Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6085
Gene name
LocationContig_6:54930..57219
Strand-
Gene length (bp)2289
Transcript length (bp)2175
Coding sequence length (bp)2175
Protein length (aa) 725

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08590 DUF1771 Domain of unknown function (DUF1771) 4.9E-14 525 588
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 3.8E-02 287 305
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 4.7E-04 311 330
PF01713 Smr Smr domain 5.2E-07 600 656

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O64843|CID7_ARATH Polyadenylate-binding protein-interacting protein 7 OS=Arabidopsis thaliana GN=CID7 PE=1 SV=1 514 642 9.0E-18
sp|Q6ZPZ3|ZC3H4_MOUSE Zinc finger CCCH domain-containing protein 4 OS=Mus musculus GN=Zc3h4 PE=1 SV=2 282 347 7.0E-09
sp|Q9UPT8|ZC3H4_HUMAN Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens GN=ZC3H4 PE=1 SV=3 282 347 9.0E-09
sp|Q86UW6|N4BP2_HUMAN NEDD4-binding protein 2 OS=Homo sapiens GN=N4BP2 PE=1 SV=2 525 667 7.0E-07
sp|Q9UTP4|YLL3_SCHPO Smr domain-containing protein C11H11.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11H11.03c PE=3 SV=1 523 660 1.0E-05

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6085
MISDEHYELCLPILQDPNLEDEDKTDRLEIALKDETGLTGSSLENIILDALWRYREVGGGSTSPPPIRPSILRRP
SPASWRGSPTPLPGSPRLGVSPLAPAGYISSTLNRAKSSTASPFSSPRASPRLALATPVIPHSPNLNAYEFASDP
TPPTEILGDYQMENVEWLVNDDAASVSSSAGASSSVLNAAAPEFSSLSSQQTDMSPYDMLRSILGQTRTDPEIEA
ALSLHGYDLSATITSIMESQTADGVTMATANEEPKGVLIGKSIMTDARPATPLGQQKSGVVCKFYMSTGQCLRAD
CRFSHDLSNYLCKYWVMGNCLAGDTCIFSHDPTNLVGKLGLDEAEAGTGRNDGLDDGTWFPALQPETSGTKGSSA
AGACVGGPLGAPPPGPRHLQGTESPRLRSRPGSRQQVKNSPMSAPAMDDNEAFPSLGAALSKQGKKHHGKRGGHG
HGHKENLAPSSLADIVKRTPSPASGPSLRSESRRAGMNGSAAGPRSGENSAAALAIPSPKHIPWLETGEWANKSY
LKARQDAIKHGGLRNKFLQSAAQAWNRNDARAAKALSLRGQSENDLMRKAHREAARELYQKRNKTDVNSGNEIFV
DLHGLHAEEAVEYLEKVLLENSRETQPIYAITGTGHHSKNGKDKVGRTVRGFLNEWRYAYREFSVPGDRNNMGGI
LGIDARSWDKSLGRFEEDEPDILSQGVEIGDGKVRLLVRDAAKGPGSRR*
Coding >OphauG2|6085
ATGATCTCAGACGAGCACTACGAGCTTTGTCTGCCTATTCTGCAGGATCCAAACCTCGAGGATGAAGATAAGACA
GACAGACTCGAAATAGCGCTCAAAGACGAGACGGGTCTCACGGGCTCGTCGCTCGAAAATATCATCCTTGACGCG
CTCTGGAGATATCGCGAGGTTGGAGGAGGCTCGACATCGCCCCCGCCTATCCGCCCATCAATCCTTCGCCGACCT
TCCCCGGCGTCATGGCGCGGGTCGCCAACTCCTCTGCCGGGATCCCCGCGACTCGGCGTAAGTCCGCTTGCGCCG
GCCGGATACATATCATCGACACTCAACAGAGCAAAATCGTCGACAGCGTCTCCCTTTTCCTCCCCGCGGGCATCC
CCGCGCCTAGCTCTTGCGACCCCAGTGATACCGCACAGTCCGAATCTTAATGCCTACGAGTTTGCGTCAGACCCT
ACTCCGCCCACGGAAATACTGGGCGACTACCAGATGGAAAATGTTGAATGGCTGGTCAACGACGATGCTGCTAGT
GTGTCGTCGTCTGCCGGGGCCTCTTCTAGCGTCTTGAATGCTGCTGCTCCCGAATTCTCTTCTCTTTCTTCGCAG
CAAACAGACATGTCGCCATACGACATGCTTCGTTCCATTCTTGGCCAGACGAGGACCGACCCCGAAATAGAAGCC
GCTCTATCACTACACGGCTACGACCTTAGTGCAACGATAACGTCGATAATGGAGAGTCAGACCGCCGATGGCGTA
ACCATGGCCACGGCCAATGAAGAGCCCAAGGGCGTGCTCATTGGCAAGTCCATCATGACTGACGCACGTCCTGCA
ACACCTCTTGGGCAGCAAAAGTCTGGCGTCGTCTGCAAATTTTACATGTCGACAGGCCAATGTCTCCGTGCCGAC
TGCCGGTTCAGCCACGATCTGAGCAACTACTTGTGCAAGTACTGGGTCATGGGGAATTGTCTTGCAGGCGACACT
TGCATCTTCTCTCATGATCCAACCAACCTGGTGGGCAAGTTGGGACTGGACGAGGCAGAGGCGGGCACGGGCAGG
AATGATGGGCTTGATGATGGTACCTGGTTCCCAGCCCTGCAGCCCGAGACAAGTGGCACAAAGGGCTCTTCTGCT
GCAGGCGCCTGTGTCGGTGGCCCGTTGGGCGCTCCACCACCCGGCCCCCGACATTTGCAGGGCACCGAGAGTCCC
CGCCTGAGGTCGCGACCAGGCAGCAGACAACAGGTCAAGAACAGCCCCATGTCTGCTCCGGCAATGGACGATAAT
GAAGCCTTCCCGTCTCTTGGAGCGGCCTTGTCCAAGCAAGGCAAGAAGCATCATGGCAAACGGGGCGGCCACGGC
CACGGCCACAAAGAGAACCTGGCCCCTAGCTCACTGGCGGACATTGTCAAGAGGACCCCGTCTCCTGCATCCGGA
CCCTCGCTGCGATCGGAGTCGCGAAGAGCGGGAATGAATGGAAGCGCTGCAGGGCCGCGCAGTGGAGAGAATAGC
GCGGCGGCTTTGGCGATTCCCAGCCCCAAGCATATCCCGTGGCTGGAGACTGGCGAGTGGGCCAATAAGTCGTAT
CTCAAAGCCCGCCAGGACGCCATTAAGCACGGCGGGCTTCGGAACAAGTTCTTGCAAAGTGCTGCACAGGCATGG
AACCGGAACGACGCCAGAGCGGCAAAGGCTCTCAGTCTGCGAGGCCAGAGCGAGAATGACTTGATGCGAAAGGCA
CATCGGGAAGCAGCTCGAGAGTTGTACCAAAAGCGCAACAAGACGGACGTGAACAGCGGGAACGAGATTTTCGTG
GACCTGCACGGGCTACATGCGGAAGAAGCAGTTGAATATCTGGAAAAGGTGCTGCTCGAGAACAGTCGGGAGACG
CAACCCATCTATGCCATTACCGGCACGGGACATCATAGCAAAAACGGCAAGGACAAGGTTGGCCGGACGGTGCGC
GGCTTTCTCAATGAGTGGCGTTATGCCTACCGCGAGTTCTCGGTTCCCGGCGACCGCAACAACATGGGGGGCATC
CTGGGCATTGATGCGCGCAGCTGGGACAAGTCGCTTGGGCGCTTCGAGGAGGACGAGCCCGACATTCTCAGCCAG
GGCGTCGAGATTGGCGATGGCAAGGTGCGGCTTCTGGTACGAGATGCAGCCAAGGGCCCAGGTAGCCGGCGATGA
Transcript >OphauG2|6085
ATGATCTCAGACGAGCACTACGAGCTTTGTCTGCCTATTCTGCAGGATCCAAACCTCGAGGATGAAGATAAGACA
GACAGACTCGAAATAGCGCTCAAAGACGAGACGGGTCTCACGGGCTCGTCGCTCGAAAATATCATCCTTGACGCG
CTCTGGAGATATCGCGAGGTTGGAGGAGGCTCGACATCGCCCCCGCCTATCCGCCCATCAATCCTTCGCCGACCT
TCCCCGGCGTCATGGCGCGGGTCGCCAACTCCTCTGCCGGGATCCCCGCGACTCGGCGTAAGTCCGCTTGCGCCG
GCCGGATACATATCATCGACACTCAACAGAGCAAAATCGTCGACAGCGTCTCCCTTTTCCTCCCCGCGGGCATCC
CCGCGCCTAGCTCTTGCGACCCCAGTGATACCGCACAGTCCGAATCTTAATGCCTACGAGTTTGCGTCAGACCCT
ACTCCGCCCACGGAAATACTGGGCGACTACCAGATGGAAAATGTTGAATGGCTGGTCAACGACGATGCTGCTAGT
GTGTCGTCGTCTGCCGGGGCCTCTTCTAGCGTCTTGAATGCTGCTGCTCCCGAATTCTCTTCTCTTTCTTCGCAG
CAAACAGACATGTCGCCATACGACATGCTTCGTTCCATTCTTGGCCAGACGAGGACCGACCCCGAAATAGAAGCC
GCTCTATCACTACACGGCTACGACCTTAGTGCAACGATAACGTCGATAATGGAGAGTCAGACCGCCGATGGCGTA
ACCATGGCCACGGCCAATGAAGAGCCCAAGGGCGTGCTCATTGGCAAGTCCATCATGACTGACGCACGTCCTGCA
ACACCTCTTGGGCAGCAAAAGTCTGGCGTCGTCTGCAAATTTTACATGTCGACAGGCCAATGTCTCCGTGCCGAC
TGCCGGTTCAGCCACGATCTGAGCAACTACTTGTGCAAGTACTGGGTCATGGGGAATTGTCTTGCAGGCGACACT
TGCATCTTCTCTCATGATCCAACCAACCTGGTGGGCAAGTTGGGACTGGACGAGGCAGAGGCGGGCACGGGCAGG
AATGATGGGCTTGATGATGGTACCTGGTTCCCAGCCCTGCAGCCCGAGACAAGTGGCACAAAGGGCTCTTCTGCT
GCAGGCGCCTGTGTCGGTGGCCCGTTGGGCGCTCCACCACCCGGCCCCCGACATTTGCAGGGCACCGAGAGTCCC
CGCCTGAGGTCGCGACCAGGCAGCAGACAACAGGTCAAGAACAGCCCCATGTCTGCTCCGGCAATGGACGATAAT
GAAGCCTTCCCGTCTCTTGGAGCGGCCTTGTCCAAGCAAGGCAAGAAGCATCATGGCAAACGGGGCGGCCACGGC
CACGGCCACAAAGAGAACCTGGCCCCTAGCTCACTGGCGGACATTGTCAAGAGGACCCCGTCTCCTGCATCCGGA
CCCTCGCTGCGATCGGAGTCGCGAAGAGCGGGAATGAATGGAAGCGCTGCAGGGCCGCGCAGTGGAGAGAATAGC
GCGGCGGCTTTGGCGATTCCCAGCCCCAAGCATATCCCGTGGCTGGAGACTGGCGAGTGGGCCAATAAGTCGTAT
CTCAAAGCCCGCCAGGACGCCATTAAGCACGGCGGGCTTCGGAACAAGTTCTTGCAAAGTGCTGCACAGGCATGG
AACCGGAACGACGCCAGAGCGGCAAAGGCTCTCAGTCTGCGAGGCCAGAGCGAGAATGACTTGATGCGAAAGGCA
CATCGGGAAGCAGCTCGAGAGTTGTACCAAAAGCGCAACAAGACGGACGTGAACAGCGGGAACGAGATTTTCGTG
GACCTGCACGGGCTACATGCGGAAGAAGCAGTTGAATATCTGGAAAAGGTGCTGCTCGAGAACAGTCGGGAGACG
CAACCCATCTATGCCATTACCGGCACGGGACATCATAGCAAAAACGGCAAGGACAAGGTTGGCCGGACGGTGCGC
GGCTTTCTCAATGAGTGGCGTTATGCCTACCGCGAGTTCTCGGTTCCCGGCGACCGCAACAACATGGGGGGCATC
CTGGGCATTGATGCGCGCAGCTGGGACAAGTCGCTTGGGCGCTTCGAGGAGGACGAGCCCGACATTCTCAGCCAG
GGCGTCGAGATTGGCGATGGCAAGGTGCGGCTTCTGGTACGAGATGCAGCCAAGGGCCCAGGTAGCCGGCGATGA
Gene >OphauG2|6085
ATGATCTCAGACGAGCACTACGAGCTTTGTCTGCCTATTCTGCAGGATCCAAACCTCGAGGATGAAGATAAGACA
GACAGACTCGAAATAGCGCTCAAAGACGAGACGGGTCTCACGGGCTCGTCGCTCGAAAATATCATCCTTGACGCG
CTCTGGAGATATCGCGAGGTTGGAGGAGGCTCGACATCGCCCCCGCCTATCCGCCCATCAATCCTTCGCCGACCT
TCCCCGGCGTCATGGCGCGGGTCGCCAACTCCTCTGCCGGGATCCCCGCGACTCGGCGTAAGTCCGCTTGCGCCG
GCCGGATACATATCATCGACACTCAACAGAGCAAAATCGTCGACAGCGTCTCCCTTTTCCTCCCCGCGGGCATCC
CCGCGCCTAGCTCTTGCGACCCCAGTGATACCGCACAGTCCGAATCTTAATGCCTACGAGTTTGCGTCAGACCCT
ACTCCGCCCACGGAAATACTGGGCGACTACCAGATGGAAAATGTTGAATGGCTGGTCAACGACGATGCTGCTAGT
GTGTCGTCGTCTGCCGGGGCCTCTTCTAGCGTCTTGAATGCTGCTGCTCCCGAATTCTCTTCTCTTTCTTCGCAG
CAAACAGACATGTCGCCATACGACATGCTTCGTTCCATTCTTGGCCAGACGAGGACCGACCCCGAAATAGAAGCC
GCTCTATCACTACACGGCTACGACCTTAGTGCAACGATAACGTCGATAATGGAGAGTCAGACCGCCGATGGCGTA
ACCATGGCCACGGCCAATGAAGAGCCCAAGGGCGTGCTCATTGGCAAGTCCATCATGACTGACGCACGTCCTGCA
ACACCTCTTGGGCAGCAAAAGTCTGGCGTCGTCTGCAAATTTTACATGTCGACAGGCCAATGTCTCCGTGCCGAC
TGCCGGTTCAGCCACGATCTGAGCAACTACTTGTGCAAGTAAGTCCAAGGTATTTGACCTGCTGACCGCGGCGGC
TTGCTAACAGTGTCTTGCCCAGGTACTGGGTCATGGGGAATTGTCTTGCAGGCGACACTTGCATCTTCTCTCATG
ATCCAACCAACCTGGTGGGCAAGTTGGGACTGGACGAGGCAGAGGCGGGCACGGGCAGGAATGATGGGCTTGATG
ATGGTACCTGGTTCCCAGCCCTGCAGCCCGAGACAAGTGGCACAAAGGGCTCTTCTGCTGCAGGCGCCTGTGTCG
GTGGCCCGTTGGGCGCTCCACCACCCGGCCCCCGACATTTGCAGGGCACCGAGAGTCCCCGCCTGAGGTCGCGAC
CAGGCAGCAGACAACAGGTCAAGAACAGCCCCATGTCTGCTCCGGCAATGGACGATAATGAAGCCTTCCCGTCTC
TTGGAGCGGCCTTGTCCAAGCAAGGCAAGAAGCATCATGGCAAACGGGGCGGCCACGGCCACGGCCACAAAGAGA
ACCTGGCCCCTAGCTCACTGGCGGACATTGTCAAGAGGACCCCGTCTCCTGCATCCGGACCCTCGCTGCGATCGG
AGTCGCGAAGAGCGGGAATGAATGGAAGCGCTGCAGGGCCGCGCAGTGGAGAGAATAGCGCGGCGGCTTTGGCGA
TTCCCAGCCCCAAGCATATCCCGTGGCTGGAGACTGGCGAGTGGGCCAATAAGTCGTATCTCAAAGCCCGCCAGG
ACGCCATTAAGCACGGCGGGCTTCGGAACAAGTTCTTGCAAAGGTCAGTGGAACTCGACTTGTTTGTTGGACTTG
GGGTTAACACTAGGCGGGGATAGTGCTGCACAGGCATGGAACCGGAACGACGCCAGAGCGGCAAAGGCTCTCAGT
CTGCGAGGCCAGAGCGAGAATGACTTGATGCGAAAGGCACATCGGGAAGCAGCTCGAGAGTTGTACCAAAAGCGC
AACAAGACGGACGTGAACAGCGGGAACGAGATTTTCGTGGACCTGCACGGGCTACATGCGGAAGAAGCAGTTGAA
TATCTGGAAAAGGTGCTGCTCGAGAACAGTCGGGAGACGCAACCCATCTATGCCATTACCGGCACGGGACATCAT
AGCAAAAACGGCAAGGACAAGGTTGGCCGGACGGTGCGCGGCTTTCTCAATGAGTGGCGTTATGCCTACCGCGAG
TTCTCGGTTCCCGGCGACCGCAACAACATGGGGGGCATCCTGGGCATTGATGCGCGCAGCTGGGACAAGTCGCTT
GGGCGCTTCGAGGAGGACGAGCCCGACATTCTCAGCCAGGGCGTCGAGATTGGCGATGGCAAGGTGCGGCTTCTG
GTACGAGATGCAGCCAAGGGCCCAGGTAGCCGGCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail