu 2 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=tuf2 PE=3 SV=1 86 340 9.0E-17
sp|A1SNN5|EFTU_NOCSJ Elongation factor Tu OS=Nocardioides sp. (strain BAA-499 / JS614) GN=tuf PE=3 SV=1 86 429 1.0E-16
sp|A2CC87|EFTU_PROM3 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9303) GN=tuf PE=3 SV=1 86 340 1.0E-16
sp|Q7U4D1|EFTU_SYNPX Elongation factor Tu OS=Synechococcus sp. (strain WH8102) GN=tuf PE=3 SV=1 86 340 1.0E-16
sp|Q057A2|EFTU_BUCCC Elongation factor Tu OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=tuf PE=3 SV=1 86 340 1.0E-16
sp|B0TM14|EFTU_SHEHH Elongation factor Tu OS=Shewanella halifaxensis (strain HAW-EB4) GN=tuf1 PE=3 SV=1 86 358 1.0E-16
sp|Q3Z7S9|EFTU_DEHM1 Elongation factor Tu OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=tuf PE=3 SV=1 87 429 1.0E-16
sp|A4SCQ7|EFTU_CHLPM Elongation factor Tu OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=tuf PE=3 SV=1 86 340 1.0E-16
sp|Q7TT91|EFTU_BORPE Elongation factor Tu OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=tuf1 PE=3 SV=1 86 340 1.0E-16
sp|Q79GC6|EFTU_BORPA Elongation factor Tu OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=tuf1 PE=3 SV=1 86 340 1.0E-16
sp|Q79G84|EFTU_BORBR Elongation factor Tu OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=tuf1 PE=3 SV=1 86 340 1.0E-16
sp|A0LRL8|EFTU_ACIC1 Elongation factor Tu OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=tuf PE=3 SV=1 86 340 1.0E-16
sp|Q1D7V1|EFTU1_MYXXD Elongation factor Tu 1 OS=Myxococcus xanthus (strain DK 1622) GN=tuf1 PE=3 SV=1 86 340 2.0E-16
sp|Q3ZXX3|EFTU_DEHMC Elongation factor Tu OS=Dehalococcoides mccartyi (strain CBDB1) GN=tuf PE=3 SV=1 87 429 2.0E-16
sp|A5FQQ5|EFTU_DEHMB Elongation factor Tu OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=tuf PE=3 SV=1 87 429 2.0E-16
sp|Q1D776|EFTU2_MYXXD Elongation factor Tu 2 OS=Myxococcus xanthus (strain DK 1622) GN=tuf2 PE=3 SV=1 86 340 2.0E-16
sp|B5ZC31|EFTU_UREU1 Elongation factor Tu OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=tuf PE=3 SV=1 86 340 2.0E-16
sp|Q8KTA3|EFTU_RICRH Elongation factor Tu OS=Rickettsia rhipicephali GN=tuf PE=3 SV=1 86 358 2.0E-16
sp|B8DAY7|EFTU_LISMH Elongation factor Tu OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=tuf PE=3 SV=1 86 336 2.0E-16
sp|Q927I6|EFTU_LISIN Elongation factor Tu OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=tuf PE=3 SV=1 86 336 2.0E-16
sp|A7Z0N5|EFTU_BACMF Elongation factor Tu OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=tuf PE=3 SV=1 87 429 2.0E-16
sp|P33169|EFTU_SHEPU Elongation factor Tu OS=Shewanella putrefaciens GN=tuf PE=3 SV=1 86 340 2.0E-16
sp|A4YBY5|EFTU_SHEPC Elongation factor Tu OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=tuf1 PE=3 SV=1 86 340 2.0E-16
sp|A2CI56|EFTU_CHLAT Elongation factor Tu, chloroplastic OS=Chlorokybus atmophyticus GN=tufA PE=3 SV=1 86 429 2.0E-16
sp|Q4MYA4|EFTU_THEPA Elongation factor Tu, apicoplast OS=Theileria parva GN=tufA PE=3 SV=1 78 509 2.0E-16
sp|A8EW02|EFTU_ARCB4 Elongation factor Tu OS=Arcobacter butzleri (strain RM4018) GN=tuf PE=3 SV=1 86 340 2.0E-16
sp|A4TS36|EFTU2_YERPP Elongation factor Tu 2 OS=Yersinia pestis (strain Pestoides F) GN=tuf2 PE=3 SV=1 86 340 2.0E-16
sp|Q8ZAN8|EFTU2_YERPE Elongation factor Tu-B OS=Yersinia pestis GN=tufB PE=3 SV=1 86 340 2.0E-16
sp|Q1C1T4|EFTU2_YERPA Elongation factor Tu 2 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=tuf2 PE=3 SV=1 86 340 2.0E-16
sp|Q66FQ9|EFTU1_YERPS Elongation factor Tu 1 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=tuf1 PE=3 SV=1 86 340 2.0E-16
sp|A7FNJ0|EFTU1_YERP3 Elongation factor Tu 1 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=tuf1 PE=3 SV=1 86 340 2.0E-16
sp|Q1ACI3|EFTU_CHAVU Elongation factor Tu, chloroplastic OS=Chara vulgaris GN=tufA PE=3 SV=1 75 429 2.0E-16
sp|P42481|EFTU_THIDL Elongation factor Tu OS=Thiomonas delicata GN=tuf PE=3 SV=1 86 340 2.0E-16
sp|Q4A597|EFTU_MYCS5 Elongation factor Tu OS=Mycoplasma synoviae (strain 53) GN=tuf PE=3 SV=1 86 340 2.0E-16
sp|B1ZPC5|EFTU_OPITP Elongation factor Tu OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=tuf PE=3 SV=1 86 340 2.0E-16
sp|A5D5I8|EFTU2_PELTS Elongation factor Tu 2 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=tuf2 PE=3 SV=1 86 340 2.0E-16
sp|Q02WY9|EFTU_LACLS Elongation factor Tu OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=tuf PE=3 SV=1 86 340 2.0E-16
sp|A2RMT1|EFTU_LACLM Elongation factor Tu OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=tuf PE=3 SV=1 86 340 2.0E-16
sp|Q9CEI0|EFTU_LACLA Elongation factor Tu OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=tuf PE=3 SV=1 86 340 2.0E-16
sp|O31298|EFTU_BUCAP Elongation factor Tu OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=tuf PE=3 SV=2 86 340 2.0E-16
sp|P64029|EFTU_STAAW Elongation factor Tu OS=Staphylococcus aureus (strain MW2) GN=tuf PE=3 SV=1 87 429 2.0E-16
sp|A8YZP5|EFTU_STAAT Elongation factor Tu OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=tuf PE=3 SV=1 87 429 2.0E-16
sp|Q6GBT9|EFTU_STAAS Elongation factor Tu OS=Staphylococcus aureus (strain MSSA476) GN=tuf PE=3 SV=1 87 429 2.0E-16
sp|Q6GJC0|EFTU_STAAR Elongation factor Tu OS=Staphylococcus aureus (strain MRSA252) GN=tuf PE=3 SV=1 87 429 2.0E-16
sp|P99152|EFTU_STAAN Elongation factor Tu OS=Staphylococcus aureus (strain N315) GN=tuf PE=1 SV=1 87 429 2.0E-16
sp|P64028|EFTU_STAAM Elongation factor Tu OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=tuf PE=3 SV=1 87 429 2.0E-16
sp|A6QEK0|EFTU_STAAE Elongation factor Tu OS=Staphylococcus aureus (strain Newman) GN=tuf PE=3 SV=1 87 429 2.0E-16
sp|Q5HIC7|EFTU_STAAC Elongation factor Tu OS=Staphylococcus aureus (strain COL) GN=tuf PE=3 SV=1 87 429 2.0E-16
sp|Q2YSB3|EFTU_STAAB Elongation factor Tu OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=tuf PE=3 SV=1 87 429 2.0E-16
sp|A5IQA2|EFTU_STAA9 Elongation factor Tu OS=Staphylococcus aureus (strain JH9) GN=tuf PE=3 SV=1 87 429 2.0E-16
sp|Q2G0N0|EFTU_STAA8 Elongation factor Tu OS=Staphylococcus aureus (strain NCTC 8325) GN=tuf PE=3 SV=1 87 429 2.0E-16
sp|Q2FJ92|EFTU_STAA3 Elongation factor Tu OS=Staphylococcus aureus (strain USA300) GN=tuf PE=3 SV=1 87 429 2.0E-16
sp|A6TZ25|EFTU_STAA2 Elongation factor Tu OS=Staphylococcus aureus (strain JH1) GN=tuf PE=3 SV=1 87 429 2.0E-16
sp|A7WYX6|EFTU_STAA1 Elongation factor Tu OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=tuf PE=3 SV=1 87 429 2.0E-16
sp|Q13TF5|EFTU_BURXL Elongation factor Tu OS=Burkholderia xenovorans (strain LB400) GN=tuf1 PE=3 SV=1 86 340 2.0E-16
sp|Q1CN86|EFTU1_YERPN Elongation factor Tu 1 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=tuf1 PE=3 SV=2 86 340 2.0E-16
sp|A1QZR2|EFTU_BORT9 Elongation factor Tu OS=Borrelia turicatae (strain 91E135) GN=tuf PE=3 SV=1 75 340 2.0E-16
sp|Q21RV6|EFTU2_RHOFT Elongation factor Tu 2 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=tuf2 PE=3 SV=1 86 358 3.0E-16
sp|Q9ZT91|EFTM_ARATH Elongation factor Tu, mitochondrial OS=Arabidopsis thaliana GN=TUFA PE=1 SV=1 86 429 3.0E-16
sp|Q21SF0|EFTU1_RHOFT Elongation factor Tu 1 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=tuf1 PE=3 SV=1 86 358 3.0E-16
sp|Q49V58|EFTU_STAS1 Elongation factor Tu OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=tuf PE=3 SV=1 87 429 3.0E-16
sp|A6T3K6|EFTU_JANMA Elongation factor Tu OS=Janthinobacterium sp. (strain Marseille) GN=tuf1 PE=3 SV=1 86 358 3.0E-16
sp|Q33451|EFTU_EIMTE Elongation factor Tu, apicoplast OS=Eimeria tenella GN=tufA PE=3 SV=1 86 340 3.0E-16
sp|A3PEZ7|EFTU_PROM0 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9301) GN=tuf PE=3 SV=1 86 340 3.0E-16
sp|A2BYN4|EFTU_PROM5 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9515) GN=tuf PE=3 SV=1 86 340 3.0E-16
sp|A8F2E9|EFTU_RICM5 Elongation factor Tu OS=Rickettsia massiliae (strain Mtu5) GN=tuf PE=3 SV=2 86 358 3.0E-16
sp|A8G708|EFTU_PROM2 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9215) GN=tuf PE=3 SV=1 86 340 3.0E-16
sp|Q15NP2|EFTU_PSEA6 Elongation factor Tu OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=tuf1 PE=3 SV=1 86 340 3.0E-16
sp|B2UQY9|EFTU_AKKM8 Elongation factor Tu OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=tuf PE=3 SV=1 86 340 3.0E-16
sp|B2S0H9|EFTU_BORHD Elongation factor Tu OS=Borrelia hermsii (strain HS1 / DAH) GN=tuf PE=3 SV=1 75 340 4.0E-16
sp|O66429|EFTU_AQUAE Elongation factor Tu OS=Aquifex aeolicus (strain VF5) GN=tufA PE=3 SV=1 86 386 4.0E-16
sp|A1VIP8|EFTU_POLNA Elongation factor Tu OS=Polaromonas naphthalenivorans (strain CJ2) GN=tuf1 PE=3 SV=1 86 340 4.0E-16
sp|A8GYW2|EFTU_SHEPA Elongation factor Tu OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=tuf1 PE=3 SV=1 86 358 4.0E-16
sp|Q74JU6|EFTU_LACJO Elongation factor Tu OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=tuf PE=3 SV=1 86 370 4.0E-16
sp|A2BT83|EFTU_PROMS Elongation factor Tu OS=Prochlorococcus marinus (strain AS9601) GN=tuf PE=3 SV=1 86 340 4.0E-16
sp|Q877P8|EFTU_XYLFT Elongation factor Tu OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=tufA PE=3 SV=2 86 340 4.0E-16
sp|Q11Q98|EFTU_CYTH3 Elongation factor Tu OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=tuf PE=3 SV=1 86 340 4.0E-16
sp|P85834|EFTU_RAT Elongation factor Tu, mitochondrial OS=Rattus norvegicus GN=Tufm PE=1 SV=1 86 340 5.0E-16
sp|A9BCK0|EFTU_PROM4 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9211) GN=tuf PE=3 SV=1 86 340 5.0E-16
sp|Q2NQL7|EFTU_SODGM Elongation factor Tu OS=Sodalis glossinidius (strain morsitans) GN=tuf1 PE=3 SV=1 86 358 5.0E-16
sp|O50293|EFTU_AQUPY Elongation factor Tu OS=Aquifex pyrophilus GN=tuf PE=3 SV=1 86 386 5.0E-16
sp|Q39KI2|EFTU_BURL3 Elongation factor Tu OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=tuf1 PE=3 SV=1 86 340 5.0E-16
sp|Q0BJ48|EFTU_BURCM Elongation factor Tu OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=tuf1 PE=3 SV=1 86 340 5.0E-16
sp|A0K3L0|EFTU_BURCH Elongation factor Tu OS=Burkholderia cenocepacia (strain HI2424) GN=tuf1 PE=3 SV=1 86 340 5.0E-16
sp|Q1BRT3|EFTU_BURCA Elongation factor Tu OS=Burkholderia cenocepacia (strain AU 1054) GN=tuf1 PE=3 SV=1 86 340 5.0E-16
sp|P42480|EFTU_HYMOC Elongation factor Tu OS=Hymenobacter ocellatus GN=tuf PE=3 SV=1 86 340 5.0E-16
sp|Q318N5|EFTU_PROM9 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9312) GN=tuf PE=3 SV=1 86 340 5.0E-16
sp|B3QZH5|EFTU_PHYMT Elongation factor Tu OS=Phytoplasma mali (strain AT) GN=tuf PE=3 SV=1 86 340 5.0E-16
sp|B9MQH1|EFTU_CALBD Elongation factor Tu OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=tuf PE=3 SV=1 86 340 5.0E-16
sp|Q0K5Z9|EFTU_CUPNH Elongation factor Tu OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=tuf1 PE=3 SV=1 86 340 5.0E-16
sp|Q8KAH0|EFTU_CHLTE Elongation factor Tu OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=tuf PE=3 SV=1 86 340 5.0E-16
sp|Q1MPT8|EFTU_LAWIP Elongation factor Tu OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=tuf PE=3 SV=1 86 340 5.0E-16
sp|Q042T5|EFTU_LACGA Elongation factor Tu OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=tuf PE=3 SV=2 86 370 5.0E-16
sp|Q123F6|EFTU_POLSJ Elongation factor Tu OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=tuf1 PE=3 SV=1 86 358 6.0E-16
sp|Q8BFR5|EFTU_MOUSE Elongation factor Tu, mitochondrial OS=Mus musculus GN=Tufm PE=1 SV=1 86 340 6.0E-16
sp|Q38WR7|EFTU_LACSS Elongation factor Tu OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=tuf PE=3 SV=1 86 340 6.0E-16
sp|A5D5K0|EFTU1_PELTS Elongation factor Tu 1 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=tuf1 PE=3 SV=1 86 340 6.0E-16
sp|A8F982|EFTU_BACP2 Elongation factor Tu OS=Bacillus pumilus (strain SAFR-032) GN=tuf PE=3 SV=1 87 429 6.0E-16
sp|Q2SU25|EFTU_BURTA Elongation factor Tu OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=tuf1 PE=3 SV=1 86 340 6.0E-16
sp|Q63PZ6|EFTU_BURPS Elongation factor Tu OS=Burkholderia pseudomallei (strain K96243) GN=tuf1 PE=3 SV=1 86 340 6.0E-16
sp|A3NEI1|EFTU_BURP6 Elongation factor Tu OS=Burkholderia pseudomallei (strain 668) GN=tuf1 PE=3 SV=1 86 340 6.0E-16
sp|Q3JMP6|EFTU_BURP1 Elongation factor Tu OS=Burkholderia pseudomallei (strain 1710b) GN=tuf1 PE=3 SV=1 86 340 6.0E-16
sp|A3P0B5|EFTU_BURP0 Elongation factor Tu OS=Burkholderia pseudomallei (strain 1106a) GN=tuf1 PE=3 SV=1 86 340 6.0E-16
sp|A1V8A5|EFTU_BURMS Elongation factor Tu OS=Burkholderia mallei (strain SAVP1) GN=tuf1 PE=3 SV=1 86 340 6.0E-16
sp|Q62GK3|EFTU_BURMA Elongation factor Tu OS=Burkholderia mallei (strain ATCC 23344) GN=tuf1 PE=3 SV=1 86 340 6.0E-16
sp|A2S7F9|EFTU_BURM9 Elongation factor Tu OS=Burkholderia mallei (strain NCTC 10229) GN=tuf1 PE=3 SV=1 86 340 6.0E-16
sp|A3MRT8|EFTU_BURM7 Elongation factor Tu OS=Burkholderia mallei (strain NCTC 10247) GN=tuf1 PE=3 SV=1 86 340 6.0E-16
sp|Q39Y08|EFTU_GEOMG Elongation factor Tu OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=tuf1 PE=3 SV=1 86 340 7.0E-16
sp|Q9P9Q9|EFTU_XYLFA Elongation factor Tu OS=Xylella fastidiosa (strain 9a5c) GN=tufA PE=1 SV=3 86 340 7.0E-16
sp|Q17VM8|EFTU_HELAH Elongation factor Tu OS=Helicobacter acinonychis (strain Sheeba) GN=tuf PE=3 SV=1 86 340 7.0E-16
sp|A5N4N1|EFTU_CLOK5 Elongation factor Tu OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=tuf1 PE=3 SV=1 86 340 7.0E-16
sp|C4K4F8|EFTU_HAMD5 Elongation factor Tu OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=tuf PE=3 SV=1 82 358 8.0E-16
sp|Q2YAZ9|EFTU_NITMU Elongation factor Tu OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=tuf1 PE=3 SV=1 86 340 8.0E-16
sp|Q46WC7|EFTU_CUPPJ Elongation factor Tu OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=tuf1 PE=3 SV=1 86 340 8.0E-16
sp|Q1LI13|EFTU_CUPMC Elongation factor Tu OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=tuf1 PE=3 SV=1 86 340 8.0E-16
sp|P42479|EFTU_STIAU Elongation factor Tu OS=Stigmatella aurantiaca GN=tuf PE=3 SV=2 86 340 8.0E-16
sp|Q8XGZ0|EFTU_RALSO Elongation factor Tu OS=Ralstonia solanacearum (strain GMI1000) GN=tufA PE=3 SV=1 86 340 8.0E-16
sp|A4JAM5|EFTU_BURVG Elongation factor Tu OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=tuf1 PE=3 SV=1 86 340 8.0E-16
sp|A5CW32|EFTU_VESOH Elongation factor Tu OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=tuf1 PE=3 SV=1 86 429 8.0E-16
sp|B8D851|EFTU_BUCAT Elongation factor Tu OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=tuf PE=3 SV=1 86 340 8.0E-16
sp|O31297|EFTU_BUCAI Elongation factor Tu OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=tuf PE=3 SV=2 86 340 8.0E-16
sp|B8D9U9|EFTU_BUCA5 Elongation factor Tu OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=tuf PE=3 SV=1 86 340 8.0E-16
sp|P33166|EFTU_BACSU Elongation factor Tu OS=Bacillus subtilis (strain 168) GN=tuf PE=3 SV=1 87 429 8.0E-16
sp|A7MKI5|EFTU_CROS8 Elongation factor Tu OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=tuf1 PE=3 SV=1 86 358 8.0E-16
sp|C0QVZ4|EFTU_BRAHW Elongation factor Tu OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=tuf PE=3 SV=1 86 340 8.0E-16
sp|B7GJ65|EFTU_ANOFW Elongation factor Tu OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=tuf PE=3 SV=1 86 340 8.0E-16
sp|Q5QWA3|EFTU_IDILO Elongation factor Tu OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=tuf1 PE=3 SV=1 86 340 8.0E-16
sp|B4S5M9|EFTU_PROA2 Elongation factor Tu OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=tuf PE=3 SV=1 86 340 8.0E-16
sp|P52854|EFTU_BRAHO Elongation factor Tu OS=Brachyspira hyodysenteriae GN=tuf PE=3 SV=1 86 340 9.0E-16
sp|A1T056|EFTU_PSYIN Elongation factor Tu OS=Psychromonas ingrahamii (strain 37) GN=tuf PE=3 SV=1 82 340 9.0E-16
sp|P49411|EFTU_HUMAN Elongation factor Tu, mitochondrial OS=Homo sapiens GN=TUFM PE=1 SV=2 86 340 9.0E-16
sp|B3E156|EFTU_METI4 Elongation factor Tu OS=Methylacidiphilum infernorum (isolate V4) GN=tuf PE=3 SV=1 79 340 9.0E-16
sp|A1JIH3|EFTU1_YERE8 Elongation factor Tu 1 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=tuf1 PE=3 SV=1 86 358 1.0E-15
sp|P13537|EFTU_THEMA Elongation factor Tu OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=tuf PE=3 SV=2 86 340 1.0E-15
sp|B1LBP2|EFTU_THESQ Elongation factor Tu OS=Thermotoga sp. (strain RQ2) GN=tuf PE=3 SV=1 86 340 1.0E-15
sp|A5IM81|EFTU_THEP1 Elongation factor Tu OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=tuf PE=3 SV=1 86 340 1.0E-15
sp|A4XI37|EFTU_CALS8 Elongation factor Tu OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=tuf PE=3 SV=1 86 340 1.0E-15
sp|Q9TKZ5|EFTU_NEPOL Elongation factor Tu, chloroplastic OS=Nephroselmis olivacea GN=tufA PE=3 SV=1 86 340 1.0E-15
sp|C0ZIH6|EFTU_BREBN Elongation factor Tu OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=tuf PE=3 SV=1 86 340 1.0E-15
sp|P49410|EFTU_BOVIN Elongation factor Tu, mitochondrial OS=Bos taurus GN=TUFM PE=1 SV=1 86 340 1.0E-15
sp|A7ZUJ2|EFTU2_ECO24 Elongation factor Tu 2 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=tuf2 PE=3 SV=1 86 340 1.0E-15
sp|A5DN78|EFTU_PICGU Elongation factor Tu, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TUF1 PE=3 SV=1 86 340 1.0E-15
sp|Q7MGR1|EFTU2_VIBVY Elongation factor Tu 2 OS=Vibrio vulnificus (strain YJ016) GN=tuf2 PE=3 SV=2 86 340 1.0E-15
sp|Q8DD27|EFTU1_VIBVU Elongation factor Tu 1 OS=Vibrio vulnificus (strain CMCP6) GN=tuf1 PE=3 SV=2 86 340 1.0E-15
sp|A3DJ00|EFTU_CLOTH Elongation factor Tu OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=tuf PE=3 SV=1 86 429 1.0E-15
sp|A1TJ05|EFTU_ACIAC Elongation factor Tu OS=Acidovorax citrulli (strain AAC00-1) GN=tuf1 PE=3 SV=1 86 358 1.0E-15
sp|Q8DCQ7|EFTU2_VIBVU Elongation factor Tu 2 OS=Vibrio vulnificus (strain CMCP6) GN=tuf2 PE=3 SV=1 86 340 1.0E-15
sp|Q1BDD3|EFTU_MYCSS Elongation factor Tu OS=Mycobacterium sp. (strain MCS) GN=tuf PE=3 SV=1 86 340 1.0E-15
sp|A1UBL1|EFTU_MYCSK Elongation factor Tu OS=Mycobacterium sp. (strain KMS) GN=tuf PE=3 SV=1 86 340 1.0E-15
sp|A3PV96|EFTU_MYCSJ Elongation factor Tu OS=Mycobacterium sp. (strain JLS) GN=tuf PE=3 SV=1 86 340 1.0E-15
sp|Q1XDK1|EFTU_PYRYE Elongation factor Tu, chloroplastic OS=Pyropia yezoensis GN=tufA PE=3 SV=1 86 429 1.0E-15
sp|A9NEN4|EFTU_ACHLI Elongation factor Tu OS=Acholeplasma laidlawii (strain PG-8A) GN=tuf PE=3 SV=1 86 340 1.0E-15
sp|B9K884|EFTU_THENN Elongation factor Tu OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=tuf PE=3 SV=1 86 340 1.0E-15
sp|Q4L3K9|EFTU_STAHJ Elongation factor Tu OS=Staphylococcus haemolyticus (strain JCSC1435) GN=tuf PE=3 SV=1 87 429 1.0E-15
sp|Q65QG6|EFTU_MANSM Elongation factor Tu OS=Mannheimia succiniciproducens (strain MBEL55E) GN=tuf1 PE=3 SV=1 86 340 1.0E-15
sp|A6TEX7|EFTU_KLEP7 Elongation factor Tu OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=tufA PE=3 SV=1 86 340 1.0E-15
sp|Q7VRP0|EFTU_BLOFL Elongation factor Tu OS=Blochmannia floridanus GN=tuf PE=3 SV=1 86 358 1.0E-15
sp|Q9JHW4|SELB_MOUSE Selenocysteine-specific elongation factor OS=Mus musculus GN=Eefsec PE=1 SV=2 81 391 1.0E-15
sp|Q83ES6|EFTU_COXBU Elongation factor Tu OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=tufA PE=1 SV=1 78 358 1.0E-15
sp|A9NAK7|EFTU_COXBR Elongation factor Tu OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=tuf1 PE=3 SV=1 78 358 1.0E-15
sp|A9KD33|EFTU_COXBN Elongation factor Tu OS=Coxiella burnetii (strain Dugway 5J108-111) GN=tuf1 PE=3 SV=1 78 358 1.0E-15
sp|Q3A9R3|EFTU1_CARHZ Elongation factor Tu 1 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=tuf1 PE=3 SV=1 86 340 1.0E-15
sp|A8YUS2|EFTU_LACH4 Elongation factor Tu OS=Lactobacillus helveticus (strain DPC 4571) GN=tuf PE=3 SV=1 86 340 1.0E-15
sp|A8EZL8|EFTU_RICCK Elongation factor Tu OS=Rickettsia canadensis (strain McKiel) GN=tuf PE=3 SV=1 86 358 1.0E-15
sp|A4SUU7|EFTU_POLSQ Elongation factor Tu OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=tuf1 PE=3 SV=1 86 340 1.0E-15
sp|P0A6N2|EFTU_ECOL6 Elongation factor Tu OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=tufA PE=3 SV=2 86 340 1.0E-15
sp|P0A6N3|EFTU_ECO57 Elongation factor Tu OS=Escherichia coli O157:H7 GN=tufA PE=3 SV=2 86 340 1.0E-15
sp|Q3YV04|EFTU2_SHISS Elongation factor Tu 2 OS=Shigella sonnei (strain Ss046) GN=tuf2 PE=3 SV=1 86 340 1.0E-15
sp|Q0SY20|EFTU2_SHIF8 Elongation factor Tu 2 OS=Shigella flexneri serotype 5b (strain 8401) GN=tuf2 PE=3 SV=1 86 340 1.0E-15
sp|Q1R5U4|EFTU2_ECOUT Elongation factor Tu 2 OS=Escherichia coli (strain UTI89 / UPEC) GN=tuf2 PE=3 SV=2 86 340 1.0E-15
sp|P0CE48|EFTU2_ECOLI Elongation factor Tu 2 OS=Escherichia coli (strain K12) GN=tufB PE=1 SV=1 86 340 1.0E-15
sp|B1IVA7|EFTU2_ECOLC Elongation factor Tu 2 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=tuf2 PE=3 SV=1 86 340 1.0E-15
sp|Q0TA85|EFTU2_ECOL5 Elongation factor Tu 2 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=tuf2 PE=3 SV=1 86 340 1.0E-15
sp|A1AIF3|EFTU2_ECOK1 Elongation factor Tu 2 OS=Escherichia coli O1:K1 / APEC GN=tuf2 PE=3 SV=1 86 340 1.0E-15
sp|A8A779|EFTU2_ECOHS Elongation factor Tu 2 OS=Escherichia coli O9:H4 (strain HS) GN=tuf2 PE=3 SV=1 86 340 1.0E-15
sp|Q7VJ74|EFTU_HELHP Elongation factor Tu OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=tuf PE=3 SV=1 78 340 2.0E-15
sp|Q83JC4|EFTU_SHIFL Elongation factor Tu OS=Shigella flexneri GN=tufA PE=3 SV=3 86 340 2.0E-15
sp|Q32B27|EFTU_SHIDS Elongation factor Tu OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=tuf1 PE=3 SV=1 86 340 2.0E-15
sp|Q31VV0|EFTU_SHIBS Elongation factor Tu OS=Shigella boydii serotype 4 (strain Sb227) GN=tuf1 PE=3 SV=1 86 340 2.0E-15
sp|Q3YWT3|EFTU1_SHISS Elongation factor Tu 1 OS=Shigella sonnei (strain Ss046) GN=tuf1 PE=3 SV=1 86 340 2.0E-15
sp|Q0SZX8|EFTU1_SHIF8 Elongation factor Tu 1 OS=Shigella flexneri serotype 5b (strain 8401) GN=tuf1 PE=3 SV=1 86 340 2.0E-15
sp|Q1R5Y2|EFTU1_ECOUT Elongation factor Tu 1 OS=Escherichia coli (strain UTI89 / UPEC) GN=tuf1 PE=1 SV=1 86 340 2.0E-15
sp|P0CE47|EFTU1_ECOLI Elongation factor Tu 1 OS=Escherichia coli (strain K12) GN=tufA PE=1 SV=1 86 340 2.0E-15
sp|B1IPW0|EFTU1_ECOLC Elongation factor Tu 1 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=tuf1 PE=3 SV=1 86 340 2.0E-15
sp|Q0TCC0|EFTU1_ECOL5 Elongation factor Tu 1 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=tuf1 PE=3 SV=1 86 340 2.0E-15
sp|A1AGM6|EFTU1_ECOK1 Elongation factor Tu 1 OS=Escherichia coli O1:K1 / APEC GN=tuf1 PE=3 SV=2 86 340 2.0E-15
sp|A8A5E6|EFTU1_ECOHS Elongation factor Tu 1 OS=Escherichia coli O9:H4 (strain HS) GN=tuf1 PE=3 SV=1 86 340 2.0E-15
sp|A7ZSL4|EFTU1_ECO24 Elongation factor Tu 1 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=tuf1 PE=3 SV=1 86 340 2.0E-15
sp|Q2EEV7|EFTU_HELSJ Elongation factor Tu, plastid OS=Helicosporidium sp. subsp. Simulium jonesii GN=tufA PE=3 SV=2 86 506 2.0E-15
sp|B9DKV8|EFTU_STACT Elongation factor Tu OS=Staphylococcus carnosus (strain TM300) GN=tuf PE=3 SV=1 87 429 2.0E-15
sp|B3EP63|EFTU_CHLPB Elongation factor Tu OS=Chlorobium phaeobacteroides (strain BS1) GN=tuf PE=3 SV=1 86 340 2.0E-15
sp|P51287|EFTU_PORPU Elongation factor Tu, chloroplastic OS=Porphyra purpurea GN=tufA PE=3 SV=1 86 429 2.0E-15
sp|Q8KT97|EFTU_RICFE Elongation factor Tu OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=tuf PE=3 SV=1 86 358 2.0E-15
sp|Q8D240|EFTU_WIGBR Elongation factor Tu OS=Wigglesworthia glossinidia brevipalpis GN=tuf PE=3 SV=1 86 340 2.0E-15
sp|P0A1H5|EFTU_SALTY Elongation factor Tu OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=tufA PE=3 SV=2 86 340 2.0E-15
sp|P0A1H6|EFTU_SALTI Elongation factor Tu OS=Salmonella typhi GN=tufA PE=3 SV=2 86 340 2.0E-15
sp|A9MT05|EFTU_SALPB Elongation factor Tu OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=tuf1 PE=3 SV=1 86 340 2.0E-15
sp|Q5PIW4|EFTU_SALPA Elongation factor Tu OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=tuf1 PE=3 SV=1 86 340 2.0E-15
sp|Q57H76|EFTU_SALCH Elongation factor Tu OS=Salmonella choleraesuis (strain SC-B67) GN=tuf1 PE=3 SV=1 86 340 2.0E-15
sp|A9MHG0|EFTU_SALAR Elongation factor Tu OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=tuf1 PE=3 SV=1 86 340 2.0E-15
sp|P33167|EFTU_BURCE Elongation factor Tu OS=Burkholderia cepacia GN=tuf PE=3 SV=1 86 340 2.0E-15
sp|A9WFP3|EFTU_CHLAA Elongation factor Tu OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=tuf1 PE=3 SV=1 86 340 2.0E-15
sp|Q3A9P8|EFTU2_CARHZ Elongation factor Tu 2 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=tuf2 PE=3 SV=1 86 340 2.0E-15
sp|A1T4L6|EFTU_MYCVP Elongation factor Tu OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=tuf PE=3 SV=1 86 340 2.0E-15
sp|B4RYQ8|EFTU_ALTMD Elongation factor Tu OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=tuf1 PE=3 SV=1 86 358 2.0E-15
sp|Q7UZY7|EFTU_PROMP Elongation factor Tu OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=tuf PE=3 SV=1 86 340 2.0E-15
sp|A8F4Q9|EFTU_PSELT Elongation factor Tu OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=tuf PE=3 SV=1 86 340 2.0E-15
sp|Q8KT99|EFTU_RICHE Elongation factor Tu OS=Rickettsia helvetica GN=tuf PE=3 SV=1 86 358 2.0E-15
sp|Q6LLV5|EFTU2_PHOPR Elongation factor Tu 2 OS=Photobacterium profundum GN=tuf2 PE=3 SV=2 86 340 2.0E-15
sp|P42476|EFTU_TERFE Elongation factor Tu OS=Terrimonas ferruginea GN=tuf PE=3 SV=1 86 340 2.0E-15
sp|Q839G8|EFTU_ENTFA Elongation factor Tu OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=tuf PE=3 SV=1 83 429 2.0E-15
sp|Q92GW4|EFTU_RICCN Elongation factor Tu OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=tuf PE=3 SV=1 86 358 2.0E-15
sp|Q85FT7|EFTU_CYAME Elongation factor Tu, chloroplastic OS=Cyanidioschyzon merolae GN=tufA PE=3 SV=1 86 429 2.0E-15
sp|P0A3B0|EFTU_RICSI Elongation factor Tu OS=Rickettsia sibirica GN=tuf PE=3 SV=1 86 358 2.0E-15
sp|P0A3A9|EFTU_RICRI Elongation factor Tu OS=Rickettsia rickettsii GN=tuf PE=3 SV=1 86 358 2.0E-15
sp|Q3MDM5|EFTU_ANAVT Elongation factor Tu OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=tuf PE=3 SV=1 86 340 2.0E-15
sp|Q4QMW6|EFTU1_HAEI8 Elongation factor Tu 1 OS=Haemophilus influenzae (strain 86-028NP) GN=tuf1 PE=3 SV=1 86 340 2.0E-15
sp|A2C4U5|EFTU_PROM1 Elongation factor Tu OS=Prochlorococcus marinus (strain NATL1A) GN=tuf PE=3 SV=1 86 340 2.0E-15
sp|A6VKH7|EFTU_ACTSZ Elongation factor Tu OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=tuf1 PE=3 SV=1 86 340 2.0E-15
sp|A1BJ36|EFTU_CHLPD Elongation factor Tu OS=Chlorobium phaeobacteroides (strain DSM 266) GN=tuf PE=3 SV=1 86 340 2.0E-15
sp|Q03YI2|EFTU_LEUMM Elongation factor Tu OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=tuf PE=3 SV=1 86 340 2.0E-15
sp|A8GT71|EFTU_RICRS Elongation factor Tu OS=Rickettsia rickettsii (strain Sheila Smith) GN=tuf PE=3 SV=1 86 358 2.0E-15
sp|B0BUR2|EFTU_RICRO Elongation factor Tu OS=Rickettsia rickettsii (strain Iowa) GN=tuf PE=3 SV=1 86 358 2.0E-15
sp|C4K2I2|EFTU_RICPU Elongation factor Tu OS=Rickettsia peacockii (strain Rustic) GN=tuf PE=3 SV=1 86 358 2.0E-15
sp|C3PPA9|EFTU_RICAE Elongation factor Tu OS=Rickettsia africae (strain ESF-5) GN=tuf PE=3 SV=1 86 358 2.0E-15
sp|Q6LVC0|EFTU1_PHOPR Elongation factor Tu 1 OS=Photobacterium profundum GN=tuf1 PE=3 SV=1 86 340 2.0E-15
sp|Q8YP63|EFTU_NOSS1 Elongation factor Tu OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=tuf PE=1 SV=1 86 340 2.0E-15
sp|A5GAW4|EFTU_GEOUR Elongation factor Tu OS=Geobacter uraniireducens (strain Rf4) GN=tuf1 PE=3 SV=1 86 340 2.0E-15
sp|A5F3K0|EFTU_VIBC3 Elongation factor Tu OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=tuf1 PE=3 SV=1 86 340 2.0E-15
sp|Q9KUZ6|EFTU2_VIBCH Elongation factor Tu-B OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=tufB PE=3 SV=1 86 340 2.0E-15
sp|A1WCN6|EFTU2_ACISJ Elongation factor Tu 2 OS=Acidovorax sp. (strain JS42) GN=tuf2 PE=3 SV=1 86 340 2.0E-15
sp|Q04FQ4|EFTU_OENOB Elongation factor Tu OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=tuf PE=3 SV=1 86 340 2.0E-15
sp|P59506|EFTU_BUCBP Elongation factor Tu OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=tuf PE=3 SV=1 86 340 2.0E-15
sp|Q7MH43|EFTU1_VIBVY Elongation factor Tu 1 OS=Vibrio vulnificus (strain YJ016) GN=tuf1 PE=3 SV=1 86 340 2.0E-15
sp|O21245|EFTU_RECAM Elongation factor Tu, mitochondrial OS=Reclinomonas americana GN=TUFA PE=3 SV=1 87 340 2.0E-15
sp|Q255F3|EFTU_CHLFF Elongation factor Tu OS=Chlamydophila felis (strain Fe/C-56) GN=tuf PE=3 SV=1 86 340 3.0E-15
sp|Q46IW4|EFTU_PROMT Elongation factor Tu OS=Prochlorococcus marinus (strain NATL2A) GN=tuf PE=3 SV=1 86 340 3.0E-15
sp|Q6CZW6|EFTU_PECAS Elongation factor Tu OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=tuf1 PE=3 SV=1 86 340 3.0E-15
sp|P13927|EFTU_MYCGE Elongation factor Tu OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=tuf PE=3 SV=1 86 340 3.0E-15
sp|A6Q6H4|EFTU_SULNB Elongation factor Tu OS=Sulfurovum sp. (strain NBC37-1) GN=tuf PE=3 SV=1 86 340 3.0E-15
sp|C5D3R5|EFTU_GEOSW Elongation factor Tu OS=Geobacillus sp. (strain WCH70) GN=tuf PE=3 SV=1 82 363 3.0E-15
sp|Q8R7T8|EFTU2_CALS4 Elongation factor Tu-B OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=tufB PE=3 SV=1 86 340 3.0E-15
sp|B2J5B1|EFTU_NOSP7 Elongation factor Tu OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=tuf PE=3 SV=1 86 340 3.0E-15
sp|Q20EU5|EFTU_OLTVI Elongation factor Tu, chloroplastic OS=Oltmannsiellopsis viridis GN=tufA PE=3 SV=1 86 340 3.0E-15
sp|A8Z5T8|EFTU_SULMW Elongation factor Tu OS=Sulcia muelleri (strain GWSS) GN=tuf PE=3 SV=1 75 340 3.0E-15
sp|P57772|SELB_HUMAN Selenocysteine-specific elongation factor OS=Homo sapiens GN=EEFSEC PE=1 SV=4 82 391 3.0E-15
sp|Q5L3Z9|EFTU_GEOKA Elongation factor Tu OS=Geobacillus kaustophilus (strain HTA426) GN=tuf PE=3 SV=1 86 340 3.0E-15
sp|A5USJ1|EFTU1_ROSS1 Elongation factor Tu 1 OS=Roseiflexus sp. (strain RS-1) GN=tuf1 PE=3 SV=1 86 429 3.0E-15
sp|Q47LJ1|EFTU_THEFY Elongation factor Tu OS=Thermobifida fusca (strain YX) GN=tuf PE=3 SV=1 86 340 3.0E-15
sp|Q5L5H6|EFTU_CHLAB Elongation factor Tu OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=tuf PE=3 SV=1 86 340 3.0E-15
sp|A1W2Q5|EFTU1_ACISJ Elongation factor Tu 1 OS=Acidovorax sp. (strain JS42) GN=tuf1 PE=3 SV=1 86 340 3.0E-15
sp|P43926|EFTU_HAEIN Elongation factor Tu OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=tufA PE=3 SV=2 86 340 3.0E-15
sp|A5UHC1|EFTU_HAEIG Elongation factor Tu OS=Haemophilus influenzae (strain PittGG) GN=tuf PE=3 SV=1 86 340 3.0E-15
sp|A5U9R1|EFTU_HAEIE Elongation factor Tu OS=Haemophilus influenzae (strain PittEE) GN=tuf1 PE=3 SV=1 86 340 3.0E-15
sp|Q4QMT5|EFTU2_HAEI8 Elongation factor Tu 2 OS=Haemophilus influenzae (strain 86-028NP) GN=tuf2 PE=3 SV=1 86 340 3.0E-15
sp|Q73PN3|EFTU_TREDE Elongation factor Tu OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=tuf PE=3 SV=1 86 340 3.0E-15
sp|P23568|EFTU_MYCPN Elongation factor Tu OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=tuf PE=3 SV=2 86 340 3.0E-15
sp|Q6MDN0|EFTU_PARUW Elongation factor Tu OS=Protochlamydia amoebophila (strain UWE25) GN=tuf PE=3 SV=1 82 340 4.0E-15
sp|A4W5A0|EFTU_ENT38 Elongation factor Tu OS=Enterobacter sp. (strain 638) GN=tuf1 PE=3 SV=1 86 340 4.0E-15
sp|B4SBU5|EFTU_PELPB Elongation factor Tu OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=tuf PE=3 SV=1 86 340 4.0E-15
sp|Q8R7V2|EFTU1_CALS4 Elongation factor Tu-A OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=tufA PE=3 SV=1 86 340 4.0E-15
sp|B8DLL9|EFTU_DESVM Elongation factor Tu OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=tuf PE=3 SV=1 82 340 4.0E-15
sp|Q3ILP4|EFTU1_PSEHT Elongation factor Tu 1 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=tuf1 PE=3 SV=1 86 340 4.0E-15
sp|P48865|EFTU_RICPR Elongation factor Tu OS=Rickettsia prowazekii (strain Madrid E) GN=tuf PE=3 SV=2 86 340 4.0E-15
sp|Q30X13|EFTU_DESAG Elongation factor Tu OS=Desulfovibrio alaskensis (strain G20) GN=tuf PE=3 SV=1 86 358 4.0E-15
sp|Q3IJV1|EFTU2_PSEHT Elongation factor Tu 2 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=tuf2 PE=3 SV=1 86 340 4.0E-15
sp|Q5YPG4|EFTU_NOCFA Elongation factor Tu OS=Nocardia farcinica (strain IFM 10152) GN=tuf PE=3 SV=2 86 340 4.0E-15
sp|Q9ZEU3|EFTU_APPPP Elongation factor Tu OS=Apple proliferation phytoplasma GN=tuf PE=3 SV=1 86 340 5.0E-15
sp|A4XZ92|EFTU_PSEMY Elongation factor Tu OS=Pseudomonas mendocina (strain ymp) GN=tuf PE=3 SV=1 86 340 5.0E-15
sp|Q822I4|EFTU_CHLCV Elongation factor Tu OS=Chlamydophila caviae (strain GPIC) GN=tuf PE=3 SV=3 86 340 5.0E-15
sp|P42482|EFTU_WOLSU Elongation factor Tu OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=tuf PE=3 SV=2 78 340 5.0E-15
sp|Q67JU1|EFTU_SYMTH Elongation factor Tu OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=tuf PE=3 SV=1 86 340 5.0E-15
sp|A4T1R2|EFTU_MYCGI Elongation factor Tu OS=Mycobacterium gilvum (strain PYR-GCK) GN=tuf PE=3 SV=1 86 340 5.0E-15
sp|Q8KT95|EFTU_RICTY Elongation factor Tu OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=tuf PE=3 SV=2 86 340 5.0E-15
sp|A6LPP6|EFTU_CLOB8 Elongation factor Tu OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=tuf1 PE=3 SV=1 86 340 5.0E-15
sp|A0QS98|EFTU_MYCS2 Elongation factor Tu OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=tuf PE=1 SV=1 86 340 5.0E-15
sp|Q5FKR8|EFTU_LACAC Elongation factor Tu OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=tuf PE=3 SV=1 86 372 5.0E-15
sp|A7NR65|EFTU1_ROSCS Elongation factor Tu 1 OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=tuf1 PE=3 SV=1 86 429 6.0E-15
sp|A6GYU7|EFTU_FLAPJ Elongation factor Tu OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=tuf PE=3 SV=1 86 340 6.0E-15
sp|Q664R7|EFTU2_YERPS Elongation factor Tu 2 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=tuf2 PE=3 SV=1 86 340 6.0E-15
sp|Q1CCT9|EFTU2_YERPN Elongation factor Tu 2 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=tuf2 PE=3 SV=1 86 340 6.0E-15
sp|A7FNN8|EFTU2_YERP3 Elongation factor Tu 2 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=tuf2 PE=3 SV=1 86 340 6.0E-15
sp|A4TGY7|EFTU1_YERPP Elongation factor Tu 1 OS=Yersinia pestis (strain Pestoides F) GN=tuf1 PE=3 SV=1 86 340 6.0E-15
sp|Q8ZJB2|EFTU1_YERPE Elongation factor Tu-A OS=Yersinia pestis GN=tufA PE=3 SV=1 86 340 6.0E-15
sp|Q1C2U1|EFTU1_YERPA Elongation factor Tu 1 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=tuf1 PE=3 SV=1 86 340 6.0E-15
sp|A4IJI7|EFTU_GEOTN Elongation factor Tu OS=Geobacillus thermodenitrificans (strain NG80-2) GN=tuf PE=3 SV=1 86 340 6.0E-15
sp|B1KSM7|EFTU_CLOBM Elongation factor Tu OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=tuf1 PE=3 SV=1 86 340 6.0E-15
sp|A4WVL0|EFTU_RHOS5 Elongation factor Tu OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=tuf1 PE=3 SV=1 86 340 7.0E-15
sp|A7GJ76|EFTU_CLOBL Elongation factor Tu OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=tuf1 PE=3 SV=1 86 340 7.0E-15
sp|B1IGF6|EFTU_CLOBK Elongation factor Tu OS=Clostridium botulinum (strain Okra / Type B1) GN=tuf1 PE=3 SV=1 86 340 7.0E-15
sp|A5I7K8|EFTU_CLOBH Elongation factor Tu OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=tuf1 PE=3 SV=1 86 340 7.0E-15
sp|A7FZ71|EFTU_CLOB1 Elongation factor Tu OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=tuf1 PE=3 SV=1 86 340 7.0E-15
sp|Q7VA05|EFTU_PROMA Elongation factor Tu OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=tuf PE=3 SV=1 86 340 7.0E-15
sp|Q4ZMP2|EFTU_PSEU2 Elongation factor Tu OS=Pseudomonas syringae pv. syringae (strain B728a) GN=tuf PE=3 SV=1 86 358 7.0E-15
sp|Q605B0|EFTU_METCA Elongation factor Tu OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=tuf1 PE=3 SV=1 86 340 7.0E-15
sp|Q9TJQ8|EFTU_PROWI Elongation factor Tu, plastid OS=Prototheca wickerhamii GN=tufA PE=3 SV=1 82 340 7.0E-15
sp|A6LLL1|EFTU_THEM4 Elongation factor Tu OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=tuf PE=3 SV=1 86 340 7.0E-15
sp|P18906|EFTU_MYCGA Elongation factor Tu OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=tuf PE=3 SV=1 86 340 7.0E-15
sp|P09953|EFTU_MICLU Elongation factor Tu OS=Micrococcus luteus GN=tuf PE=3 SV=1 83 340 7.0E-15
sp|P72231|EFTU_PLARO Elongation factor Tu OS=Planobispora rosea GN=tuf PE=3 SV=2 86 363 7.0E-15
sp|Q8CQ81|EFTU_STAES Elongation factor Tu OS=Staphylococcus epidermidis (strain ATCC 12228) GN=tuf PE=3 SV=1 87 340 8.0E-15
sp|Q5HRK4|EFTU_STAEQ Elongation factor Tu OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=tuf PE=3 SV=1 87 340 8.0E-15
sp|C0Q9Y7|EFTU_DESAH Elongation factor Tu OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=tuf PE=3 SV=1 86 340 9.0E-15
sp|Q8KTA1|EFTU_RICMO Elongation factor Tu OS=Rickettsia montanensis GN=tuf PE=3 SV=1 86 358 9.0E-15
sp|P74227|EFTU_SYNY3 Elongation factor Tu OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=tuf PE=1 SV=1 86 340 1.0E-14
sp|A8GKK1|EFTU2_SERP5 Elongation factor Tu 2 OS=Serratia proteamaculans (strain 568) GN=tuf2 PE=3 SV=1 86 340 1.0E-14
sp|A8G8E0|EFTU1_SERP5 Elongation factor Tu 1 OS=Serratia proteamaculans (strain 568) GN=tuf1 PE=3 SV=1 86 340 1.0E-14
sp|P57966|EFTU2_PASMU Elongation factor Tu-B OS=Pasteurella multocida (strain Pm70) GN=tufB PE=3 SV=1 86 340 1.0E-14
sp|A7MXE4|EFTU_VIBCB Elongation factor Tu OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=tuf1 PE=3 SV=1 86 340 1.0E-14
sp|Q4FLK5|EFTU_PELUB Elongation factor Tu OS=Pelagibacter ubique (strain HTCC1062) GN=tuf PE=3 SV=1 87 340 1.0E-14
sp|A7HM54|EFTU_FERNB Elongation factor Tu OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=tuf PE=3 SV=1 86 340 1.0E-14
sp|Q8KTA6|EFTU_RICPA Elongation factor Tu OS=Rickettsia parkeri GN=tuf PE=3 SV=1 86 358 1.0E-14
sp|Q6AP73|EFTU2_DESPS Elongation factor Tu 2 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=tuf2 PE=3 SV=1 86 358 1.0E-14
sp|Q0AUG3|EFTU2_SYNWW Elongation factor Tu 2 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=tuf2 PE=3 SV=1 86 340 1.0E-14
sp|P57939|EFTU1_PASMU Elongation factor Tu-A OS=Pasteurella multocida (strain Pm70) GN=tufA PE=3 SV=1 86 340 1.0E-14
sp|A1TYJ5|EFTU_MARHV Elongation factor Tu OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=tuf PE=3 SV=1 86 429 1.0E-14
sp|Q0P3M7|EFTU_OSTTA Elongation factor Tu, chloroplastic OS=Ostreococcus tauri GN=tufA PE=3 SV=1 86 429 1.0E-14
sp|P29542|EFTU1_STRRA Elongation factor Tu-1 OS=Streptomyces ramocissimus GN=tuf1 PE=3 SV=1 86 340 1.0E-14
sp|A5WH42|EFTU2_PSYWF Elongation factor Tu 2 OS=Psychrobacter sp. (strain PRwf-1) GN=tuf2 PE=3 SV=1 86 358 1.0E-14
sp|B0JSE0|EFTU_MICAN Elongation factor Tu OS=Microcystis aeruginosa (strain NIES-843) GN=tuf PE=3 SV=1 86 340 1.0E-14
sp|B0TC54|EFTU_HELMI Elongation factor Tu OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=tuf PE=3 SV=1 86 340 1.0E-14
sp|Q1LSY4|EFTU_BAUCH Elongation factor Tu OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=tuf PE=3 SV=1 86 340 1.0E-14
sp|B8ELG5|EFTU_METSB Elongation factor Tu OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=tuf PE=3 SV=1 87 340 1.0E-14
sp|A8GPF2|EFTU_RICAH Elongation factor Tu OS=Rickettsia akari (strain Hartford) GN=tuf PE=3 SV=1 86 340 1.0E-14
sp|A7GK18|EFTU_BACCN Elongation factor Tu OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=tuf PE=3 SV=1 86 429 1.0E-14
sp|P42471|EFTU_BRELN Elongation factor Tu OS=Brevibacterium linens GN=tuf PE=3 SV=1 86 363 1.0E-14
sp|Q5GSU2|EFTU1_WOLTR Elongation factor Tu 1 OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=tuf1 PE=3 SV=1 86 340 2.0E-14
sp|A0KQ95|EFTU_AERHH Elongation factor Tu OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=tuf1 PE=3 SV=1 86 358 2.0E-14
sp|Q3J5S4|EFTU_RHOS4 Elongation factor Tu OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=tuf1 PE=3 SV=1 86 340 2.0E-14
sp|A3PGI1|EFTU_RHOS1 Elongation factor Tu OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=tuf1 PE=3 SV=1 86 340 2.0E-14
sp|Q2JUX4|EFTU_SYNJA Elongation factor Tu OS=Synechococcus sp. (strain JA-3-3Ab) GN=tuf PE=3 SV=1 86 340 2.0E-14
sp|B1MY04|EFTU_LEUCK Elongation factor Tu OS=Leuconostoc citreum (strain KM20) GN=tuf PE=3 SV=1 86 340 2.0E-14
sp|A0M3Z6|EFTU_GRAFK Elongation factor Tu OS=Gramella forsetii (strain KT0803) GN=tuf PE=3 SV=1 86 340 2.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0003924 GTPase activity Yes
GO:0005525 GTP binding Yes
GO:0016462 pyrophosphatase activity No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:1901265 nucleoside phosphate binding No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016787 hydrolase activity No
GO:0005488 binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0036094 small molecule binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0032555 purine ribonucleotide binding No
GO:0019001 guanyl nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1941
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6089 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7657
Ophiocordyceps camponoti-floridani Ophcf2|00401
Ophiocordyceps camponoti-rufipedis Ophun1|3972
Ophiocordyceps kimflemingae Ophio5|6343
Ophiocordyceps subramaniannii Hirsu2|2079

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6089
MSANGDPKFDDVDSESDSGESYDGNHNAGDGVDEKSLKPAIKNVNRAIPDQTIQRPPLPPQTDPKDLDVASLNPL
TPEIIARQATINIGTIGHVAHGKSTVVKAISGVQTVRFKNELIRNITIKLGYANAKIYKCDNPQCPRPGCYRSYK
SEKEVDPPCEREGCTGTYRLLRHVSFVDCPGHDILMSTMLSGAAVMDAALLLIAGNETCPQPQTSEHLAAIEIMK
LDKIIILQNKVDLMRDEAAQQHYQSILKFIRGTVAGKSPVIPISAQLKFNIDAVNEAIVNTIPVPLRDFSLDPHM
IVIRSFDVNKPGAEIDDLKGGVAGGSILHGVVKLGDEIEIRPGIVSRDDSGALKCTPIFSRIVSLNSEANELKYA
VPGGLIGVGTRIDPTLCRADRLVGFVLGLKGKLPEIYSEIEVNFYLLRRLLGVRTADGKQAKVAKLAKNEVIMVN
IGSTSTGAKVAAIKNDAAKLVLTSPACTSIGEKVALSRRIEKHWRLIGWATIAAGVTLEPTMS*
Coding >OphauG2|6089
ATGTCTGCAAACGGAGACCCCAAATTCGACGATGTCGACTCCGAGTCTGACTCTGGTGAATCGTATGACGGCAAT
CATAACGCAGGTGACGGTGTCGATGAAAAATCACTTAAACCTGCCATCAAAAACGTCAACCGTGCAATCCCAGAC
CAGACTATCCAAAGACCCCCATTGCCTCCGCAGACGGATCCCAAAGACCTCGATGTTGCCAGTCTCAATCCACTA
ACACCAGAGATTATCGCGCGCCAAGCAACCATCAATATCGGCACCATTGGTCATGTCGCCCACGGCAAATCTACC
GTTGTCAAGGCCATATCCGGCGTCCAGACTGTTCGCTTCAAGAACGAGCTCATCCGCAACATTACCATCAAACTC
GGGTATGCCAACGCAAAAATTTACAAGTGCGACAACCCCCAGTGCCCTCGCCCTGGTTGCTACCGGAGCTACAAG
AGCGAAAAGGAGGTCGACCCACCATGTGAGCGCGAAGGCTGCACTGGCACATACAGACTGCTGCGCCATGTCTCA
TTTGTCGATTGTCCAGGTCACGATATTCTCATGAGCACCATGTTGTCGGGGGCCGCTGTCATGGATGCTGCCCTC
TTACTCATTGCTGGAAATGAAACCTGTCCTCAACCTCAGACCTCTGAGCATTTGGCAGCCATTGAAATCATGAAG
CTCGACAAGATTATTATCCTGCAAAACAAAGTTGATCTCATGAGAGACGAGGCCGCACAGCAACACTACCAGTCC
ATATTAAAATTCATTCGAGGAACCGTTGCTGGTAAATCGCCCGTCATTCCCATTTCAGCTCAGCTCAAGTTCAAC
ATTGATGCCGTCAATGAGGCCATTGTCAACACCATTCCCGTGCCTTTGCGAGACTTTAGTCTGGATCCGCACATG
ATTGTCATTCGCTCTTTTGACGTGAACAAGCCTGGTGCTGAGATTGATGATCTCAAAGGCGGTGTCGCTGGCGGA
AGTATACTTCACGGCGTTGTCAAACTTGGCGACGAAATTGAGATACGCCCAGGCATTGTCTCCCGCGACGACAGC
GGCGCACTCAAATGTACGCCCATCTTCAGTCGAATCGTGTCGCTCAACTCAGAGGCCAACGAGCTCAAGTATGCC
GTGCCTGGTGGTCTGATTGGTGTGGGCACACGCATCGACCCCACCCTTTGCAGAGCAGATCGCTTGGTCGGCTTT
GTCCTCGGTCTCAAAGGCAAGCTGCCAGAGATTTACAGCGAGATCGAAGTCAACTTTTACCTTCTGCGTCGTCTG
CTTGGAGTGCGGACAGCCGACGGCAAGCAGGCAAAGGTTGCCAAGCTAGCCAAGAATGAAGTCATCATGGTCAAT
ATTGGGTCGACCTCGACTGGTGCCAAGGTTGCTGCCATCAAGAACGATGCTGCCAAGCTGGTTCTTACCAGCCCT
GCTTGTACAAGCATCGGCGAGAAGGTTGCCCTAAGTCGACGCATTGAAAAGCACTGGCGTCTCATCGGCTGGGCT
ACCATCGCAGCCGGTGTCACACTGGAGCCCACCATGTCTTGA
Transcript >OphauG2|6089
ATGTCTGCAAACGGAGACCCCAAATTCGACGATGTCGACTCCGAGTCTGACTCTGGTGAATCGTATGACGGCAAT
CATAACGCAGGTGACGGTGTCGATGAAAAATCACTTAAACCTGCCATCAAAAACGTCAACCGTGCAATCCCAGAC
CAGACTATCCAAAGACCCCCATTGCCTCCGCAGACGGATCCCAAAGACCTCGATGTTGCCAGTCTCAATCCACTA
ACACCAGAGATTATCGCGCGCCAAGCAACCATCAATATCGGCACCATTGGTCATGTCGCCCACGGCAAATCTACC
GTTGTCAAGGCCATATCCGGCGTCCAGACTGTTCGCTTCAAGAACGAGCTCATCCGCAACATTACCATCAAACTC
GGGTATGCCAACGCAAAAATTTACAAGTGCGACAACCCCCAGTGCCCTCGCCCTGGTTGCTACCGGAGCTACAAG
AGCGAAAAGGAGGTCGACCCACCATGTGAGCGCGAAGGCTGCACTGGCACATACAGACTGCTGCGCCATGTCTCA
TTTGTCGATTGTCCAGGTCACGATATTCTCATGAGCACCATGTTGTCGGGGGCCGCTGTCATGGATGCTGCCCTC
TTACTCATTGCTGGAAATGAAACCTGTCCTCAACCTCAGACCTCTGAGCATTTGGCAGCCATTGAAATCATGAAG
CTCGACAAGATTATTATCCTGCAAAACAAAGTTGATCTCATGAGAGACGAGGCCGCACAGCAACACTACCAGTCC
ATATTAAAATTCATTCGAGGAACCGTTGCTGGTAAATCGCCCGTCATTCCCATTTCAGCTCAGCTCAAGTTCAAC
ATTGATGCCGTCAATGAGGCCATTGTCAACACCATTCCCGTGCCTTTGCGAGACTTTAGTCTGGATCCGCACATG
ATTGTCATTCGCTCTTTTGACGTGAACAAGCCTGGTGCTGAGATTGATGATCTCAAAGGCGGTGTCGCTGGCGGA
AGTATACTTCACGGCGTTGTCAAACTTGGCGACGAAATTGAGATACGCCCAGGCATTGTCTCCCGCGACGACAGC
GGCGCACTCAAATGTACGCCCATCTTCAGTCGAATCGTGTCGCTCAACTCAGAGGCCAACGAGCTCAAGTATGCC
GTGCCTGGTGGTCTGATTGGTGTGGGCACACGCATCGACCCCACCCTTTGCAGAGCAGATCGCTTGGTCGGCTTT
GTCCTCGGTCTCAAAGGCAAGCTGCCAGAGATTTACAGCGAGATCGAAGTCAACTTTTACCTTCTGCGTCGTCTG
CTTGGAGTGCGGACAGCCGACGGCAAGCAGGCAAAGGTTGCCAAGCTAGCCAAGAATGAAGTCATCATGGTCAAT
ATTGGGTCGACCTCGACTGGTGCCAAGGTTGCTGCCATCAAGAACGATGCTGCCAAGCTGGTTCTTACCAGCCCT
GCTTGTACAAGCATCGGCGAGAAGGTTGCCCTAAGTCGACGCATTGAAAAGCACTGGCGTCTCATCGGCTGGGCT
ACCATCGCAGCCGGTGTCACACTGGAGCCCACCATGTCTTGA
Gene >OphauG2|6089
ATGTCTGCAAACGGAGACCCCAAATTCGACGATGTCGACTCCGAGTCTGACTCTGGTGAATCGTATGACGGCAAT
CATAACGCAGGTGACGGTGTCGATGAAAAATCACTTAAACCTGCCATCAAAAACGTCAACCGTGCAATCCCAGAC
CAGACTATCCAAAGACCCCCATTGCCTCCGCAGACGGATCCCAAAGACCTCGATGTTGCCAGTCTCAATCCACTA
ACACCAGAGATTATCGCGCGCCAAGCAACCATCAATATCGGCACCATTGGTCATGTCGCCCACGGCAAATCTACC
GTTGTCAAGGCCATATCCGGCGTCCAGACTGTTCGCTTCAAGAACGAGCTCATCCGCAACATTACCATCAAACTC
GGGTATGCCAACGCAAAAATTTACAAGTGCGACAACCCCCAGTGCCCTCGCCCTGGTTGCTACCGGAGCTACAAG
AGCGAAAAGGAGGTCGACCCACCATGTGAGCGCGAAGGCTGCACTGGCACATACAGACTGCTGCGCCATGTCTCG
TAAGTTGCTTCCACTGCCTACTACCATTTCACAAACAACCGTAAACAAGCTAACACTCTTGACTACTCAAGATTT
GTCGATTGTCCAGGTCACGATATTCTCATGAGCACCATGTTGTCGGGGGCCGCTGTCATGGATGCTGCCCTCTTA
CTCATTGCTGGAAATGAAACCTGTCCTCAACCTCAGACCTCTGAGCATTTGGCAGCCATTGAAATCATGAAGCTC
GACAAGATTATTATCCTGCAAAACAAAGTTGATCTCATGAGAGACGAGGCCGCACAGCAACACTACCAGTCCATA
TTAAAATTCATTCGAGGAACCGTTGCTGGTAAATCGCCCGTCATTCCCATTTCAGCTCAGCTCAAGTTCAACATT
GATGCCGTCAATGAGGCCATTGTCAACACCATTCCCGTGCCTTTGCGAGACTTTAGTCTGGATCCGCACATGATT
GTCATTCGCTCTTTTGACGTGAACAAGCCTGGTGCTGAGATTGATGATCTCAAAGGCGGTGTCGCTGGCGGAAGT
ATACTTCACGGCGTTGTCAAACTTGGCGACGAAATTGAGATACGCCCAGGCATTGTCTCCCGCGACGACAGCGGC
GCACTCAAATGTACGCCCATCTTCAGTCGAATCGTGTCGCTCAACTCAGAGGCCAACGAGCTCAAGTATGCCGTG
CCTGGTGGTCTGATTGGTGTGGGCACACGCATCGACCCCACCCTTTGCAGAGCAGATCGCTTGGTCGGCTTTGTC
CTCGGTCTCAAAGGCAAGCTGCCAGAGATTTACAGCGAGATCGAAGTCAACTTTTACCTTCTGCGTCGTCTGCTT
GGAGTGCGGACAGCCGACGGCAAGCAGGCAAAGGTTGCCAAGCTAGCCAAGAATGAAGTCATCATGGTCAATATT
GGGTCGACCTCGACTGGTGCCAAGGTTGCTGCCATCAAGAACGATGCTGCCAAGCTGGTTCTTACCAGCCCTGCT
TGTACAAGCATCGGCGAGAAGGTTGCCCTAAGTCGACGCATTGAAAAGCACTGGCGTCTCATCGGCTGGGCTACC
ATCGCAGCGTAAGTCGTGCTTGCCAAAATATTCCAACTGCGCCGCTAACTTGTTCATGAAGCGGTGTCACACTGG
AGCCCACCATGTCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail